RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781027|ref|YP_003065440.1| hypothetical protein CLIBASIA_04645 [Candidatus Liberibacter asiaticus str. psy62] (108 letters) >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 Length = 350 Score = 31.5 bits (70), Expect = 0.048 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Query: 80 QPCKSTYKKRDNLPNFAEIKGQKTIKRAL 108 QP S K R P F+ I GQ+ +K AL Sbjct: 9 QPSASGAKTRPVFP-FSAIVGQEDMKLAL 36 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 28.0 bits (62), Expect = 0.48 Identities = 9/54 (16%), Positives = 19/54 (35%), Gaps = 20/54 (37%) Query: 7 ISTESF-SHYLAVGEINLDGSLPAAICAKNMNKDFICPQSCGSEAAWASDSLRI 59 +++ F SH L PA+ D I + ++ + ++I Sbjct: 423 VAS-PFHSHLLV----------PAS--------DLINKDLVKNNVSFNAKDIQI 457 >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 27.3 bits (59), Expect = 0.78 Identities = 13/37 (35%), Positives = 15/37 (40%), Gaps = 13/37 (35%) Query: 1 MASIQAISTESFSHYLAVGEINLDGSLPA-AICAKNM 36 + +QA S Y A D S PA AI A M Sbjct: 22 LKKLQA----SLKLY-A------DDSAPALAIKA-TM 46 >3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 Score = 26.8 bits (59), Expect = 1.2 Identities = 5/16 (31%), Positives = 6/16 (37%), Gaps = 1/16 (6%) Query: 33 AKNMNKDFICPQSCGS 48 N+N CP C Sbjct: 15 GPNLNIVLTCP-ECKV 29 >2vvy_A Protein B15, B14; IKK, IKK beta, BCL-2 family, early protein, HOST-virus interaction, viral protein, immunomodulator, NF-KB activation; 2.69A {Vaccinia virus} Length = 169 Score = 25.2 bits (55), Expect = 3.4 Identities = 14/65 (21%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Query: 35 NMNKDFICPQSCGSEAAWASDSLRIVAPSTLLELINHLNNKQLLPQPCKSTYKKRDNLPN 94 N + PQ CG + + D +R L E I + Q Y + + Sbjct: 24 NFSTHVFSPQHCGCDRLTSIDDVRQC----LTEYIYWSSYAYRNRQCAGQLYSTLLSFRD 79 Query: 95 FAEIK 99 AE+ Sbjct: 80 DAELV 84 >1vsy_5 Proteasome activator BLM10; 20S proteasome BLM10, cytoplasm, hydrolase, nucleus, phospho protease, threonine protease, isopeptide bond; 3.00A {Saccharomyces cerevisiae} PDB: 3l5q_6 Length = 997 Score = 25.1 bits (54), Expect = 4.2 Identities = 4/27 (14%), Positives = 6/27 (22%), Gaps = 4/27 (14%) Query: 62 PSTLLELINHLNNKQLLPQPCKSTYKK 88 P L L + + K Sbjct: 937 PKNLSNLSSWART----SGMTGNAAKN 959 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.316 0.129 0.379 Gapped Lambda K H 0.267 0.0593 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 861,975 Number of extensions: 32603 Number of successful extensions: 66 Number of sequences better than 10.0: 1 Number of HSP's gapped: 65 Number of HSP's successfully gapped: 7 Length of query: 108 Length of database: 5,693,230 Length adjustment: 72 Effective length of query: 36 Effective length of database: 3,947,662 Effective search space: 142115832 Effective search space used: 142115832 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.3 bits)