HHsearch results for GI: 254781028 and protein with PDBid: 3m6a_A

>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, cytoplasm, hydrolase, nucleotide-B protease, serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A
Probab=96.70  E-value=0.011  Score=36.23  Aligned_cols=73  Identities=14%  Similarity=0.174  Sum_probs=62.7

Q ss_pred             EEEEEEEEEEEEEEEEEEEEEECCCCCCEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCCC--CCCCEEEEEEEC
Q ss_conf             3699999997330178999998468974379961625888999899999999779844211--289404799637
Q gi|254781028|r    2 ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVN--ELPSIYLQLIYQ   74 (87)
Q Consensus         2 lski~S~al~Gi~a~~V~VEv~is~GlP~f~iVGLpD~aVkESreRVrsAl~nsGl~F~~~--~~p~~~~tinl~   74 (87)
                      ++.+++.+..|..+..+.+|+...+|...+.++|..+...|||.....|.+++....|-..  .+....|.||..
T Consensus       354 vGvv~GLa~t~~GG~il~iE~~~~~G~g~l~lTG~lG~vmkES~~~A~s~~~~~~~~~~i~~~~~~~~dIHih~p  428 (543)
T 3m6a_A          354 VGVVTGLAYTTVGGDTLSIEVSLSPGKGKLILTGKLGDVMRESAQAAFSYVRSKTEELGIEPDFHEKYDIHIHVP  428 (543)
T ss_dssp             SSEEEEEEEETTEEEEEEEEEEEESSCSCEEEEESCCHHHHHHHHHHHHHHTSSCGGGSSCSSCTTTCEEEEEEC
T ss_pred             CCEEEEEEEECCCCCEEEEEEEECCCCCCCCEECCHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHCCEEEECC
T ss_conf             865888778736885389998750898861121127799999999999999988998788915644133567347