RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781027|ref|YP_003065440.1| hypothetical protein CLIBASIA_04645 [Candidatus Liberibacter asiaticus str. psy62] (108 letters) >1z0w_A Putative protease LA homolog type; ATP-dependent protease, catalytic Ser-Lys DYAD, B-type LON, hydrolase; 1.20A {Archaeoglobus fulgidus} PDB: 1z0b_A 1z0c_A 1z0e_A 1z0g_A 1z0t_A 1z0v_A (A:) Length = 207 Score = 58.6 bits (141), Expect = 3e-10 Identities = 11/101 (10%), Positives = 28/101 (27%), Gaps = 20/101 (19%) Query: 13 SHYLAVGEINLDGS-------LPAAICAKNM-NKDFICPQSCGSEAAWASD---SLRIVA 61 G +++ G A K I P+ + ++ + ++ Sbjct: 115 QSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIP 174 Query: 62 PSTLLELINHLNNKQLLPQPCKSTYKKRDNLPNFAEIKGQK 102 S + E++ H+ + F E++ Sbjct: 175 VSRINEVLEHVLEDGKKKNR---------LMSKFKELELAA 206 >1xhk_A Putative protease LA homolog; LON protease, ATP dependent, catalytic DYAD, hydrolase; HET: MES; 1.90A {Methanocaldococcus jannaschii} (A:) Length = 187 Score = 44.0 bits (103), Expect = 8e-06 Identities = 12/69 (17%), Positives = 26/69 (37%), Gaps = 9/69 (13%) Query: 14 HYLAVGEINLDGSL-------PAAICAKNMN-KDFICPQSCGSEAAWASDSLRIVAPSTL 65 + G ++L G++ AK K I P++ + + I+ TL Sbjct: 118 DFAITGSLDLSGNVLAIGGVNEKIEAAKRYGFKRVIIPEANXIDVIETEG-IEIIPVKTL 176 Query: 66 LELINHLNN 74 E++ + + Sbjct: 177 DEIVPLVFD 185 >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (A:1221-1330,A:1541-1688) Length = 258 Score = 24.8 bits (54), Expect = 4.0 Identities = 15/66 (22%), Positives = 25/66 (37%), Gaps = 19/66 (28%) Query: 4 IQAISTESFSHYLA--VGEINLDGSLPAAIC----AKNM-NKDF------ICPQSCGSEA 50 + I +E + +L EI+ + A A+ DF I P G+ A Sbjct: 55 AEEIPSEDQNEFLLERTREIHNE-----AESQLRAAQQQWGNDFYKRDPRIAPLR-GALA 108 Query: 51 AWASDS 56 ++ DS Sbjct: 109 TYSKDS 114 >1xl7_A COT, peroxisomal carnitine O-octanoyltransferase; selenomethionine, hepes; HET: EPE; 2.00A {Mus musculus} (A:1-95,A:393-612) Length = 315 Score = 23.8 bits (51), Expect = 8.9 Identities = 8/35 (22%), Positives = 19/35 (54%) Query: 74 NKQLLPQPCKSTYKKRDNLPNFAEIKGQKTIKRAL 108 QL + T++ +D+LP+ ++++K+ L Sbjct: 2 ENQLTKSVEERTFQYQDSLPSLPVPALEESLKKYL 36 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.316 0.129 0.379 Gapped Lambda K H 0.267 0.0606 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 747,884 Number of extensions: 27581 Number of successful extensions: 50 Number of sequences better than 10.0: 1 Number of HSP's gapped: 49 Number of HSP's successfully gapped: 4 Length of query: 108 Length of database: 4,956,049 Length adjustment: 64 Effective length of query: 44 Effective length of database: 2,792,529 Effective search space: 122871276 Effective search space used: 122871276 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.3 bits)