RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781024|ref|YP_003065437.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Candidatus Liberibacter asiaticus str. psy62] (554 letters) >gnl|CDD|37626 KOG2415, KOG2415, KOG2415, Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion]. Length = 621 Score = 575 bits (1483), Expect = e-164 Identities = 253/557 (45%), Positives = 360/557 (64%), Gaps = 19/557 (3%) Query: 10 KDVFEYDVVIIGAGPAGLAAAIRCKQI----NPHLSVVILEKSAEVGAHILSGAIIDPIG 65 ++ E DVVI+GAGPAGL+AAIR KQ+ N L V ++EK+AEVG H LSGA+I+P Sbjct: 72 RESEEVDVVIVGAGPAGLSAAIRLKQLAAKANKDLRVCVVEKAAEVGGHTLSGAVIEPGA 131 Query: 66 IDSLLPRWREDKGHPFHTVVKRDLYWFLNAQRSIQIPHFCLPDFMDNKEHYIVSLGQVCR 125 +D LLP W+ED G P +T V D + FL + I +P +P MDN +Y+VSLGQ+ R Sbjct: 132 LDELLPDWKED-GAPLNTPVTSDKFKFLTGKGRISVP---VPSPMDNHGNYVVSLGQLVR 187 Query: 126 WLKNKAEALGVEIYCGFTATEIYYGKKGEALGILTGEKGKNYDGTQGKHYIAPMLLLSKY 185 WL KAE LGVEIY GF A+E+ Y + G GI T + G + DG + M +K Sbjct: 188 WLGEKAEELGVEIYPGFAASEVLYDEDGSVKGIATNDVGISKDGAPKDTFERGMEFHAKV 247 Query: 186 MLVGEGACGSLTRQLIERYSLMDGRQPQKFGLGIKELWKIKPQYHRRGLALHSIGWPLDM 245 + EG GSL++Q+I+++ L + +PQ +GLG+KE+W+I P+ H G H++GWPLD Sbjct: 248 TIFAEGCHGSLSKQIIKKFDLRENCEPQTYGLGLKEVWEIDPENHNPGEVAHTLGWPLDN 307 Query: 246 NTSGGGFVYHFDDNLVSIGFVLHLDYRNPWISAYEELQRFKTHPDIRIIFTEGERLEYGA 305 +T GG F+YHF+D LV++G V+ LDY+NP++S Y+E Q+ K HP I + G+R+ YGA Sbjct: 308 DTYGGSFLYHFNDPLVAVGLVVGLDYKNPYLSPYKEFQKMKHHPSISKVLEGGKRIAYGA 367 Query: 306 RVISEGGWQSVPKLSFPGGSLIGCAAGFVNLLRIKGSHNAIISGMLAAEKIVERLSNGKK 365 R ++EGG+QS+PKL FPGG+LIGC+AGF+N+ +IKG+H A+ SGMLAAE I E + + Sbjct: 368 RALNEGGFQSIPKLVFPGGALIGCSAGFLNVPKIKGTHTAMKSGMLAAESIFEAIKGLPQ 427 Query: 366 HD----DPIEIEDSWRQTQIGKDLWIIRNIKPLLSRF-GVFIGLSLGLMDIWIQKILGFS 420 DP E++ + + + K+L+ +RNI+P G++ G+ + + +L Sbjct: 428 SKMAGLDPTTYEENLKDSYVWKELYSVRNIRPSFHGKLGLYGGMIYSGIFSY---VLKGK 484 Query: 421 FLGTLKHHKMDSCSLEAASQHKKIDYPKPDGKLTFDIMSSLFLAKVKYVKEQPMHLLIKD 480 TLKH K D +L+ AS++K I YPKPDG L+FD+++S+ + + ++QP HL ++D Sbjct: 485 VPWTLKHGKNDHEALKPASKYKPIVYPKPDGVLSFDLLTSVSRSGTNHDEDQPAHLTLRD 544 Query: 481 KDLQKKSELRIYSGPSMRYCPAGVYEWHQNNDENN---YIIHAQNCIHCKACVIKDPNQN 537 D+ K +Y GP R+CPAGVYE+ + I+AQNCIHCK C IKDP QN Sbjct: 545 DDIPVKVNFPVYKGPESRFCPAGVYEYVPDEAGPVGKRLQINAQNCIHCKTCDIKDPKQN 604 Query: 538 IEWNPPQGGDGPHYVDM 554 I W P+GG GP Y M Sbjct: 605 INWVVPEGGGGPKYTLM 621 >gnl|CDD|30989 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion]. Length = 396 Score = 254 bits (649), Expect = 5e-68 Identities = 134/454 (29%), Positives = 205/454 (45%), Gaps = 63/454 (13%) Query: 13 FEYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHILSGAIIDPIGIDSLLPR 72 EYDVVI+GAGPAG +AA R + L V++LEK +E GA G + P ++ L+P Sbjct: 2 MEYDVVIVGAGPAGSSAARRLAKAG--LDVLVLEKGSEPGAKPCCGGGLSPRALEELIPD 59 Query: 73 WREDKGHPFHTVVKRDLYWFLNAQRSIQIPHFCLPDFMDNKEHYIVSLGQVCRWLKNKAE 132 + E+ V +F + +I++P E YIV + +WL +AE Sbjct: 60 FDEE----IERKVTGARIYFPGEKVAIEVPV---------GEGYIVDRAKFDKWLAERAE 106 Query: 133 ALGVEIYCGFTATEIYYGKKGEALGILTGEKGKNYDGTQGKHYIAPMLLLSKYMLVGEGA 192 G E+Y G T + G +G+ G+ + +K ++ +G Sbjct: 107 EAGAELYPGTRVTGVIREDDGVVVGVRAGD----------------DEVRAKVVIDADGV 150 Query: 193 CGSLTRQLIERYSLMDGRQPQKFGLGIKELWKIKPQYHRRGLALHSIGWPLDMNTSGGGF 252 +L R+L + R+P+ + +G+KE+ ++ G + PLD+ G G+ Sbjct: 151 NSALARKLG-----LKDRKPEDYAIGVKEVIEV----PDDGDVEEFLYGPLDVGPGGYGW 201 Query: 253 VYHFDDNLVSIGFVLHLDYRNPWISAYEELQRFKTHPDIRIIFTEGERLEYGARVISEGG 312 ++ D ++G + LD + E L+RFK HP IR + G+ LEY A I EGG Sbjct: 202 IFPLGDGHANVGIGVLLDDPSLSPF-LELLERFKEHPAIRKLLLGGKILEYAAGGIPEGG 260 Query: 313 WQSVPKLSFPGGSLIGCAAGFVNLLRIKGSHNAIISGMLAAEKIVERLSNGKKHDDPIEI 372 S P L G L+G AAGFVN L +G AI SG LAAE I E L G+ + E Sbjct: 261 PASRP-LVGDGVLLVGDAAGFVNPLTGEGIRYAIKSGKLAAEAIAEALEGGE--EALAEY 317 Query: 373 EDSWRQTQIGKDLWIIRNIKPLLSRFGVFIGLSLGLMDIWIQKILGFSFLGTLKHHKMDS 432 E R++ +DL +R +K LL + I+ + LG +K + Sbjct: 318 ERLLRKSLAREDLKSLRLLKLLLRLL-------DRTLPALIKLLADKDLLGLIKKYL--- 367 Query: 433 CSLEAASQHKKIDYPKPDGKLT-FDIMSSLFLAK 465 K I YP G L FD++ S+ + Sbjct: 368 --------RKLILYPLLKGVLARFDLLKSVKRSL 393 >gnl|CDD|147396 pfam05187, ETF_QO, Electron transfer flavoprotein-ubiquinone oxidoreductase. Electron-transfer flavoprotein-ubiquinone oxidoreductase (ETF-QO) in the inner mitochondrial membrane accepts electrons from electron-transfer flavoprotein which is located in the mitochondrial matrix and reduces ubiquinone in the mitochondrial membrane. The two redox centres in the protein, FAD and a [4Fe4S] cluster, are present in a 64-kDa monomer. Length = 110 Score = 133 bits (338), Expect = 9e-32 Identities = 55/113 (48%), Positives = 75/113 (66%), Gaps = 3/113 (2%) Query: 399 GVFIGLSLGLMDIWIQKILGFSFLGTLKHHKMDSCSLEAASQHKKIDYPKPDGKLTFDIM 458 G+++GL+ +D WI + G S TLKHHK D +L+ AS+ K IDYPKPDGKLTFD + Sbjct: 1 GLWLGLAYAGLDQWILR--GKSPW-TLKHHKPDHAALKPASECKPIDYPKPDGKLTFDRL 57 Query: 459 SSLFLAKVKYVKEQPMHLLIKDKDLQKKSELRIYSGPSMRYCPAGVYEWHQNN 511 SS+FL+ + ++QP HL +KD + L Y+GP RYCPAGVYE ++ Sbjct: 58 SSVFLSNTNHEEDQPCHLKLKDPSVPIAVNLPKYAGPEQRYCPAGVYEIVEDE 110 >gnl|CDD|30999 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion]. Length = 387 Score = 57.4 bits (138), Expect = 9e-09 Identities = 32/139 (23%), Positives = 49/139 (35%), Gaps = 16/139 (11%) Query: 15 YDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHILSGAIIDPIGIDSL----- 69 DV I+GAGPAGLA A+ + L V +LE++ G + P + +L Sbjct: 3 LDVAIVGAGPAGLALALALARAG--LDVTLLERAPRELLERGRGIALSPNALRALERLGL 60 Query: 70 LPRWREDKGHPFHTVVKRDLYWFLNAQRSIQIPHFCLPDFMDNKEHYIVSLGQVCRWLKN 129 R P H + +R + F + Y+V + L Sbjct: 61 WDRLEALGVPPLHV-----MVVDDGGRRLL---IFDAAELGRGALGYVVPRSDLLNALLE 112 Query: 130 KAEALG-VEIYCGFTATEI 147 A AL V + G + Sbjct: 113 AARALPNVTLRFGAEVEAV 131 >gnl|CDD|32561 COG2440, FixX, Ferredoxin-like protein [Energy production and conversion]. Length = 99 Score = 53.4 bits (128), Expect = 2e-07 Identities = 26/99 (26%), Positives = 47/99 (47%), Gaps = 9/99 (9%) Query: 454 TFDIMSSLFLAKVKYVKEQPMHLLIKDKDLQKKSELRIYSGPSMRYCPAGVYEWHQNNDE 513 +I L + + ++ P H+++KD D ++ E + P ++ CPAG Y+ D+ Sbjct: 6 MMNIEEKLSVNRYNVDEDHP-HIIVKDPDDCQECEDK----PLIKACPAGCYKL---IDD 57 Query: 514 NNYIIHAQNCIHCKAC-VIKDPNQNIEWNPPQGGDGPHY 551 + C+ C C V+ + I+W P+GG G Y Sbjct: 58 GKLRFDYEGCLECGTCRVLCPHSGLIQWRYPRGGFGITY 96 >gnl|CDD|31441 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion]. Length = 454 Score = 51.4 bits (123), Expect = 6e-07 Identities = 22/40 (55%), Positives = 27/40 (67%), Gaps = 2/40 (5%) Query: 13 FEYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVG 52 EYDVV+IGAGPAG AAIR Q+ L V ++EK +G Sbjct: 3 KEYDVVVIGAGPAGYVAAIRAAQL--GLKVALVEKGERLG 40 >gnl|CDD|36549 KOG1335, KOG1335, KOG1335, Dihydrolipoamide dehydrogenase [Energy production and conversion]. Length = 506 Score = 50.3 bits (120), Expect = 1e-06 Identities = 38/156 (24%), Positives = 60/156 (38%), Gaps = 26/156 (16%) Query: 14 EYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHILS-GAIIDPIGIDSLLPR 72 +YDVV+IG GP G AAI+ Q+ L +EK +G L+ G I +LL Sbjct: 39 DYDVVVIGGGPGGYVAAIKAAQLG--LKTACVEKRGTLGGTCLNVGCIPS----KALL-- 90 Query: 73 WREDKGHPFHTVVKRDLYWFLNAQRSIQIP--HFCLPDFMDNKEHYIVSLGQVCRWLKNK 130 + H +H D A R I + L M K++ + L ++N Sbjct: 91 ---NNSHLYHEAQHEDF-----ASRGIDVSSVSLDLQAMMKAKDNAVKQLTGG---IENL 139 Query: 131 AEALGVEIYCGFTA----TEIYYGKKGEALGILTGE 162 + V GF + ++ K I+ + Sbjct: 140 FKKNKVTYVKGFGSFLDPNKVSVKKIDGEDQIIKAK 175 >gnl|CDD|146239 pfam03486, HI0933_like, HI0933-like protein. Length = 405 Score = 50.3 bits (121), Expect = 2e-06 Identities = 20/45 (44%), Positives = 28/45 (62%), Gaps = 3/45 (6%) Query: 15 YDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHIL-SG 58 YDV++IG G AGL AAI + V+++EK ++G IL SG Sbjct: 1 YDVIVIGGGAAGLMAAISAAK--RGRRVLLIEKGKKLGRKILISG 43 >gnl|CDD|144475 pfam00890, FAD_binding_2, FAD binding domain. This family includes members that bind FAD. This family includes the flavoprotein subunits from succinate and fumarate dehydrogenase, aspartate oxidase and the alpha subunit of adenylylsulphate reductase. Length = 401 Score = 50.0 bits (120), Expect = 2e-06 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Query: 16 DVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHI 55 DVV+IG+G AGLAAA+ + L V ++EK G Sbjct: 1 DVVVIGSGLAGLAAALEAAE--AGLKVAVVEKGQPFGGAT 38 >gnl|CDD|31425 COG1232, HemY, Protoporphyrinogen oxidase [Coenzyme metabolism]. Length = 444 Score = 49.5 bits (118), Expect = 2e-06 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 5/63 (7%) Query: 17 VVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHILS----GAIIDPIGIDSLLPR 72 + IIG G AGL+AA R ++ P + V + E VG + + G + + G L R Sbjct: 3 IAIIGGGIAGLSAAYRLQKAGPDVEVTLFEADDRVGGLLRTVKIDGFLFE-RGPHHFLAR 61 Query: 73 WRE 75 E Sbjct: 62 KEE 64 >gnl|CDD|31253 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion]. Length = 562 Score = 48.4 bits (115), Expect = 4e-06 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Query: 12 VFEYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAH 54 + E+DVV+IG G AGL AAI + L V +L K+ H Sbjct: 4 IHEFDVVVIGGGGAGLRAAIEAAEAG--LKVALLSKAPPKRGH 44 >gnl|CDD|30838 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones]. Length = 305 Score = 48.0 bits (114), Expect = 8e-06 Identities = 19/39 (48%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Query: 14 EYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVG 52 YDV+IIG GPAGL AAI + L VV++ + E G Sbjct: 3 IYDVIIIGGGPAGLTAAIYAARAG--LKVVLILEGGEPG 39 >gnl|CDD|32255 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism]. Length = 443 Score = 46.6 bits (110), Expect = 2e-05 Identities = 20/38 (52%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Query: 15 YDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVG 52 DV IIGAG +GLAAA KQ VI EK +VG Sbjct: 9 TDVAIIGAGQSGLAAAYALKQAGVP-DFVIFEKRDDVG 45 >gnl|CDD|36613 KOG1399, KOG1399, KOG1399, Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism]. Length = 448 Score = 46.5 bits (110), Expect = 2e-05 Identities = 28/139 (20%), Positives = 51/139 (36%), Gaps = 23/139 (16%) Query: 16 DVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHILSGAIIDPIGIDSLLPRWRE 75 DV +IGAGPAGLAAA + VV+ E++ ++G ++ E Sbjct: 8 DVAVIGAGPAGLAAARELLR--EGHEVVVFERTDDIGGLW----------------KYTE 49 Query: 76 DKGHPFHTVVKRDLYWFLNAQRSIQIPHFCLPDFMDNKEHYIVSLGQVCRWLKNKAEALG 135 + +V K L ++ + F + Y S +V +L++ A+ Sbjct: 50 NVEVVHSSVYKS-----LRTNLPKEMMGYSDFPFPERDPRYFPSHREVLEYLRDYAKHFD 104 Query: 136 VEIYCGFTATEIYYGKKGE 154 + F + + Sbjct: 105 LLKMINFNTEVVRVDSIDK 123 >gnl|CDD|31426 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]. Length = 487 Score = 46.6 bits (110), Expect = 2e-05 Identities = 20/39 (51%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Query: 14 EYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVG 52 YDVV+IGAG GLAAA + L V +LEK+ VG Sbjct: 3 MYDVVVIGAGLNGLAAAALLARAG--LKVTVLEKNDRVG 39 >gnl|CDD|144747 pfam01266, DAO, FAD dependent oxidoreductase. This family includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase EC:1.1.99.5, Sarcosine oxidase beta subunit EC:1.5.3.1, D-alanine oxidase EC:1.4.99.1, D-aspartate oxidase EC:1.4.3.1. Length = 309 Score = 45.4 bits (108), Expect = 4e-05 Identities = 41/176 (23%), Positives = 65/176 (36%), Gaps = 47/176 (26%) Query: 16 DVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAH--------ILSGAIIDP---- 63 DVV+IG G GL+ A + LSV +LE+ ++ + + G + Sbjct: 1 DVVVIGGGIVGLSTAYELAR--RGLSVTLLER-GDLASGASGRNAGLLHPGLRKERAPLL 57 Query: 64 --IGIDS--LLPRWREDKGHPFHT------VVKRD------LYWFLNAQRSIQIPHFCL- 106 + ++S L E+ G V+ RD L A R++ +P L Sbjct: 58 ARLALESRDLWRELIEELGIDCDFRRTGVLVLARDEAELDALRRLAAALRALGLPVELLD 117 Query: 107 PDFMDNKEHYI---------------VSLGQVCRWLKNKAEALGVEIYCGFTATEI 147 + + E + V ++ R L AEALGVEI G T + Sbjct: 118 AEELRELEPGLSPGIRGGLFYPDGGHVDPARLLRALARAAEALGVEILEGTEVTGL 173 >gnl|CDD|30924 COG0579, COG0579, Predicted dehydrogenase [General function prediction only]. Length = 429 Score = 44.9 bits (106), Expect = 6e-05 Identities = 19/41 (46%), Positives = 22/41 (53%) Query: 14 EYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAH 54 +YDVVIIG G G A A + P LSV +LEK V Sbjct: 3 DYDVVIIGGGIMGAATAYELSEYEPDLSVALLEKEDGVAQE 43 >gnl|CDD|32264 COG2081, COG2081, Predicted flavoproteins [General function prediction only]. Length = 408 Score = 43.2 bits (102), Expect = 2e-04 Identities = 18/42 (42%), Positives = 27/42 (64%), Gaps = 2/42 (4%) Query: 15 YDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHIL 56 +DV+IIG GPAGL AAI + V++++K ++G IL Sbjct: 4 FDVIIIGGGPAGLMAAISAAK--AGRRVLLIDKGPKLGRKIL 43 >gnl|CDD|38171 KOG2960, KOG2960, KOG2960, Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only]. Length = 328 Score = 41.2 bits (96), Expect = 8e-04 Identities = 20/39 (51%), Positives = 24/39 (61%) Query: 14 EYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVG 52 E DVVI+GAG AGL+AA + P L V I+E S G Sbjct: 76 ESDVVIVGAGSAGLSAAYVIAKNRPDLKVAIIESSVAPG 114 >gnl|CDD|35252 KOG0029, KOG0029, KOG0029, Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism]. Length = 501 Score = 41.1 bits (96), Expect = 9e-04 Identities = 19/70 (27%), Positives = 34/70 (48%), Gaps = 21/70 (30%) Query: 15 YDVVIIGAGPAGLAAAIRCKQI-NPHLSVVILEKS-----------------AEVGAHIL 56 V++IGAG AGL+AA +Q+ + V++LE ++GA +L Sbjct: 16 KKVIVIGAGLAGLSAA---RQLQDFGFDVLVLEARDRVGGRIYTFKSEGGDHVDLGASVL 72 Query: 57 SGAIIDPIGI 66 +G +P+ + Sbjct: 73 TGVYNNPLAL 82 >gnl|CDD|31822 COG1635, THI4, Flavoprotein involved in thiazole biosynthesis [Coenzyme metabolism]. Length = 262 Score = 40.6 bits (95), Expect = 0.001 Identities = 44/215 (20%), Positives = 77/215 (35%), Gaps = 39/215 (18%) Query: 10 KDVFEYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHILSGAIIDPIGIDSL 69 D E DV+I+GAGP+GL AA + L V I E+ G I G + L Sbjct: 26 LDYLESDVIIVGAGPSGLTAAYYLAKAG--LKVAIFERKLSFGGGIWGGGM--------L 75 Query: 70 LPRWREDKGHPFHTVVKRDLYWFLNAQRSIQIPHFCLPDFMDNKEHYIVSLGQVCRWLKN 129 + VV+ + L I + D +Y+ + L Sbjct: 76 FNK----------IVVREEADEIL---DEFGIR---YEEEEDG--YYVADSAEFASKLAA 117 Query: 130 KAEALGVEIYCGFTATEIYYGKKGEALGILTGEKGKNYDGTQGKH-YIAPMLLLSKYMLV 188 +A G +I+ G + ++ G++ N+ Q ++ P+ + +K ++ Sbjct: 118 RALDAGAKIFNGVSVEDVIVRDDPRVAGVVV-----NWTPVQMAGLHVDPLTIRAKAVVD 172 Query: 189 GEGACGSLTRQLIERYSLMDGRQPQKFGLGIKELW 223 G + L +R + P G K +W Sbjct: 173 ATGHDAEVVSFLAKRIPELGIEVP-----GEKSMW 202 >gnl|CDD|30795 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only]. Length = 415 Score = 39.1 bits (90), Expect = 0.003 Identities = 9/32 (28%), Positives = 19/32 (59%) Query: 17 VVIIGAGPAGLAAAIRCKQINPHLSVVILEKS 48 +VI+G G AGL+AA +++ + ++ + Sbjct: 1 IVIVGGGAAGLSAATTLRRLLLAAEITLIGRE 32 Score = 36.1 bits (82), Expect = 0.027 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Query: 16 DVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHILSGAIIDPI 64 DVV++GAGP GL AA + V ++E + +G +L + + + Sbjct: 138 DVVVVGAGPIGLEAAEAAAKRG--KKVTLIEAADRLGGQLLDPEVAEEL 184 >gnl|CDD|31009 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism]. Length = 387 Score = 38.7 bits (89), Expect = 0.004 Identities = 19/63 (30%), Positives = 25/63 (39%), Gaps = 4/63 (6%) Query: 14 EYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKS--AEVGAHILSGAIIDPIGIDSLLP 71 + DVVIIG G GL+AA + V +LE A +G I+ P Sbjct: 4 KMDVVIIGGGIVGLSAAYYLAER--GADVTVLEAGEAGGGAAGRNAGGILAPWASPGGEL 61 Query: 72 RWR 74 R Sbjct: 62 EVR 64 >gnl|CDD|37876 KOG2665, KOG2665, KOG2665, Predicted FAD-dependent oxidoreductase [Function unknown]. Length = 453 Score = 38.4 bits (89), Expect = 0.005 Identities = 16/41 (39%), Positives = 23/41 (56%) Query: 14 EYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAH 54 YD+V++G G GLA+A +P L V +LEK + H Sbjct: 48 RYDLVVVGGGIVGLASARELSLRHPSLKVAVLEKEKSLAVH 88 >gnl|CDD|145231 pfam01946, Thi4, Thi4 family. This family includes a putative thiamine biosynthetic enzyme. Length = 229 Score = 37.4 bits (87), Expect = 0.010 Identities = 21/48 (43%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Query: 11 DVFEYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHILSG 58 D E DVVI+GAGP+GL AA + L V I+E+S G G Sbjct: 14 DYAESDVVIVGAGPSGLTAAYYLAKKG--LKVAIIERSLSPGGGAWGG 59 >gnl|CDD|30379 COG0029, NadB, Aspartate oxidase [Coenzyme metabolism]. Length = 518 Score = 36.8 bits (85), Expect = 0.014 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Query: 9 NKDVFEYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSA 49 N D DV+IIG+G AGL AA+ P V +L K Sbjct: 2 NTDFEHPDVLIIGSGLAGLTAALSLA---PSFRVTVLTKGP 39 >gnl|CDD|30839 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only]. Length = 457 Score = 36.1 bits (83), Expect = 0.024 Identities = 24/77 (31%), Positives = 32/77 (41%), Gaps = 8/77 (10%) Query: 16 DVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHILSGAIIDPIGIDSLLPRWR- 74 V +IGAGPAGLAAA + V + E+ A G +L G I + + R Sbjct: 125 KVAVIGAGPAGLAAADDLSRAG--HDVTVFERVALDGGLLLYG--IPDFKLPKDILDRRL 180 Query: 75 ---EDKGHPFHTVVKRD 88 E G F V+ Sbjct: 181 ELLERSGVEFKLNVRVG 197 >gnl|CDD|35904 KOG0685, KOG0685, KOG0685, Flavin-containing amine oxidase [Coenzyme transport and metabolism]. Length = 498 Score = 36.1 bits (83), Expect = 0.027 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 3/42 (7%) Query: 17 VVIIGAGPAGLAAAIR-CKQINPHLSVVILEKSAEVGAHILS 57 +VIIGAG AGLAAA R + + ILE S +G I + Sbjct: 24 IVIIGAGIAGLAAATRLLENGFIDVL--ILEASDRIGGRIHT 63 >gnl|CDD|31342 COG1148, HdrA, Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion]. Length = 622 Score = 36.1 bits (83), Expect = 0.027 Identities = 19/68 (27%), Positives = 29/68 (42%), Gaps = 5/68 (7%) Query: 16 DVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHILSGAIIDPI---GIDSLLPR 72 V++IG G AG+ AA+ + V ++EK +G + P I L P+ Sbjct: 126 SVLVIGGGVAGITAALELADMG--FKVYLVEKEPSIGGRMAKLNKTFPTNDCSICILAPK 183 Query: 73 WREDKGHP 80 E HP Sbjct: 184 MVEVSNHP 191 >gnl|CDD|36452 KOG1238, KOG1238, KOG1238, Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only]. Length = 623 Score = 35.7 bits (82), Expect = 0.033 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 13 FEYDVVIIGAGPAGLAAAIRCKQINPHLSVVILE 46 YD +++G G AG A R + NP+ SV++LE Sbjct: 56 SSYDYIVVGGGTAGCVLAARLSE-NPNWSVLLLE 88 >gnl|CDD|32458 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism]. Length = 542 Score = 35.9 bits (82), Expect = 0.034 Identities = 23/65 (35%), Positives = 29/65 (44%), Gaps = 6/65 (9%) Query: 14 EYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHILSGAIIDPIGIDSLLPRW 73 EYD VI+G+G AG A R + LSV++L E G I P L+ Sbjct: 7 EYDYVIVGSGSAGSVLAARLS--DAGLSVLVL----EAGGPDRRPLIQMPAAYAFLMNGP 60 Query: 74 REDKG 78 R D G Sbjct: 61 RYDWG 65 >gnl|CDD|31341 COG1146, COG1146, Ferredoxin [Energy production and conversion]. Length = 68 Score = 35.5 bits (81), Expect = 0.041 Identities = 12/49 (24%), Positives = 22/49 (44%) Query: 500 CPAGVYEWHQNNDENNYIIHAQNCIHCKACVIKDPNQNIEWNPPQGGDG 548 CPAGV++ ++ + + CI C C + P I+ + + G Sbjct: 20 CPAGVFDLGEDEGGKPVVARPEECIDCGLCELACPVGAIKVDILRPGKQ 68 >gnl|CDD|33187 COG3380, COG3380, Predicted NAD/FAD-dependent oxidoreductase [General function prediction only]. Length = 331 Score = 35.3 bits (81), Expect = 0.042 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Query: 16 DVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHILS 57 + I+GAG AGLAAA ++ V + EK VG + + Sbjct: 3 SIAIVGAGIAGLAAAYALREAG--REVTVFEKGRGVGGRLAT 42 >gnl|CDD|32889 COG3075, GlpB, Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism]. Length = 421 Score = 34.9 bits (80), Expect = 0.060 Identities = 21/81 (25%), Positives = 36/81 (44%), Gaps = 13/81 (16%) Query: 14 EYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSA--------EVGAHILSGAIIDPI- 64 +DV IIG G AGL + +Q ++V +SA ++ + G + I Sbjct: 2 NFDVAIIGGGLAGLTCGLALQQAGKRCAIVNRGQSALHFSSGSLDLLGRLPDGQAVTDIH 61 Query: 65 -GIDSLLPRWREDKGHPFHTV 84 G+D+L ++ HP+ V Sbjct: 62 DGLDAL---RQQAPAHPYSLV 79 >gnl|CDD|144912 pfam01494, FAD_binding_3, FAD binding domain. This domain is involved in FAD binding in a number of enzymes. Length = 349 Score = 34.6 bits (80), Expect = 0.064 Identities = 11/18 (61%), Positives = 14/18 (77%) Query: 14 EYDVVIIGAGPAGLAAAI 31 E DV+I+G GPAGL A+ Sbjct: 1 ETDVLIVGGGPAGLMLAL 18 >gnl|CDD|31424 COG1231, COG1231, Monoamine oxidase [Amino acid transport and metabolism]. Length = 450 Score = 34.6 bits (79), Expect = 0.073 Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Query: 16 DVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHILSG 58 DV+I+GAG AGL+AA K+ V ILE VG L+ Sbjct: 9 DVIIVGAGLAGLSAAYELKKAG--YQVQILEARDRVGGRSLTA 49 >gnl|CDD|110172 pfam01150, GDA1_CD39, GDA1/CD39 (nucleoside phosphatase) family. Length = 424 Score = 34.7 bits (80), Expect = 0.076 Identities = 37/156 (23%), Positives = 58/156 (37%), Gaps = 36/156 (23%) Query: 252 FVYHF-DDNLVSIGFVLHLDYR---NPWISAYEELQRFKTHPDIRIIFTEGERLEYGARV 307 VY + D++L + V ++ P +S++ T P+ + LE+ V Sbjct: 24 HVYKWKDEDLDLLQIVPLIEEFKKLEPGLSSFA------TKPEEAAKYLT-PLLEFAEEV 76 Query: 308 ISEGGWQSVPKLSFPGGSLIGCAAGFVNLLRIKGSHNAIISGMLAAEKIVERLSNGKKHD 367 I + P +G AG + LL A+EKI+ L NG K Sbjct: 77 IPDSQLSETP-------VFLGATAG-MRLLP-----------EDASEKILRALRNGLKSL 117 Query: 368 DPIEIEDSWRQ----TQIGKDLWIIRNIKPLLSRFG 399 ++D + + G WI N LL RFG Sbjct: 118 STFPVDDQGVRIIDGAEEGLYGWITVNY--LLGRFG 151 >gnl|CDD|176246 cd08286, FDH_like_ADH2, formaldehyde dehydrogenase (FDH)-like. This group is related to formaldehyde dehydrogenase (FDH), which is a member of the zinc-dependent/medium chain alcohol dehydrogenase family. This family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. Another member is identified as a dihydroxyacetone reductase. Like the zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), tetrameric FDHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains and a structural zinc in a lobe of the catalytic domain. Unlike ADH, where NAD(P)(H) acts as a cofactor, NADH in FDH is a tightly bound redox cofactor (similar to nicotinamide proteins). The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Length = 345 Score = 34.1 bits (79), Expect = 0.090 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 6/44 (13%) Query: 17 VVIIGAGPAGLAAAIRCKQINPHLSVVI------LEKSAEVGAH 54 V I+GAGP GLAA + + +P +++ LE + ++GA Sbjct: 170 VAIVGAGPVGLAALLTAQLYSPSKIIMVDLDDNRLEVAKKLGAT 213 >gnl|CDD|36490 KOG1276, KOG1276, KOG1276, Protoporphyrinogen oxidase [Coenzyme transport and metabolism]. Length = 491 Score = 34.2 bits (78), Expect = 0.100 Identities = 14/42 (33%), Positives = 23/42 (54%) Query: 16 DVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHILS 57 V ++G G +GL AA ++ P +++ + E S VG I S Sbjct: 13 TVAVVGGGISGLCAAYYLARLGPDVTITLFEASPRVGGWIRS 54 >gnl|CDD|35620 KOG0399, KOG0399, KOG0399, Glutamate synthase [Amino acid transport and metabolism]. Length = 2142 Score = 34.2 bits (78), Expect = 0.10 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Query: 17 VVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHILSG 58 V IIG+GPAGLAAA + + V + E+S VG ++ G Sbjct: 1788 VAIIGSGPAGLAAADQLNKAGHT--VTVYERSDRVGGLLMYG 1827 >gnl|CDD|176239 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydrogenase. Benzyl alcohol dehydrogenase is similar to liver alcohol dehydrogenase, but has some amino acid substitutions near the active site, which may determine the enzyme's specificity of oxidizing aromatic substrates. Also known as aryl-alcohol dehydrogenases, they catalyze the conversion of an aromatic alcohol + NAD+ to an aromatic aldehyde + NADH + H+. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 365 Score = 34.0 bits (79), Expect = 0.12 Identities = 16/60 (26%), Positives = 26/60 (43%), Gaps = 17/60 (28%) Query: 17 VVIIGAGPAGLAA-----AIRCKQINPHLSVVI------LEKSAEVGA-HILSGAIIDPI 64 + + GAG GLAA C I + + LE + E+GA H+++ D + Sbjct: 190 IAVFGAGAVGLAAVMAAKIAGCTTI-----IAVDIVDSRLELAKELGATHVINPKEEDLV 244 >gnl|CDD|144651 pfam01134, GIDA, Glucose inhibited division protein A. Length = 391 Score = 33.7 bits (78), Expect = 0.14 Identities = 9/20 (45%), Positives = 13/20 (65%) Query: 16 DVVIIGAGPAGLAAAIRCKQ 35 DV++IG G AG AA+ + Sbjct: 1 DVIVIGGGHAGCEAALAAAR 20 >gnl|CDD|33432 COG3634, AhpF, Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones]. Length = 520 Score = 33.7 bits (77), Expect = 0.14 Identities = 12/17 (70%), Positives = 15/17 (88%) Query: 15 YDVVIIGAGPAGLAAAI 31 YDV+++G GPAG AAAI Sbjct: 212 YDVLVVGGGPAGAAAAI 228 >gnl|CDD|176223 cd08262, Zn_ADH8, Alcohol dehydrogenases of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 341 Score = 33.4 bits (77), Expect = 0.18 Identities = 19/66 (28%), Positives = 26/66 (39%), Gaps = 13/66 (19%) Query: 16 DVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAE-------VGAHILSGAIIDPIGIDS 68 ++IG GP GLA K +V + S E +GA I+ +DP DS Sbjct: 164 VALVIGCGPIGLAVIAALKARGVG-PIVASDFSPERRALALAMGADIV----VDP-AADS 217 Query: 69 LLPRWR 74 W Sbjct: 218 PFAAWA 223 >gnl|CDD|33375 COG3573, COG3573, Predicted oxidoreductase [General function prediction only]. Length = 552 Score = 33.4 bits (76), Expect = 0.18 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Query: 11 DVFEYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAE 50 D DV+++GAG AGL AA + + V+IL++ E Sbjct: 2 DGLTADVIVVGAGLAGLVAA--AELADAGKRVLILDQEGE 39 >gnl|CDD|37011 KOG1800, KOG1800, KOG1800, Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism]. Length = 468 Score = 33.1 bits (75), Expect = 0.22 Identities = 15/46 (32%), Positives = 21/46 (45%) Query: 17 VVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHILSGAIID 62 V I+G+GPAG A + +P+ V I EK + G D Sbjct: 23 VCIVGSGPAGFYTAQHLLKRHPNAHVDIFEKLPVPFGLVRYGVAPD 68 >gnl|CDD|39455 KOG4254, KOG4254, KOG4254, Phytoene desaturase [Coenzyme transport and metabolism]. Length = 561 Score = 32.7 bits (74), Expect = 0.25 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Query: 14 EYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHILSGAII 61 EYD V+IG G GL AA + SV +LE+ +G ++ I+ Sbjct: 14 EYDAVVIGGGHNGLTAAAYLARYG--QSVAVLERRHVIGGAAVTEEIV 59 >gnl|CDD|176193 cd08231, MDR_TM0436_like, Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH). This group contains the hypothetical TM0436 alcohol dehydrogenase from Thermotoga maritima, proteins annotated as 5-exo-alcohol dehydrogenase, and other members of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. MDR, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. Length = 361 Score = 32.6 bits (75), Expect = 0.31 Identities = 17/44 (38%), Positives = 20/44 (45%), Gaps = 6/44 (13%) Query: 17 VVIIGAGPAGLAAAIRCKQINPHLSVVI------LEKSAEVGAH 54 VV+ GAGP GL A K +VI LE + E GA Sbjct: 181 VVVQGAGPLGLYAVAAAKLAGARRVIVIDGSPERLELAREFGAD 224 >gnl|CDD|113586 pfam04820, Trp_halogenase, Tryptophan halogenase. Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan. This is the first step in the biosynthesis of pyrrolnitrin, an antibiotic with broad-spectrum anti-fungal activity. Tryptophan halogenase is NADH-dependent. Length = 457 Score = 32.3 bits (74), Expect = 0.37 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Query: 16 DVVIIGAGPAG-LAAAIRCKQINPHLSVVILEKSAEVG 52 +VI+G G AG +AAA + + L V ++E S E+G Sbjct: 1 KIVIVGGGTAGWMAAAALARALKGGLDVTLVE-SEEIG 37 >gnl|CDD|37615 KOG2404, KOG2404, KOG2404, Fumarate reductase, flavoprotein subunit [Energy production and conversion]. Length = 477 Score = 32.3 bits (73), Expect = 0.40 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Query: 17 VVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVG 52 VV+IG G AGL+A+ IN V++LEK+ +G Sbjct: 12 VVVIGGGLAGLSASNDI--INKGGIVILLEKAGSIG 45 >gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family. The medium chain reductase/dehydrogenases (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH) , quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Other MDR members have only a catalytic zinc, and some contain no coordinated zinc. Length = 271 Score = 31.9 bits (73), Expect = 0.49 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 5/43 (11%) Query: 17 VVIIGAGPAGLAAAIRCKQINPHLSVVI-----LEKSAEVGAH 54 V+++GAG GL AA K + V LE + E+GA Sbjct: 138 VLVLGAGGVGLLAAQLAKAAGARVIVTDRSDEKLELAKELGAD 180 >gnl|CDD|39059 KOG3855, KOG3855, KOG3855, Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism, Energy production and conversion]. Length = 481 Score = 31.5 bits (71), Expect = 0.59 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 8/45 (17%) Query: 9 NKDVFEYDVVIIGAGPAG--LAAAIRCKQINPHL---SVVILEKS 48 + D +YDVVI+G GP G LAAA+ NP V++L+ Sbjct: 31 STDTAKYDVVIVGGGPVGLALAAAL---GSNPPFQDKKVLLLDAG 72 >gnl|CDD|143965 pfam00208, ELFV_dehydrog, Glutamate/Leucine/Phenylalanine/Valine dehydrogenase. Length = 237 Score = 31.0 bits (71), Expect = 0.79 Identities = 22/87 (25%), Positives = 30/87 (34%), Gaps = 21/87 (24%) Query: 17 VVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHIL-----SGAIIDPIGID-SLL 70 V + G G G AA EK E+GA ++ SG I DP GID L Sbjct: 35 VAVQGFGNVGSYAA---------------EKLLELGAKVVAVSDSSGYIYDPNGIDIEEL 79 Query: 71 PRWREDKGHPFHTVVKRDLYWFLNAQR 97 +E+ G + + Sbjct: 80 LELKEEGGGRVVEYAGSGAEYISGEEL 106 >gnl|CDD|176244 cd08284, FDH_like_2, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2. Glutathione-dependent formaldehyde dehydrogenases (FDHs) are members of the zinc-dependent/medium chain alcohol dehydrogenase family. Formaldehyde dehydrogenase (FDH) is a member of the zinc-dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD to formate and NADH. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. These tetrameric FDHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains and a structural zinc in a lobe of the catalytic domain. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Length = 344 Score = 31.1 bits (71), Expect = 0.82 Identities = 14/54 (25%), Positives = 26/54 (48%), Gaps = 6/54 (11%) Query: 17 VVIIGAGPAGLAAAIRCKQINPHLSVVI------LEKSAEVGAHILSGAIIDPI 64 V +IG GP GL A + + + + LE++A +GA ++ +P+ Sbjct: 171 VAVIGCGPVGLCAVLSAQVLGAARVFAVDPVPERLERAAALGAEPINFEDAEPV 224 >gnl|CDD|34178 COG4529, COG4529, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 474 Score = 31.1 bits (70), Expect = 0.93 Identities = 13/42 (30%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Query: 15 YDVVIIGAGPAGLAAAIR-CKQINPHLSVVILEKSAEVGAHI 55 + V IIG G +G+ A K P + I E G I Sbjct: 2 FKVAIIGGGFSGIYMAAHLLKSPRPSGLISIFEPRPNFGQGI 43 >gnl|CDD|36550 KOG1336, KOG1336, KOG1336, Monodehydroascorbate/ferredoxin reductase [General function prediction only]. Length = 478 Score = 30.6 bits (69), Expect = 1.0 Identities = 21/79 (26%), Positives = 33/79 (41%), Gaps = 6/79 (7%) Query: 17 VVIIGAGPAGLAAAIRCKQINPH--LSVVILEKSAEVGAHILSGAII-DPIGIDSLLPRW 73 VI+G GP G A +Q+ +++V E LS ++ G+ P + Sbjct: 77 FVIVGGGPGGAVAIETLRQVGFTERIALVKREYLLPYDRARLSKFLLTVGEGLAKRTPEF 136 Query: 74 REDKGHPFHT---VVKRDL 89 ++KG VVK DL Sbjct: 137 YKEKGIELILGTSVVKADL 155 >gnl|CDD|31340 COG1145, NapF, Ferredoxin [Energy production and conversion]. Length = 99 Score = 30.7 bits (67), Expect = 1.1 Identities = 12/51 (23%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Query: 491 IYSGPSMRYCPAGVYEWHQNNDENNYI-IHAQNCIHCKACVIKDPNQNIEW 540 I G ++ CP G E + + I C+ C AC+ P + Sbjct: 32 IGCGLCVKVCPTGAIELIEEGLLLPEVVIDPDLCVLCGACLKVCPVDALSI 82 >gnl|CDD|39914 KOG4716, KOG4716, KOG4716, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones]. Length = 503 Score = 30.3 bits (68), Expect = 1.4 Identities = 11/40 (27%), Positives = 20/40 (50%) Query: 13 FEYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVG 52 ++YD+++IG G GLA A + ++ + K G Sbjct: 18 YDYDLIVIGGGSGGLACAKEAADLGAKVACLDFVKPTPQG 57 >gnl|CDD|31263 COG1063, Tdh, Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only]. Length = 350 Score = 29.6 bits (66), Expect = 2.0 Identities = 19/76 (25%), Positives = 32/76 (42%), Gaps = 9/76 (11%) Query: 16 DVVIIGAGPAGLAAAIRCKQINPHLSVVI------LEKSAEVGAHILSGAIIDPIGIDSL 69 VV++GAGP GL A K + + +V+ LE + E G + +++P D+ Sbjct: 171 TVVVVGAGPIGLLAIALAKLLGASVVIVVDRSPERLELAKEAGG---ADVVVNPSEDDAG 227 Query: 70 LPRWREDKGHPFHTVV 85 G V+ Sbjct: 228 AEILELTGGRGADVVI 243 >gnl|CDD|32579 COG2509, COG2509, Uncharacterized FAD-dependent dehydrogenases [General function prediction only]. Length = 486 Score = 29.5 bits (66), Expect = 2.3 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Query: 14 EYDVVIIGAGPAGLAAAIRC---KQINPHLSVVILEKSAEVGAHILSG 58 DVVI+GAGPAGL AA + P L + +++ ++ + Sbjct: 18 ALDVVIVGAGPAGLFAAYELSGDARKVPILKIYVVDVGLDIEQRLCPK 65 >gnl|CDD|176181 cd05278, FDH_like, Formaldehyde dehydrogenases. Formaldehyde dehydrogenase (FDH) is a member of the zinc-dependent/medium chain alcohol dehydrogenase family. Formaldehyde dehydrogenase (aka ADH3) may be the ancestral form of alcohol dehydrogenase, which evolved to detoxify formaldehyde. This CD contains glutathione dependant FDH, glutathione independent FDH, and related alcohol dehydrogenases. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. Unlike typical FDH, Pseudomonas putida aldehyde-dismutating FDH (PFDH) is glutathione-independent. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Length = 347 Score = 29.6 bits (67), Expect = 2.3 Identities = 9/28 (32%), Positives = 14/28 (50%) Query: 17 VVIIGAGPAGLAAAIRCKQINPHLSVVI 44 V +IGAGP GL A + + + + Sbjct: 171 VAVIGAGPVGLCAVAGARLLGAARIIAV 198 >gnl|CDD|35522 KOG0301, KOG0301, KOG0301, Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism]. Length = 745 Score = 29.6 bits (66), Expect = 2.3 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Query: 404 LSLGLMD--IWIQKILGFSFLGTLKHHKMDSCSLEA 437 L +G MD I + K+ L TLK HK + CSL Sbjct: 74 LVVGGMDTTIIVFKLSQAEPLYTLKGHKSNVCSLSI 109 >gnl|CDD|31444 COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion]. Length = 405 Score = 29.4 bits (66), Expect = 2.5 Identities = 10/31 (32%), Positives = 20/31 (64%) Query: 17 VVIIGAGPAGLAAAIRCKQINPHLSVVILEK 47 +VI+G G GL+AA R + P + + ++++ Sbjct: 6 IVILGGGFGGLSAAKRLARKLPDVEITLVDR 36 Score = 27.9 bits (62), Expect = 8.1 Identities = 11/50 (22%), Positives = 19/50 (38%), Gaps = 11/50 (22%) Query: 16 DVVIIGAGPAG--LAAAIR---------CKQINPHLSVVILEKSAEVGAH 54 +VI+G GP G LA + + L V+++E + Sbjct: 157 TIVIVGGGPTGVELAGELAERLHRLLKKFRVDPSELRVILVEAGPRILPM 206 >gnl|CDD|30629 COG0281, SfcA, Malic enzyme [Energy production and conversion]. Length = 432 Score = 29.4 bits (66), Expect = 2.9 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Query: 1 MNSCDILHNKDVFEYDVVIIGAGPAGLAAA 30 +N+ + K + + +VI GAG AG+A A Sbjct: 187 LNALKLT-GKKLKDQKIVINGAGAAGIAIA 215 >gnl|CDD|30794 COG0445, GidA, NAD/FAD-utilizing enzyme apparently involved in cell division [Cell division and chromosome partitioning]. Length = 621 Score = 29.4 bits (66), Expect = 3.0 Identities = 11/17 (64%), Positives = 14/17 (82%) Query: 14 EYDVVIIGAGPAGLAAA 30 EYDV++IG G AG+ AA Sbjct: 4 EYDVIVIGGGHAGVEAA 20 >gnl|CDD|31338 COG1143, NuoI, Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion]. Length = 172 Score = 29.2 bits (65), Expect = 3.1 Identities = 10/38 (26%), Positives = 13/38 (34%), Gaps = 7/38 (18%) Query: 500 CPAG--VYEWHQNNDENN-----YIIHAQNCIHCKACV 530 CPA E + + I+ CI C CV Sbjct: 67 CPANAITMETAERKVDGRKKPKRPDINLGRCIFCGLCV 104 >gnl|CDD|133453 cd05311, NAD_bind_2_malic_enz, NAD(P) binding domain of malic enzyme (ME), subgroup 2. Malic enzyme (ME), a member of the amino acid dehydrogenase (DH)-like domain family, catalyzes the oxidative decarboxylation of L-malate to pyruvate in the presence of cations (typically Mg++ or Mn++) with the concomitant reduction of cofactor NAD+ or NADP+. ME has been found in all organisms, and plays important roles in diverse metabolic pathways such as photosynthesis and lipogenesis. This enzyme generally forms homotetramers. The conversion of malate to pyruvate by ME typically involves oxidation of malate to produce oxaloacetate, followed by decarboxylation of oxaloacetate to produce pyruvate and CO2. This subfamily consists primarily of archaeal and bacterial ME. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann fold superfamily includes a wide variety of protein families including NAD(P)- binding domains of alcohol DHs, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate DH, lactate/malate DHs, formate/glycerate DHs, siroheme synthases, 6-phosphogluconate DH, amino acid DHs, repressor rex, NAD-binding potassium channel domain, CoA-binding, and ornithine cyclodeaminase-like domains. These domains have an alpha-beta-alpha configuration. NAD binding involves numerous hydrogen and van der Waals contacts. Length = 226 Score = 29.2 bits (66), Expect = 3.3 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 1 MNSCDILHNKDVFEYDVVIIGAGPAGLAAA 30 +N+ ++ K + E +VI GAG AG+A A Sbjct: 13 LNALKLV-GKKIEEVKIVINGAGAAGIAIA 41 >gnl|CDD|176195 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase. (2R,3R)-2,3-butanediol dehydrogenase, a zinc-dependent medium chain alcohol dehydrogenase, catalyzes the NAD(+)-dependent oxidation of (2R,3R)-2,3-butanediol and meso-butanediol to acetoin. BDH functions as a homodimer. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit. Length = 351 Score = 29.0 bits (66), Expect = 3.5 Identities = 16/63 (25%), Positives = 27/63 (42%), Gaps = 20/63 (31%) Query: 17 VVIIGAGPAGLAAAI-----RCKQINPHLSVVI------LEKSAEVGAHILSGAIIDPIG 65 +++GAGP GL + +I +V E + E+GA I ++DP Sbjct: 176 ALVLGAGPIGLLTILALKAAGASKI-----IVSEPSEARRELAEELGATI----VLDPTE 226 Query: 66 IDS 68 +D Sbjct: 227 VDV 229 >gnl|CDD|30923 COG0578, GlpA, Glycerol-3-phosphate dehydrogenase [Energy production and conversion]. Length = 532 Score = 29.1 bits (65), Expect = 3.6 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Query: 14 EYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEK 47 E+DV++IG G G A L V ++EK Sbjct: 12 EFDVIVIGGGITGAGIARDA--AGRGLKVALVEK 43 >gnl|CDD|176188 cd05285, sorbitol_DH, Sorbitol dehydrogenase. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit. Aldose reductase catalyzes the NADP(H)-dependent conversion of glucose to sorbital, and SDH uses NAD(H) in the conversion of sorbitol to fructose. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Length = 343 Score = 29.0 bits (66), Expect = 3.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Query: 17 VVIIGAGPAGLAAAIRCK 34 V++ GAGP GL A K Sbjct: 166 VLVFGAGPIGLLTAAVAK 183 >gnl|CDD|37825 KOG2614, KOG2614, KOG2614, Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion, General function prediction only]. Length = 420 Score = 28.8 bits (64), Expect = 4.1 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Query: 16 DVVIIGAGPAGLAAAIRCKQINPHLSVVILEKS 48 VVI+G G GLA A+ + + VV+LE Sbjct: 4 KVVIVGGGIVGLATALALHRKG--IDVVVLESR 34 >gnl|CDD|176222 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR family. This group contains members identified as related to zinc-dependent alcohol dehydrogenase and other members of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group includes various activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 337 Score = 28.7 bits (65), Expect = 4.3 Identities = 7/15 (46%), Positives = 10/15 (66%) Query: 17 VVIIGAGPAGLAAAI 31 V+++GAGP GL Sbjct: 163 VLVVGAGPIGLGVIQ 177 >gnl|CDD|33289 COG3486, IucD, Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism]. Length = 436 Score = 28.7 bits (64), Expect = 4.4 Identities = 12/42 (28%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Query: 15 YDVVIIGAGPAGLAAAIRCKQINPH--LSVVILEKSAEVGAH 54 D++ IG GP L+ A + H L + LE+ + H Sbjct: 6 LDLIGIGIGPFNLSLAA---LLEEHSGLKSLFLERKPDFSWH 44 >gnl|CDD|176197 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenase. Putative L-iditol 2-dehydrogenase based on annotation of some members in this subgroup. L-iditol 2-dehydrogenase catalyzes the NAD+-dependent conversion of L-iditol to L-sorbose in fructose and mannose metabolism. This enzyme is related to sorbitol dehydrogenase, alcohol dehydrogenase, and other medium chain dehydrogenase/reductases. The zinc-dependent alcohol dehydrogenase (ADH-Zn)-like family of proteins is a diverse group of proteins related to the first identified member, class I mammalian ADH. This group is also called the medium chain dehydrogenases/reductase family (MDR) to highlight its broad range of activities and to distinguish from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal GroES-like catalytic domain. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 343 Score = 28.7 bits (65), Expect = 4.6 Identities = 17/62 (27%), Positives = 24/62 (38%), Gaps = 18/62 (29%) Query: 16 DVVIIGAGPAGL----------AAAIRCKQINPHLSVVILEKSAEVGAHILSGAIIDPIG 65 V++IGAGP GL A + +N LE + ++GA ID Sbjct: 168 TVLVIGAGPIGLLHAMLAKASGARKVIVSDLNEFR----LEFAKKLGADY----TIDAAE 219 Query: 66 ID 67 D Sbjct: 220 ED 221 >gnl|CDD|144743 pfam01262, AlaDh_PNT_C, Alanine dehydrogenase/PNT, C-terminal domain. This family now also contains the lysine 2-oxoglutarate reductases. Length = 150 Score = 28.7 bits (65), Expect = 4.8 Identities = 14/35 (40%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Query: 17 VVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEV 51 VV+IG G GL AA K + V IL+ E Sbjct: 23 VVVIGGGVVGLGAAATAKGLG--APVTILDVRPER 55 >gnl|CDD|33157 COG3349, COG3349, Uncharacterized conserved protein [Function unknown]. Length = 485 Score = 28.4 bits (63), Expect = 5.2 Identities = 16/49 (32%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Query: 17 VVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHILSGAIIDPIG 65 V I GAG AGLAAA V + E +G + D G Sbjct: 3 VAIAGAGLAGLAAAYELADAG--YDVTLYEARDRLGG--KVASWRDSDG 47 >gnl|CDD|37522 KOG2311, KOG2311, KOG2311, NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis]. Length = 679 Score = 28.4 bits (63), Expect = 5.4 Identities = 13/22 (59%), Positives = 14/22 (63%), Gaps = 3/22 (13%) Query: 15 YDVVIIGAGPAGL---AAAIRC 33 YDVV+IG G AG AAA R Sbjct: 29 YDVVVIGGGHAGCEAAAAAARL 50 >gnl|CDD|37614 KOG2403, KOG2403, KOG2403, Succinate dehydrogenase, flavoprotein subunit [Energy production and conversion]. Length = 642 Score = 28.0 bits (62), Expect = 6.0 Identities = 31/106 (29%), Positives = 45/106 (42%), Gaps = 13/106 (12%) Query: 14 EYDVVIIGAGPAGLAAAIRCKQINPHLSVVI-LEK--SAEVGAHILSGAIIDPIGIDSLL 70 YD V++GAG AGL AA ++ +V+ L S V A A + +G D+ Sbjct: 55 TYDAVVVGAGGAGLRAARGLAELGEKTAVITKLFPTRSHTVAAQGGINAALGNMGNDN-- 112 Query: 71 PRWREDKGHPFHTVVKRDLYWFLNAQRSIQIPHFCLPDFMDNKEHY 116 WR H + TV D +L Q +I P + E+Y Sbjct: 113 --WRW---HMYDTVKGSD---WLGDQDAIHYMCREAPKAVIELENY 150 >gnl|CDD|35626 KOG0405, KOG0405, KOG0405, Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism]. Length = 478 Score = 28.4 bits (63), Expect = 6.2 Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Query: 11 DVFEYDVVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVG 52 DV ++D ++IG G G+A+A R V + E +G Sbjct: 17 DVKDFDYLVIGGGSGGVASARRAASHG--AKVALCELPFGLG 56 >gnl|CDD|176218 cd08256, Zn_ADH2, Alcohol dehydrogenases of the MDR family. This group has the characteristic catalytic and structural zinc-binding sites of the zinc-dependent alcohol dehydrogenases of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. Length = 350 Score = 28.1 bits (63), Expect = 6.6 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 10/51 (19%) Query: 13 FEYDVVIIGAGPAGLA--AAIRCKQINPHLSVVI------LEKSAEVGAHI 55 F+ VV+ GAGP GL A R K NP +V+ L + + GA + Sbjct: 174 FDDVVVLAGAGPLGLGMIGAARLK--NPKKLIVLDLKDERLALARKFGADV 222 >gnl|CDD|176242 cd08282, PFDH_like, Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH). Formaldehyde dehydrogenase (FDH) is a member of the zinc-dependent/medium chain alcohol dehydrogenase family. Unlike typical FDH, Pseudomonas putida aldehyde-dismutating FDH (PFDH) is glutathione-independent. PFDH converts 2 molecules of aldehydes to corresponding carboxylic acid and alcohol. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. Like the zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these tetrameric FDHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains and a structural zinc in a lobe of the catalytic domain. Unlike ADH, where NAD(P)(H) acts as a cofactor, NADH in FDH is a tightly bound redox cofactor (similar to nicotinamide proteins). The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of an beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Length = 375 Score = 27.9 bits (63), Expect = 7.7 Identities = 9/14 (64%), Positives = 10/14 (71%) Query: 17 VVIIGAGPAGLAAA 30 V + GAGP GL AA Sbjct: 180 VAVFGAGPVGLMAA 193 >gnl|CDD|29750 cd01147, HemV-2, Metal binding protein HemV-2. These proteins are predicted to function as initial receptors in ABC transport of metal ions. They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains. In addition, these proteins sometimes have a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).. Length = 262 Score = 27.6 bits (61), Expect = 9.2 Identities = 13/65 (20%), Positives = 21/65 (32%), Gaps = 3/65 (4%) Query: 481 KDLQKKSELRIYSGPSMRYCPAGVYEWHQNNDENNYIIHAQNCIHCKA---CVIKDPNQN 537 KD+ + + +Y G AG+ + E + N P Q Sbjct: 149 KDIPDEEKPTVYFGRIGTKGAAGLESGLAGSIEVFELAGGINVADGLGGGGLKEVSPEQI 208 Query: 538 IEWNP 542 + WNP Sbjct: 209 LLWNP 213 >gnl|CDD|31339 COG1144, COG1144, Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion]. Length = 91 Score = 27.7 bits (61), Expect = 9.3 Identities = 9/37 (24%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Query: 517 IIHAQNCIHCKACVIKDPNQNIEWNPPQGGDGPHYVD 553 ++ CI+CK C + P I G +D Sbjct: 31 VVDEDKCINCKLCWLYCPEPAILEEE---GGYKVRID 64 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.141 0.446 Gapped Lambda K H 0.267 0.0823 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 7,314,504 Number of extensions: 409761 Number of successful extensions: 1089 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1077 Number of HSP's successfully gapped: 96 Length of query: 554 Length of database: 6,263,737 Length adjustment: 99 Effective length of query: 455 Effective length of database: 4,124,446 Effective search space: 1876622930 Effective search space used: 1876622930 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 60 (26.7 bits)