BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781022|ref|YP_003065435.1| hypothetical protein CLIBASIA_04620 [Candidatus Liberibacter asiaticus str. psy62] (163 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781022|ref|YP_003065435.1| hypothetical protein CLIBASIA_04620 [Candidatus Liberibacter asiaticus str. psy62] Length = 163 Score = 327 bits (838), Expect = 7e-92, Method: Compositional matrix adjust. Identities = 163/163 (100%), Positives = 163/163 (100%) Query: 1 MTYEGHCIFALASVILAKKVNFLSSFTDAEWGTVVLGALLSCLLPDIDHPRSFISKRFKT 60 MTYEGHCIFALASVILAKKVNFLSSFTDAEWGTVVLGALLSCLLPDIDHPRSFISKRFKT Sbjct: 1 MTYEGHCIFALASVILAKKVNFLSSFTDAEWGTVVLGALLSCLLPDIDHPRSFISKRFKT 60 Query: 61 LSLLTSCISSHRGFTHSILAVILYKWLIHHFFPSELISYQGLQDALIIGYVSHLVADVLT 120 LSLLTSCISSHRGFTHSILAVILYKWLIHHFFPSELISYQGLQDALIIGYVSHLVADVLT Sbjct: 61 LSLLTSCISSHRGFTHSILAVILYKWLIHHFFPSELISYQGLQDALIIGYVSHLVADVLT 120 Query: 121 PTGIPLLWPYHWRFCLPILHPNSPIGEIFFCVLFLIYAIISVH 163 PTGIPLLWPYHWRFCLPILHPNSPIGEIFFCVLFLIYAIISVH Sbjct: 121 PTGIPLLWPYHWRFCLPILHPNSPIGEIFFCVLFLIYAIISVH 163 >gi|254781175|ref|YP_003065588.1| UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Candidatus Liberibacter asiaticus str. psy62] Length = 296 Score = 23.5 bits (49), Expect = 1.9, Method: Compositional matrix adjust. Identities = 10/23 (43%), Positives = 15/23 (65%) Query: 104 DALIIGYVSHLVADVLTPTGIPL 126 + L IG + H +AD +T TGI + Sbjct: 2 EMLQIGRLQHTIADSITITGIGI 24 >gi|254780166|ref|YP_003064579.1| hydrolase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 261 Score = 22.3 bits (46), Expect = 4.0, Method: Compositional matrix adjust. Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 13/69 (18%) Query: 13 SVILAKKVNFLSSFTDAEWGTVVLGALLSCLLPDIDHPRSFISKRFKT---------LSL 63 SVIL + L +W +++ S LLP ID ++ + K+F+ L Sbjct: 125 SVILGGVGSVLYDSDVVDWQSLID----SFLLPSIDEVQNPLGKKFRKFADLDPGNDLKA 180 Query: 64 LTSCISSHR 72 L SC+S R Sbjct: 181 LASCLSMIR 189 >gi|255764505|ref|YP_003065248.2| polysialic acid capsule expression protein [Candidatus Liberibacter asiaticus str. psy62] Length = 341 Score = 21.2 bits (43), Expect = 8.8, Method: Compositional matrix adjust. Identities = 7/25 (28%), Positives = 15/25 (60%) Query: 138 ILHPNSPIGEIFFCVLFLIYAIISV 162 +LHP +G +F C ++++ S+ Sbjct: 206 VLHPGGKLGTLFVCASDVMHSGDSI 230 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.331 0.145 0.478 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 112,712 Number of Sequences: 1233 Number of extensions: 4533 Number of successful extensions: 10 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 8 length of query: 163 length of database: 328,796 effective HSP length: 67 effective length of query: 96 effective length of database: 246,185 effective search space: 23633760 effective search space used: 23633760 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 35 (18.1 bits)