BLAST/PSIBLAST alignment of GI: 254781028 and GI: 150398731 at iteration 1
>gi|150398731|ref|YP_001329198.1| Mg chelatase subunit ChlI [Sinorhizobium medicae WSM419] Length = 532
>gi|150030246|gb|ABR62363.1| Mg chelatase, subunit ChlI [Sinorhizobium medicae WSM419] Length = 532
 Score = 90.9 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 40/57 (70%), Positives = 52/57 (91%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGL 57
          M++R+ST+AFQGI+G+PV+VQVMV+PGRVG+QIVGLPDKAV ESRER+Q+    +GL
Sbjct: 23 MVARVSTVAFQGIEGLPVDVQVMVAPGRVGMQIVGLPDKAVAESRERVQAALHASGL 79