RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781025|ref|YP_003065438.1| deoxyuridine 5 27-triphosphate nucleotidohydrolase [Candidatus Liberibacter asiaticus str. psy62] (154 letters) >gnl|CDD|31099 COG0756, Dut, dUTPase [Nucleotide transport and metabolism]. Length = 148 Score = 158 bits (400), Expect = 8e-40 Identities = 76/152 (50%), Positives = 98/152 (64%), Gaps = 6/152 (3%) Query: 1 MQSIDIPFLQLPHAHGIPLPEYKTSGSSGMDLFAALPEDEPVELLPGMRSLIPGGYIIAI 60 M+ ++ + + G PLP+Y T GS+G DL AA E V + PG R L+P G I + Sbjct: 1 MRGFEMKLDKRLNE-GAPLPKYATEGSAGYDLRAAEDE---VTIAPGERKLVPTGLAIEL 56 Query: 61 PPGYEGQVRSRSGLALNYGVACLNSPGTIDSDYRGEIKILLINLGQENFLIMRGMRIAQL 120 P GYE QVR RSGLAL +G+ NSPGTIDSDYRGEIK+LLINLG E+F+I +G RIAQL Sbjct: 57 PEGYEAQVRPRSGLALKHGITLGNSPGTIDSDYRGEIKVLLINLGDEDFVIEKGDRIAQL 116 Query: 121 IIANSVRAHPSLISAMPMGKNERNEKGFGSTG 152 + ++A + + + ER GFGSTG Sbjct: 117 VFVKVLQAEFDEVEN--LDETERGTGGFGSTG 146 >gnl|CDD|143638 cd07557, trimeric_dUTPase, Trimeric dUTP diphosphatases. Trimeric dUTP diphosphatases, or dUTPases, are the most common family of dUTPase, found in bacteria, eukaryotes, and archaea. They catalyze the hydrolysis of the dUTP-Mg complex (dUTP-Mg) into dUMP and pyrophosphate. This reaction is crucial for the preservation of chromosomal integrity as it removes dUTP and therefore reduces the cellular dUTP/dTTP ratio, and prevents dUTP from being incorporated into DNA. It also provides dUMP as the precursor for dTTP synthesis via the thymidylate synthase pathway. dUTPases are homotrimeric, except some monomeric viral dUTPases, which have been shown to mimic a trimer. Active sites are located at the subunit interface. Length = 92 Score = 100 bits (251), Expect = 2e-22 Identities = 42/95 (44%), Positives = 52/95 (54%), Gaps = 3/95 (3%) Query: 28 SGMDLFAALPEDEPVELLPGMRSLIPGGYIIAIPPGYEGQVRSRSGLALNYGVACLNSPG 87 +G DL + E + L PG L+P G I +P GY G V RS LA G+ N G Sbjct: 1 AGYDLRLG-EDFEGIVLPPGETVLVPTGEAIELPEGYVGLVFPRSSLARK-GITVHN-AG 57 Query: 88 TIDSDYRGEIKILLINLGQENFLIMRGMRIAQLII 122 ID YRGEI + L NLG E +I +G RIAQL+ Sbjct: 58 VIDPGYRGEITLELYNLGPEPVVIKKGDRIAQLVF 92 >gnl|CDD|144334 pfam00692, dUTPase, dUTPase. dUTPase hydrolyses dUTP to dUMP and pyrophosphate. Length = 129 Score = 93.5 bits (233), Expect = 2e-20 Identities = 56/136 (41%), Positives = 73/136 (53%), Gaps = 9/136 (6%) Query: 17 IPLPEYKTSGSSGMDLFAALPEDEPVELLPGMRSLIPGGYIIAIPPGYEGQVRSRSGLAL 76 +P K G +G DL A L PG L+P I +PPG G + RS LA Sbjct: 3 GEIPTRKRPGDAGYDLCAP----YDFTLPPGGTVLVPTDIRIPLPPGTFGLILGRSSLAA 58 Query: 77 NYGVACLNSPGTIDSDYRGEIKILLINLGQENFLIMRGMRIAQLIIANSVRAHPSLISAM 136 + PG IDSDYRGEIK++L N G+++F I +G RIAQLI+ V HP L Sbjct: 59 KGLIVL---PGIIDSDYRGEIKVVLFNSGKKDFTIKKGDRIAQLILLPCV--HPELEPVE 113 Query: 137 PMGKNERNEKGFGSTG 152 + + ER + GFGS+G Sbjct: 114 NLERTERGDSGFGSSG 129 >gnl|CDD|38580 KOG3370, KOG3370, KOG3370, dUTPase [Nucleotide transport and metabolism]. Length = 140 Score = 81.9 bits (202), Expect = 6e-17 Identities = 45/133 (33%), Positives = 70/133 (52%), Gaps = 8/133 (6%) Query: 20 PEYKTSGSSGMDLFAALPEDEPVELLPGMRSLIPGGYIIAIPPGYEGQVRSRSGLALNYG 79 P ++G++G DL++A + + ++++ IA+P GY G+V RSGLA + Sbjct: 15 PTRGSAGAAGYDLYSA----QDGTVPARGKAVVDTDLQIAVPSGYYGRVAPRSGLAWKHF 70 Query: 80 VACLNSPGTIDSDYRGEIKILLINLGQENFLIMRGMRIAQLIIANSVRAHPSLISAMPMG 139 + G +D DYRGE+ +LL N +F +G RIAQLI+ P ++ + Sbjct: 71 IDVGA--GVVDPDYRGEVGVLLFNHSDRDFEYKKGDRIAQLIV--EKIVTPEIVLVSSLE 126 Query: 140 KNERNEKGFGSTG 152 ER GFGSTG Sbjct: 127 ATERGAGGFGSTG 139 >gnl|CDD|31061 COG0717, Dcd, Deoxycytidine deaminase [Nucleotide transport and metabolism]. Length = 183 Score = 48.7 bits (116), Expect = 7e-07 Identities = 26/85 (30%), Positives = 34/85 (40%), Gaps = 3/85 (3%) Query: 37 PEDEPVELLPGMRSLIPGGYIIAIPPGYEGQVRSRSGLALNYGVACLNSPGTIDSDYRGE 96 ED L PG L + IP RS LA + + G ID + G Sbjct: 70 LEDGEFILPPGEFYLAVTLEYVEIPEDVAAFCTGRSSLA---RLGLIVHVGVIDPGFEGR 126 Query: 97 IKILLINLGQENFLIMRGMRIAQLI 121 I + L+N G + G RIAQL+ Sbjct: 127 ITLELVNSGPLPIRLYPGERIAQLV 151 >gnl|CDD|31604 COG1414, IclR, Transcriptional regulator [Transcription]. Length = 246 Score = 28.3 bits (63), Expect = 1.0 Identities = 23/80 (28%), Positives = 31/80 (38%), Gaps = 9/80 (11%) Query: 14 AHGIPLPEYKTSGSSGMDLFAALPEDEPVELLPGMRSLIPGGYIIAIPPGYEGQVRS--R 71 G LP Y T+ SG L A LPE+E LL I P ++ Sbjct: 123 RVGRRLPLYATA--SGKALLAFLPEEEREALLEEEELRPFTPRTITDPEALLEELAEIRA 180 Query: 72 SGLALN-----YGVACLNSP 86 G A++ GV C+ +P Sbjct: 181 RGYAVDDEELEPGVRCIAAP 200 >gnl|CDD|146721 pfam04234, CopC, Copper resistance protein CopC. CopC is a bacterial blue copper protein that binds 1 atom of copper per protein molecule. Along with CopA, CopC mediates copper resistance by sequestration of copper in the periplasm. Length = 120 Score = 25.7 bits (57), Expect = 6.2 Identities = 7/18 (38%), Positives = 12/18 (66%) Query: 120 LIIANSVRAHPSLISAMP 137 L++A + AH L+S+ P Sbjct: 15 LLLAGAASAHAKLVSSTP 32 >gnl|CDD|143613 cd07347, harmonin_N_like, N-terminal protein-binding module of harmonin and similar domains. This domain is found in harmonin, and similar proteins such as delphilin, and whirlin. These are postsynaptic density-95/discs-large/ZO-1 (PDZ) domain-containing scaffold proteins. Harmonin and whirlin are organizers of the Usher protein network of the inner ear and the retina, delphilin is found at the cerebellar parallel fiber-Purkinje cell synapses. This harmonin_N_like domain is found in either one or two copies. Harmonin contains a single copy, which is found at its N-terminus and binds specifically to a short internal peptide fragment of the cadherin 23 cytoplasmic domain; cadherin 23 is a component of the Usher protein network. Whirlin contains two copies of the harmonin_N_like domain; the first of these has been assayed for interaction with the cytoplasmic domain of cadherin 23 and no interaction could be detected. Length = 78 Score = 25.4 bits (56), Expect = 6.4 Identities = 8/24 (33%), Positives = 12/24 (50%) Query: 30 MDLFAALPEDEPVELLPGMRSLIP 53 DL+ L + LL +R +IP Sbjct: 42 RDLYLVLDTPAKLPLLQFLRQVIP 65 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.141 0.412 Gapped Lambda K H 0.267 0.0762 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,928,024 Number of extensions: 99293 Number of successful extensions: 196 Number of sequences better than 10.0: 1 Number of HSP's gapped: 189 Number of HSP's successfully gapped: 11 Length of query: 154 Length of database: 6,263,737 Length adjustment: 86 Effective length of query: 68 Effective length of database: 4,405,363 Effective search space: 299564684 Effective search space used: 299564684 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (24.1 bits)