RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781027|ref|YP_003065440.1| hypothetical protein CLIBASIA_04645 [Candidatus Liberibacter asiaticus str. psy62] (108 letters) >gnl|CDD|30951 COG0606, COG0606, Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]. Length = 490 Score = 80.7 bits (199), Expect = 8e-17 Identities = 36/117 (30%), Positives = 56/117 (47%), Gaps = 10/117 (8%) Query: 1 MASIQAISTESFSHYLAVGEINLDGS-------LPAAICAKNMN-KDFICPQSCGSEAAW 52 +A+ + ++ Y +GE++LDG LPAA+ AK + I P+ EA+ Sbjct: 76 LAASGQLPADALILYEFLGELSLDGLLRPVGGVLPAALAAKEKGKRGLIVPKENAEEASL 135 Query: 53 ASDSLRIVAPSTLLELINHLNNKQLLPQPCKST-YKKRDNLPNFAEIKGQKTIKRAL 108 L + L E++N L K LP P S + P+F ++KGQ+ KRAL Sbjct: 136 IGG-LPVYGARYLEEVVNFLEGKLRLPIPIPSEVIESFSLAPDFKDVKGQEQAKRAL 191 >gnl|CDD|36679 KOG1466, KOG1466, KOG1466, Translation initiation factor 2B, alpha subunit (eIF-2Balpha/GCN3) [Translation, ribosomal structure and biogenesis]. Length = 313 Score = 27.2 bits (60), Expect = 1.0 Identities = 12/22 (54%), Positives = 15/22 (68%) Query: 19 GEINLDGSLPAAICAKNMNKDF 40 G IN G+ A+CAK+MNK F Sbjct: 214 GIINKIGTYQVAVCAKSMNKPF 235 >gnl|CDD|144608 pfam01078, Mg_chelatase, Magnesium chelatase, subunit ChlI. Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX. This is the first unique step in the synthesis of (bacterio)chlorophyll. Due to this, it is thought that Mg-chelatase has an important role in channelling inter- mediates into the (bacterio)chlorophyll branch in response to conditions suitable for photosynthetic growth. ChlI and BchD have molecular weight between 38-42 kDa. Length = 207 Score = 24.8 bits (55), Expect = 4.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Query: 95 FAEIKGQKTIKRAL 108 A++KGQ+ KRAL Sbjct: 2 LADVKGQEQAKRAL 15 >gnl|CDD|31250 COG1049, AcnB, Aconitase B [Energy production and conversion]. Length = 852 Score = 24.1 bits (52), Expect = 9.0 Identities = 10/39 (25%), Positives = 19/39 (48%) Query: 1 MASIQAISTESFSHYLAVGEINLDGSLPAAICAKNMNKD 39 +A+ + + ++ + Y AV EI+L + A N D Sbjct: 643 LANPELLEADADAEYAAVIEIDLADIKEPILAAPNDPDD 681 >gnl|CDD|133012 cd02520, Glucosylceramide_synthase, Glucosylceramide synthase catalyzes the first glycosylation step of glycosphingolipid synthesis. UDP-glucose:N-acylsphingosine D-glucosyltransferase (glucosylceramide synthase or ceramide glucosyltransferase) catalyzes the first glycosylation step of glycosphingolipid synthesis. Its product, glucosylceramide, serves as the core of more than 300 glycosphingolipids (GSL). GSLs are a group of membrane components that have the lipid portion embedded in the outer plasma membrane leaflet and the sugar chains extended to the outer environment. Several lines of evidence suggest the importance of GSLs in various cellular processes such as differentiation, adhesion, proliferation, and cell-cell recognition. In pathogenic fungus Cryptococcus neoformans, glucosylceramide serves as an antigen that elicits an antibody response in patients and it is essential for fungal growth in host extracellular environment. Length = 196 Score = 24.1 bits (53), Expect = 9.7 Identities = 16/56 (28%), Positives = 22/56 (39%), Gaps = 10/56 (17%) Query: 47 GSEAA-----WASDSLRIVAPSTLLELINHLNNKQ--LLPQPC---KSTYKKRDNL 92 G E A SDS V P L ++ L + L+ C KS +R+ L Sbjct: 81 GYEEARYDILVISDSDISVPPDYLRRMVAPLMDPGVGLVTCLCAFGKSMALRREVL 136 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.316 0.129 0.379 Gapped Lambda K H 0.267 0.0693 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,211,834 Number of extensions: 51146 Number of successful extensions: 106 Number of sequences better than 10.0: 1 Number of HSP's gapped: 103 Number of HSP's successfully gapped: 11 Length of query: 108 Length of database: 6,263,737 Length adjustment: 75 Effective length of query: 33 Effective length of database: 4,643,062 Effective search space: 153221046 Effective search space used: 153221046 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.5 bits)