>pfam05784 Herpes_UL82_83 Betaherpesvirus UL82/83 protein N terminus. This family represents the N terminal region of the Betaherpesvirus UL82 and UL83 proteins. As viruses are reliant upon their host cell to serve as proper environments for their replication, many have evolved mechanisms to alter intracellular conditions to suit their own needs. Human cytomegalovirus induces quiescent cells to enter the cell cycle and then arrests them in late G(1), before they enter the S phase, a cell cycle compartment that is presumably favourable for viral replication. The protein product of the human cytomegalovirus UL82 gene, pp71, can accelerate the movement of cells through the G(1) phase of the cell cycle. This activity would help infected cells reach the late G(1) arrest point sooner and thus may stimulate the infectious cycle. pp71 also induces DNA synthesis in quiescent cells, but a pp71 mutant protein that is unable to induce quiescent cells to enter the cell cycle still retains the abilit

Probab=95.37 E-value=0.21 Score=28.08 Aligned_cols=93 Identities=16% Similarity=0.125 Sum_probs=61.6 Q ss_pred CCCCCCCCCEEEEEEECCCCCCEEECCCCEEEEECCCHHHCCCCEEEEEEECCCCEEEEEEECCCCCEEECCCCCCCEEE Q ss_conf 74357886408789103778738937997399965860225876146787526631332220235503665687887699 Q gi|254781025|r 20 PEYKTSGSSGMDLFAALPEDEPVELLPGMRSLIPGGYIIAIPPGYEGQVRSRSGLALNYGVACLNSPGTIDSDYRGEIKI 99 (154) Q Consensus 20 P~~~t~~~AG~Dl~a~~~~~e~~~i~pg~~~li~Tgi~i~ip~g~~~~i~~RSsl~~K~gl~~~n~~GvID~~YrGei~v 99 (154) T Consensus 249 P~L~~~~~NGftV~~----Pr~~~l~~g~~~~v~i~~~feS~~~~~~lF~P~~ip----Glsi--~~~~w~--~~~~L~i 316 (346) T pfam05784 249 PFLRPHPRNGFTVLC----PKNLHLKPGQTSHVMIDNAFESDQTHAGLFFPKDIP----GLSI--SCGPWM--ERQPLFI 316 (346) T ss_pred CCCCCCCCCCEEEEC----CCCEECCCCCEEEEEEEEEEECCCCEEEEEECCCCC----CCEE--EECCCC--CCCEEEE T ss_conf 732117999789978----875660899869999974895188169999265579----9776--732158--9974899 Q ss_pred EEEECCCCEEEEECCCCEEEEEEEEC Q ss_conf 99980794499955950358999750 Q gi|254781025|r 100 LLINLGQENFLIMRGMRIAQLIIANS 125 (154) Q Consensus 100 ~l~N~~~~~~~i~~G~RIaQlv~~~~ 125 (154) T Consensus 317 ~i~a~~~-~v~i~~~q~LG~lhFf~r 341 (346) T pfam05784 317 ELRATKE-SVRIEHMQPLGELHFFPR 341 (346) T ss_pred EEEECCC-CEECCCCCEEEEEEEEEC T ss_conf 9984355-410237875348998515

HHsearch alignment for GI: 254781025 and conserved domain: pfam05784