HHsearch alignment of GI: 254781028 and MMDB domain: 1rre_A_

>1rre_A (A:) ATP-dependent protease LA; catalytic Ser-Lys DYAD, hydrolase; HET: MSE; 1.75A {Escherichia coli}
Probab=98.79  E-value=2e-08  Score=70.73  Aligned_cols=78  Identities=9%  Similarity=0.109  Sum_probs=70.6

Q ss_pred             CEEEEEEEEEEEEEEEEEEEEEECCCCCCEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCC--CCCCCEEEEEEECHHHH
Q ss_conf             9369999999733017899999846897437996162588899989999999977984421--12894047996375889
Q gi|254781028|r    1 MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV--NELPSIYLQLIYQKKDL   78 (87)
Q Consensus         1 Mlski~S~al~Gi~a~~V~VEv~is~GlP~f~iVGLpD~aVkESreRVrsAl~nsGl~F~~--~~~p~~~~tinl~p~dl   78 (87)
                      |+.++++.++.|.+++++.||+...+|.|.+.++|+++...+|+++|+++|+.+.+..+..  ..+|..++++|+++.|.
T Consensus        10 ~~g~v~~~~v~~~~~~~~~iE~~~~~g~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~i~i~~~~~~~   89 (200)
T 1rre_A           10 RVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVXQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGAT   89 (200)
T ss_dssp             CCEEEEEEEEETTEEEEEEEEEEEEECSSCEEEESSBCHHHHHHHHHHHHHHHHTHHHHTCCTTTTTSEEEEEECSSTTS
T ss_pred             CCEEEEEEEEECCCCEEEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHCCCEEEEECCCCC
T ss_conf             62799877995799877999999982688632234554012578999999999986650677013322303454214654