BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781025|ref|YP_003065438.1| deoxyuridine 5 27-triphosphate nucleotidohydrolase [Candidatus Liberibacter asiaticus str. psy62] (154 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781025|ref|YP_003065438.1| deoxyuridine 5 27-triphosphate nucleotidohydrolase [Candidatus Liberibacter asiaticus str. psy62] Length = 154 Score = 309 bits (792), Expect = 1e-86, Method: Compositional matrix adjust. Identities = 154/154 (100%), Positives = 154/154 (100%) Query: 1 MQSIDIPFLQLPHAHGIPLPEYKTSGSSGMDLFAALPEDEPVELLPGMRSLIPGGYIIAI 60 MQSIDIPFLQLPHAHGIPLPEYKTSGSSGMDLFAALPEDEPVELLPGMRSLIPGGYIIAI Sbjct: 1 MQSIDIPFLQLPHAHGIPLPEYKTSGSSGMDLFAALPEDEPVELLPGMRSLIPGGYIIAI 60 Query: 61 PPGYEGQVRSRSGLALNYGVACLNSPGTIDSDYRGEIKILLINLGQENFLIMRGMRIAQL 120 PPGYEGQVRSRSGLALNYGVACLNSPGTIDSDYRGEIKILLINLGQENFLIMRGMRIAQL Sbjct: 61 PPGYEGQVRSRSGLALNYGVACLNSPGTIDSDYRGEIKILLINLGQENFLIMRGMRIAQL 120 Query: 121 IIANSVRAHPSLISAMPMGKNERNEKGFGSTGLY 154 IIANSVRAHPSLISAMPMGKNERNEKGFGSTGLY Sbjct: 121 IIANSVRAHPSLISAMPMGKNERNEKGFGSTGLY 154 >gi|254780241|ref|YP_003064654.1| preprotein translocase subunit SecY [Candidatus Liberibacter asiaticus str. psy62] Length = 444 Score = 24.3 bits (51), Expect = 1.1, Method: Compositional matrix adjust. Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 13/81 (16%) Query: 73 GLALNYGVAC--LNSPGTI-DSDYRGEIKILLINLGQENFLIMRGMRI--------AQLI 121 G+ YG+A N G + DSDY ++ LG FL+ G +I LI Sbjct: 132 GILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLI 191 Query: 122 IANSVRAH--PSLISAMPMGK 140 I + + A SL+S + +G+ Sbjct: 192 IFSGIVAGLPSSLVSVLELGR 212 >537021.9.peg.472_1 Length = 369 Score = 21.9 bits (45), Expect = 5.7, Method: Compositional matrix adjust. Identities = 7/21 (33%), Positives = 15/21 (71%) Query: 1 MQSIDIPFLQLPHAHGIPLPE 21 M+++++ ++L HA +P PE Sbjct: 335 MEAVEMVLIRLAHAVQLPSPE 355 >gi|254780623|ref|YP_003065036.1| 2-polyprenylphenol 6-hydroxylase [Candidatus Liberibacter asiaticus str. psy62] Length = 517 Score = 21.6 bits (44), Expect = 6.4, Method: Composition-based stats. Identities = 10/29 (34%), Positives = 16/29 (55%) Query: 43 ELLPGMRSLIPGGYIIAIPPGYEGQVRSR 71 +L PG + GYI+A+ G G++ R Sbjct: 287 DLHPGNLFVDSKGYIVAVDMGITGRLSKR 315 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.141 0.412 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99,007 Number of Sequences: 1233 Number of extensions: 3859 Number of successful extensions: 11 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 7 length of query: 154 length of database: 328,796 effective HSP length: 67 effective length of query: 87 effective length of database: 246,185 effective search space: 21418095 effective search space used: 21418095 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 35 (18.1 bits)