BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781027|ref|YP_003065440.1| hypothetical protein CLIBASIA_04645 [Candidatus Liberibacter asiaticus str. psy62] (108 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781027|ref|YP_003065440.1| hypothetical protein CLIBASIA_04645 [Candidatus Liberibacter asiaticus str. psy62] Length = 108 Score = 224 bits (570), Expect = 4e-61, Method: Compositional matrix adjust. Identities = 108/108 (100%), Positives = 108/108 (100%) Query: 1 MASIQAISTESFSHYLAVGEINLDGSLPAAICAKNMNKDFICPQSCGSEAAWASDSLRIV 60 MASIQAISTESFSHYLAVGEINLDGSLPAAICAKNMNKDFICPQSCGSEAAWASDSLRIV Sbjct: 1 MASIQAISTESFSHYLAVGEINLDGSLPAAICAKNMNKDFICPQSCGSEAAWASDSLRIV 60 Query: 61 APSTLLELINHLNNKQLLPQPCKSTYKKRDNLPNFAEIKGQKTIKRAL 108 APSTLLELINHLNNKQLLPQPCKSTYKKRDNLPNFAEIKGQKTIKRAL Sbjct: 61 APSTLLELINHLNNKQLLPQPCKSTYKKRDNLPNFAEIKGQKTIKRAL 108 >gi|254780768|ref|YP_003065181.1| hypothetical protein CLIBASIA_03295 [Candidatus Liberibacter asiaticus str. psy62] Length = 281 Score = 22.3 bits (46), Expect = 2.3, Method: Compositional matrix adjust. Identities = 15/53 (28%), Positives = 23/53 (43%), Gaps = 7/53 (13%) Query: 63 STLLELINHLNNKQLLP-------QPCKSTYKKRDNLPNFAEIKGQKTIKRAL 108 S L +++ NN ++L + CKS R +LP+ Q IK L Sbjct: 191 SMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.316 0.129 0.379 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,644 Number of Sequences: 1233 Number of extensions: 2297 Number of successful extensions: 3 Number of sequences better than 100.0: 3 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 108 length of database: 328,796 effective HSP length: 62 effective length of query: 46 effective length of database: 252,350 effective search space: 11608100 effective search space used: 11608100 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)