BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781028|ref|YP_003065441.1| putative Mg2+ chelatase family
protein [Candidatus Liberibacter asiaticus str. psy62]
         (87 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|258593812|emb|CBE70153.1| putative enzyme (N-terminal); transcriptional regulator with
          P-loop containing NTP hydrolase domain
          (C-terminal)(yifB) [NC10 bacterium 'Dutch sediment']
          Length = 510

 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ + A  G++   V+V+V ++ G      VGLPD AV ESR+R+++   + G  F 
Sbjct: 1  MLAKVLSSAVLGVEAYLVDVEVDIAQGLPNFNTVGLPDAAVKESRDRVRAAIKNCGFDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     D+
Sbjct: 60 ----PARRITVNLAPADI 73


>gi|325283871|ref|YP_004256412.1| Mg chelatase, subunit ChlI [Deinococcus proteolyticus MRP]
 gi|324315680|gb|ADY26795.1| Mg chelatase, subunit ChlI [Deinococcus proteolyticus MRP]
          Length = 426

 Score =  124 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 48/78 (61%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + A  G+  +PVEV+V VSPG     +VGLPD+AV E+RER+++   ++GL F 
Sbjct: 1  MLARVRSAALVGVDAVPVEVEVDVSPGLPSFMVVGLPDQAVSEARERVRAAIRNSGLPF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     DL
Sbjct: 60 ----PAARITVNLAPADL 73


>gi|256750724|ref|ZP_05491609.1| Mg chelatase, subunit ChlI [Thermoanaerobacter ethanolicus CCSD1]
 gi|256750307|gb|EEU63326.1| Mg chelatase, subunit ChlI [Thermoanaerobacter ethanolicus CCSD1]
          Length = 510

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S++ ++A  GI    VEV+V +S G     IVGL D  V E+R+R++S   ++G    
Sbjct: 1  MLSKVKSMAVLGINAYVVEVEVDLSTGIPSFDIVGLGDTEVKEARDRVRSAIKNSGF--- 57

Query: 61 VNELPSIYLQLIYQKKD 77
            E P   + +     D
Sbjct: 58 --EFPLKKITVNLAPAD 72


>gi|167040343|ref|YP_001663328.1| Mg chelatase subunit ChlI [Thermoanaerobacter sp. X514]
 gi|300914427|ref|ZP_07131743.1| Mg chelatase, subunit ChlI [Thermoanaerobacter sp. X561]
 gi|307724337|ref|YP_003904088.1| Mg chelatase subunit ChlI [Thermoanaerobacter sp. X513]
 gi|166854583|gb|ABY92992.1| Mg chelatase, subunit ChlI [Thermoanaerobacter sp. X514]
 gi|300889362|gb|EFK84508.1| Mg chelatase, subunit ChlI [Thermoanaerobacter sp. X561]
 gi|307581398|gb|ADN54797.1| Mg chelatase, subunit ChlI [Thermoanaerobacter sp. X513]
          Length = 510

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S++ ++A  GI    VEV+V +S G     IVGL D  V E+R+R++S   ++G    
Sbjct: 1  MLSKVKSMAVLGINAYVVEVEVDLSTGIPSFDIVGLGDTEVKEARDRVRSAIKNSGF--- 57

Query: 61 VNELPSIYLQLIYQKKD 77
            E P   + +     D
Sbjct: 58 --EFPLKKITVNLAPAD 72


>gi|307264852|ref|ZP_07546414.1| Mg chelatase, subunit ChlI [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306920110|gb|EFN50322.1| Mg chelatase, subunit ChlI [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 510

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S++ ++A  GI    VEV+V +S G     IVGL D  V E+R+R++S   ++G    
Sbjct: 1  MLSKVKSMAVLGINAYVVEVEVDLSTGIPSFDIVGLGDTEVKEARDRVRSAIKNSGF--- 57

Query: 61 VNELPSIYLQLIYQKKD 77
            E P   + +     D
Sbjct: 58 --EFPLKKITVNLAPAD 72


>gi|297544723|ref|YP_003677025.1| Mg chelatase subunit ChlI [Thermoanaerobacter mathranii subsp.
          mathranii str. A3]
 gi|296842498|gb|ADH61014.1| Mg chelatase, subunit ChlI [Thermoanaerobacter mathranii subsp.
          mathranii str. A3]
          Length = 510

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S++ ++A  GI    VEV+V +S G     IVGL D  V E+R+R++S   ++G    
Sbjct: 1  MLSKVKSMAVLGINAYVVEVEVDLSTGIPSFDIVGLGDTEVKEARDRVRSAIKNSGF--- 57

Query: 61 VNELPSIYLQLIYQKKD 77
            E P   + +     D
Sbjct: 58 --EFPLKKITVNLAPAD 72


>gi|167037682|ref|YP_001665260.1| Mg chelatase subunit ChlI [Thermoanaerobacter pseudethanolicus
          ATCC 33223]
 gi|320116097|ref|YP_004186256.1| Mg chelatase subunit ChlI [Thermoanaerobacter brockii subsp.
          finnii Ako-1]
 gi|166856516|gb|ABY94924.1| Mg chelatase, subunit ChlI [Thermoanaerobacter pseudethanolicus
          ATCC 33223]
 gi|319929188|gb|ADV79873.1| Mg chelatase, subunit ChlI [Thermoanaerobacter brockii subsp.
          finnii Ako-1]
          Length = 510

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S++ ++A  GI    VEV+V +S G     IVGL D  V E+R+R++S   ++G    
Sbjct: 1  MLSKVKSMAVLGINAYVVEVEVDLSTGIPSFDIVGLGDTEVKEARDRVRSAIKNSGF--- 57

Query: 61 VNELPSIYLQLIYQKKD 77
            E P   + +     D
Sbjct: 58 --EFPLKKITVNLAPAD 72


>gi|289578447|ref|YP_003477074.1| Mg chelatase, subunit ChlI [Thermoanaerobacter italicus Ab9]
 gi|289528160|gb|ADD02512.1| Mg chelatase, subunit ChlI [Thermoanaerobacter italicus Ab9]
          Length = 510

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S++ ++A  GI    VEV+V +S G     IVGL D  V E+R+R++S   ++G    
Sbjct: 1  MLSKVKSMAVLGINAYVVEVEVDLSTGIPSFDIVGLGDTEVKEARDRVRSAIKNSGF--- 57

Query: 61 VNELPSIYLQLIYQKKD 77
            E P   + +     D
Sbjct: 58 --EFPLKKITVNLAPAD 72


>gi|326389496|ref|ZP_08211063.1| Mg chelatase, subunit ChlI [Thermoanaerobacter ethanolicus JW
          200]
 gi|325994501|gb|EGD52926.1| Mg chelatase, subunit ChlI [Thermoanaerobacter ethanolicus JW
          200]
          Length = 510

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S++ ++A  GI    VEV+V +S G     IVGL D  V E+R+R++S   ++G    
Sbjct: 1  MLSKVKSMAVLGINAYVVEVEVDLSTGIPSFDIVGLGDTEVKEARDRVRSAIKNSGF--- 57

Query: 61 VNELPSIYLQLIYQKKD 77
            E P   + +     D
Sbjct: 58 --EFPLKKITVNLAPAD 72


>gi|15605825|ref|NP_213202.1| hypothetical protein aq_291 [Aquifex aeolicus VF5]
 gi|2982994|gb|AAC06607.1| hypothetical protein aq_291 [Aquifex aeolicus VF5]
          Length = 492

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S++ +    G++  PVEVQV +S G     +VGLPD +V E+RER++S   ++G  F 
Sbjct: 1  MFSKVLSGGLWGVEAFPVEVQVDISQGLPSFNVVGLPDSSVKEARERVRSAVKNSGFSF- 59

Query: 61 VNELPSIYLQLIYQKKD 77
              P   + +     D
Sbjct: 60 ----PLKRITVNLSPSD 72


>gi|15806659|ref|NP_295379.1| Mg(2+) chelatase family protein [Deinococcus radiodurans R1]
 gi|6459421|gb|AAF11212.1|AE002008_7 Mg(2+) chelatase family protein [Deinococcus radiodurans R1]
          Length = 519

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 48/78 (61%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R  ++A  G+  +PVEV+V VSPG     +VGLPD+AV E+RER+++   ++GL F 
Sbjct: 21 MLARARSVALIGVDAVPVEVEVDVSPGLPAFTVVGLPDQAVSEARERVRAAVRNSGLPF- 79

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     DL
Sbjct: 80 ----PAARITVNLAPADL 93


>gi|94266935|ref|ZP_01290588.1| Mg chelatase-related protein [delta proteobacterium MLMS-1]
 gi|93452387|gb|EAT03006.1| Mg chelatase-related protein [delta proteobacterium MLMS-1]
          Length = 511

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + A  G++G+ V+V+V +  G      VGL + AV ES+ER+++   ++G    
Sbjct: 1  MLARVQSGAVVGVEGLLVDVEVDIGRGLPQFTTVGLAEGAVRESKERVRAAIKNSGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P+  + +     DL
Sbjct: 58 --EFPNRRITINLAPADL 73


>gi|94263387|ref|ZP_01287201.1| Mg chelatase-related protein [delta proteobacterium MLMS-1]
 gi|93456223|gb|EAT06357.1| Mg chelatase-related protein [delta proteobacterium MLMS-1]
          Length = 511

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + A  G++G+ V+V+V +  G      VGL + AV ES+ER+++   ++G    
Sbjct: 1  MLARVQSGAVVGVEGLLVDVEVDIGRGLPQFTTVGLAEGAVRESKERVRAAIKNSGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P+  + +     DL
Sbjct: 58 --EFPNRRITINLAPADL 73


>gi|302392406|ref|YP_003828226.1| Mg chelatase, subunit ChlI [Acetohalobium arabaticum DSM 5501]
 gi|302204483|gb|ADL13161.1| Mg chelatase, subunit ChlI [Acetohalobium arabaticum DSM 5501]
          Length = 509

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MIS++ + A  GI+   V+V++ ++ G     +VGLP+  V ESRER+++   ++G  F 
Sbjct: 1  MISKVISSAVLGIEAYLVDVEIDLAQGLPSFNLVGLPNTVVKESRERVRAAIKNSGFNF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 60 ----PVKRITVNLAPADI 73


>gi|253681967|ref|ZP_04862764.1| putative Mg chelatase family protein [Clostridium botulinum D
          str. 1873]
 gi|253561679|gb|EES91131.1| putative Mg chelatase family protein [Clostridium botulinum D
          str. 1873]
          Length = 509

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ ++++  F GI G  + V++ +S G     IVGLPD +V ES+ER+++  I++G  F 
Sbjct: 1  MVIKVNSATFTGINGNIINVEIDISNGLPTFNIVGLPDVSVKESKERVRAAIINSGFKF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 60 ----PMKRITVNLAPADV 73


>gi|189423408|ref|YP_001950585.1| Mg chelatase, subunit ChlI [Geobacter lovleyi SZ]
 gi|189419667|gb|ACD94065.1| Mg chelatase, subunit ChlI [Geobacter lovleyi SZ]
          Length = 390

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ +    GI  I V+V+V ++ G      VGLPD AV ES++R+++   ++G  F 
Sbjct: 1  MLAKVLSATVVGIDAILVDVEVDIAQGLPQFSTVGLPDGAVKESKDRVKAALKNSGYDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   +       DL
Sbjct: 60 ----PPRRITANLAPADL 73


>gi|296133525|ref|YP_003640772.1| Mg chelatase, subunit ChlI [Thermincola sp. JR]
 gi|296032103|gb|ADG82871.1| Mg chelatase, subunit ChlI [Thermincola potens JR]
          Length = 514

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ +++    G++ +PV V+V VS G     +VGLPD AV E+RER+++   ++G    
Sbjct: 1  MLAAVNSAVVVGLQAVPVTVEVDVSNGLPSFDVVGLPDTAVREARERVRAAIKNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     D+
Sbjct: 58 --EFPLQRITVNLAPADI 73


>gi|262370193|ref|ZP_06063520.1| competence protein comM [Acinetobacter johnsonii SH046]
 gi|262315232|gb|EEY96272.1| competence protein comM [Acinetobacter johnsonii SH046]
          Length = 499

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           ++I T A  G+    VEV+V +S G   + IVGLP+ AV ES++R++S  I++G  F  
Sbjct: 7  FAKIYTRALLGLHAPSVEVEVHLSQGLPSLTIVGLPEAAVRESKDRVRSAIINSGFQF-- 64

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  L +     DL
Sbjct: 65 ---PTKRLTINLAPADL 78


>gi|28210943|ref|NP_781887.1| Mg(2+) chelatase family protein [Clostridium tetani E88]
 gi|28203382|gb|AAO35824.1| Mg(2+) chelatase family protein [Clostridium tetani E88]
          Length = 524

 Score =  120 bits (302), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +I+T  F GI+GIP+ V+V ++ G     IVG+ D ++ ES++R++S  I++G    
Sbjct: 24 MVVKINTATFTGIEGIPINVEVDINRGLPNFNIVGMADTSIKESKDRVRSAIINSGF--- 80

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     D+
Sbjct: 81 --EFPLGKITVNLAPADI 96


>gi|331269645|ref|YP_004396137.1| putative Mg chelatase [Clostridium botulinum BKT015925]
 gi|329126195|gb|AEB76140.1| putative Mg chelatase [Clostridium botulinum BKT015925]
          Length = 508

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +I++  F GI G  + V++ +S G     IVGLPD +V ES+ER+++  I++G  F 
Sbjct: 1  MVIKINSATFTGINGNIINVEIDISNGLPTFNIVGLPDVSVKESKERVRAAIINSGFQF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 60 ----PMKRITVNLAPADV 73


>gi|148657847|ref|YP_001278052.1| Mg chelatase subunit ChlI [Roseiflexus sp. RS-1]
 gi|148569957|gb|ABQ92102.1| Mg chelatase, subunit ChlI [Roseiflexus sp. RS-1]
          Length = 505

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ + A  G++G+ VEV+V ++ G     IVGL D AV ESRER+++   ++G  F 
Sbjct: 1  MLAKVYSSAVIGLEGVLVEVEVDIAQGLPAFTIVGLGDTAVQESRERVRAAVRNSGYSF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PMKRITVNLAPADL 73


>gi|226356793|ref|YP_002786533.1| Mg2+ chelatase family protein [Deinococcus deserti VCD115]
 gi|226318783|gb|ACO46779.1| putative Mg2+ chelatase family protein [Deinococcus deserti
          VCD115]
          Length = 499

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 49/78 (62%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ ++A  G+  +PVEV+V VSPG     +VGLPD+AV E+RER+++   +AGL F 
Sbjct: 1  MLARVRSVALIGVDAVPVEVEVDVSPGLPAFTVVGLPDQAVSEARERVRAAVRNAGLPF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     DL
Sbjct: 60 ----PAARITVNLAPADL 73


>gi|118444422|ref|YP_878277.1| Mg chelatase-related protein [Clostridium novyi NT]
 gi|118134878|gb|ABK61922.1| Mg chelatase-related protein [Clostridium novyi NT]
          Length = 347

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+++I +  F GI G  + V++ +S G     IVG+PD AV ES+ER+++  I++G    
Sbjct: 1  MVTKIKSATFTGINGTIINVEIDISNGLPAFNIVGIPDIAVKESKERVRAAIINSGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     DL
Sbjct: 58 --EFPMRRITINLAPADL 73


>gi|147678025|ref|YP_001212240.1| ATPase [Pelotomaculum thermopropionicum SI]
 gi|146274122|dbj|BAF59871.1| predicted ATPase [Pelotomaculum thermopropionicum SI]
          Length = 513

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI+ + + A  G++G  VEV+V VS G     IVGLPD +V E+++R+++   ++GL   
Sbjct: 1  MIAIVKSTALHGLEGQIVEVEVDVSNGLPCFDIVGLPDTSVREAKDRVRAAIKNSGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     DL
Sbjct: 58 --EFPVKRITVNLAPADL 73


>gi|20807902|ref|NP_623073.1| ATPase with chaperone activity [Thermoanaerobacter tengcongensis
          MB4]
 gi|254479477|ref|ZP_05092802.1| putative Mg chelatase [Carboxydibrachium pacificum DSM 12653]
 gi|20516469|gb|AAM24677.1| predicted ATPase with chaperone activity [Thermoanaerobacter
          tengcongensis MB4]
 gi|214034581|gb|EEB75330.1| putative Mg chelatase [Carboxydibrachium pacificum DSM 12653]
          Length = 510

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S++ T+A  GI    V+V++ +  G     IVGL D  V E+R+R+++   ++G  F 
Sbjct: 1  MLSKVKTMAILGIDAYVVDVEIDLGTGIPSFDIVGLGDTEVKEARDRVRAAIKNSGFDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 60 ----PLKKITVNLAPADI 73


>gi|94985494|ref|YP_604858.1| Mg chelatase-related protein [Deinococcus geothermalis DSM 11300]
 gi|94555775|gb|ABF45689.1| Mg chelatase-related protein [Deinococcus geothermalis DSM 11300]
          Length = 499

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 48/78 (61%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R  ++A  G+  +PVEV+V VSPG     +VGLPD+AV E+RER+++   +AGL F 
Sbjct: 1  MLARARSVALIGVDAVPVEVEVDVSPGLPAFTVVGLPDQAVSEARERVRAAVRNAGLPF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     DL
Sbjct: 60 ----PAARITVNLAPADL 73


>gi|167630276|ref|YP_001680775.1| mg chelatase, subunit chli, putative [Heliobacterium
          modesticaldum Ice1]
 gi|167593016|gb|ABZ84764.1| mg chelatase, subunit chli, putative [Heliobacterium
          modesticaldum Ice1]
          Length = 557

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ ++  +G+   P+EV+V V+ G     +VGLP  AV E+RER++S   ++G    
Sbjct: 1  MLARVHSVVLEGLNAQPIEVEVDVANGLPAFDLVGLPATAVREARERVRSALRNSGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     D+
Sbjct: 58 --EFPLRRITVNLAPADV 73


>gi|148266042|ref|YP_001232748.1| Mg chelatase, subunit ChlI [Geobacter uraniireducens Rf4]
 gi|146399542|gb|ABQ28175.1| Mg chelatase, subunit ChlI [Geobacter uraniireducens Rf4]
          Length = 509

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ + A  GI  I V+V+V ++ G      VGLPD AV ES++R++S   ++G    
Sbjct: 1  MLAKVLSSALLGIDAIMVDVEVDIAQGLPQFATVGLPDGAVKESKDRVKSALKNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P+  + +     D+
Sbjct: 58 --EFPNRKITVNLAPADV 73


>gi|237755384|ref|ZP_04584012.1| competence protein ComM [Sulfurihydrogenibium yellowstonense
          SS-5]
 gi|237692468|gb|EEP61448.1| competence protein ComM [Sulfurihydrogenibium yellowstonense
          SS-5]
          Length = 340

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 42/81 (51%), Gaps = 5/81 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S + +    GI G  V+V+V +S G     +VGLPD AV ESRER++S   + G  F 
Sbjct: 1  MLSVVKSGGTYGINGYVVDVEVNISQGLPQFTVVGLPDTAVKESRERVRSAIENIGYKF- 59

Query: 61 VNELPSIYLQLIYQKKDLIMI 81
              P   + +     D++ I
Sbjct: 60 ----PVKKITVNLAPADVLKI 76


>gi|258514505|ref|YP_003190727.1| Mg chelatase, subunit ChlI [Desulfotomaculum acetoxidans DSM 771]
 gi|257778210|gb|ACV62104.1| Mg chelatase, subunit ChlI [Desulfotomaculum acetoxidans DSM 771]
          Length = 516

 Score =  118 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S I + A  G+ G  ++V+V VS G  G  IVGLPD AV ESR+R+++   ++G  F 
Sbjct: 1  MLSIIKSTALIGLDGQVIQVEVDVSSGLPGFDIVGLPDAAVRESRDRVRTAIRNSGYDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 60 ----PVKKITVNLAPADI 73


>gi|39995597|ref|NP_951548.1| Mg chelatase-related protein [Geobacter sulfurreducens PCA]
 gi|39982360|gb|AAR33821.1| Mg chelatase-related protein [Geobacter sulfurreducens PCA]
 gi|298504616|gb|ADI83339.1| Mg chelatase-related chaperone ATPase [Geobacter sulfurreducens
          KN400]
          Length = 509

 Score =  118 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+++  + A  GI  + V+V+V +SPG      VGLPD AV ES++R++S   +AG  F 
Sbjct: 1  MLAKALSSALLGIDAVIVDVEVDISPGLPQFATVGLPDGAVKESKDRVKSALKNAGYDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PPRKITVNLAPADL 73


>gi|294648968|ref|ZP_06726416.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
          19194]
 gi|292825103|gb|EFF83858.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
          19194]
          Length = 202

 Score =  118 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           ++I T    G+    +EV+V +S G   + IVGLP+ AV ES++R++S  I++G LF  
Sbjct: 16 FAKIYTRGLLGLHAPQIEVEVHISSGLPSLTIVGLPEAAVRESKDRVRSAIINSGFLF-- 73

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  L +     DL
Sbjct: 74 ---PTKRLTINLAPADL 87


>gi|297569364|ref|YP_003690708.1| Mg chelatase, subunit ChlI [Desulfurivibrio alkaliphilus AHT2]
 gi|296925279|gb|ADH86089.1| Mg chelatase, subunit ChlI [Desulfurivibrio alkaliphilus AHT2]
          Length = 508

 Score =  118 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ + A  G+ G+ V+V+V ++ G      VGL + AV ES+ER+++   ++G    
Sbjct: 1  MLAKVKSGAVVGVDGLLVDVEVDIARGLPVFTTVGLAEGAVRESKERVKAAVKNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P+  + +     DL
Sbjct: 58 --EFPARRITINLAPADL 73


>gi|126661166|ref|ZP_01732243.1| Mg chelatase-related protein [Cyanothece sp. CCY0110]
 gi|126617539|gb|EAZ88331.1| Mg chelatase-related protein [Cyanothece sp. CCY0110]
          Length = 509

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+   +  GI  + V V+V V+ G   + IVGLPD AV ESRER+++   ++G  F 
Sbjct: 1  MLARVWCASLVGIDAVKVGVEVDVAGGLPAITIVGLPDTAVQESRERVKAAIKNSGFAF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PVRKIIINLAPADL 73


>gi|95930509|ref|ZP_01313244.1| Mg chelatase-related protein [Desulfuromonas acetoxidans DSM 684]
 gi|95133344|gb|EAT15008.1| Mg chelatase-related protein [Desulfuromonas acetoxidans DSM 684]
          Length = 508

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ I + A  GI   PVEV+V V+ G      VGLP+ AV ES++R++S   ++G  F 
Sbjct: 1  MLANILSGALIGIDAYPVEVEVDVAQGLPQFSTVGLPEGAVKESKDRVKSAIKNSGYDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 60 ----PVRRITVNLAPADI 73


>gi|172038974|ref|YP_001805475.1| Mg chelatase-like protein [Cyanothece sp. ATCC 51142]
 gi|171700428|gb|ACB53409.1| Mg chelatase-like protein [Cyanothece sp. ATCC 51142]
          Length = 509

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+   +  GI  + V V+V V+ G   + IVGLPD AV ESRER+++   ++G  F 
Sbjct: 1  MLARVWCASLVGIDAVKVGVEVDVAGGLPAITIVGLPDTAVQESRERVKAAIKNSGFAF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PVRKIIINLAPADL 73


>gi|78224261|ref|YP_386008.1| magnesium chelatase, ChlI subunit [Geobacter metallireducens
          GS-15]
 gi|78195516|gb|ABB33283.1| Magnesium chelatase, ChlI subunit [Geobacter metallireducens
          GS-15]
          Length = 308

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+++  + A  GI  + V+V+V ++ G      VGLPD AV ES++R++S   ++G  F 
Sbjct: 1  MLAKALSSALLGIDAVIVDVEVDIAQGLPQFATVGLPDGAVKESKDRVKSALKNSGYDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PPRKITVNLAPADL 73


>gi|260775000|ref|ZP_05883900.1| Mg(2+) chelatase family protein/ComM-related protein [Vibrio
          coralliilyticus ATCC BAA-450]
 gi|260609090|gb|EEX35249.1| Mg(2+) chelatase family protein/ComM-related protein [Vibrio
          coralliilyticus ATCC BAA-450]
          Length = 507

 Score =  118 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++  PV V+V +S G  G  +VGLP+  V ESR+R++S  I++      
Sbjct: 3  LAIIYSRASVGVEAPPVTVEVHISNGMPGFTLVGLPETTVKESRDRVRSAIINSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKRITVNLAPADL 74


>gi|302037578|ref|YP_003797900.1| putative ATP-dependent protease, Mg chelatase-related protein
          [Candidatus Nitrospira defluvii]
 gi|300605642|emb|CBK41975.1| putative ATP-dependent protease, Mg chelatase-related protein
          [Candidatus Nitrospira defluvii]
          Length = 509

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ + + A  G+    V+V+V +S G     IVGLPD  V ESR+R+++   ++G  F 
Sbjct: 1  MLANVLSAAIVGVDAHLVDVEVDISSGLPQFSIVGLPDATVRESRDRVRAALKNSGFHF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     ++
Sbjct: 60 ----PVKKVTVNLAPANI 73


>gi|156741123|ref|YP_001431252.1| Mg chelatase subunit ChlI [Roseiflexus castenholzii DSM 13941]
 gi|156232451|gb|ABU57234.1| Mg chelatase, subunit ChlI [Roseiflexus castenholzii DSM 13941]
          Length = 505

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ + A  G++G+ VEV+V ++ G     IVGL D AV ESRER+++   + G    
Sbjct: 1  MLAKVYSSAVIGLEGVLVEVEVDIAQGLPSFTIVGLGDTAVQESRERVRAAVRNCG---- 56

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 57 -ASFPMKRITVNLAPADL 73


>gi|295798111|emb|CAX68935.1| Mg chelatase-related protein [uncultured bacterium]
          Length = 506

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MIS   + +  GI+   VE++V VS G   + IVGLPD+AV ES+ER++S   + G    
Sbjct: 1  MISITYSSSAMGIEAHLVEIEVDVSNGLPQMNIVGLPDQAVKESKERVRSALKNCGYN-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     D+
Sbjct: 59 ---IPPKRITINLAPADV 73


>gi|262373922|ref|ZP_06067199.1| competence protein comM [Acinetobacter junii SH205]
 gi|262310933|gb|EEY92020.1| competence protein comM [Acinetobacter junii SH205]
          Length = 495

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           ++I T    G+    +EV+V +S G   + IVGLP+ AV ES++R++S  I++G LF  
Sbjct: 3  FAKIYTRGLLGLHAPQIEVEVHISSGLPSLTIVGLPEAAVRESKDRVRSAIINSGFLF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  L +     DL
Sbjct: 61 ---PTKRLTINLAPADL 74


>gi|262376964|ref|ZP_06070190.1| competence protein comM [Acinetobacter lwoffii SH145]
 gi|262308002|gb|EEY89139.1| competence protein comM [Acinetobacter lwoffii SH145]
          Length = 496

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           ++I T    G+    +EV+V VS G   + IVGLP+ AV ES++R++S  +++G  F  
Sbjct: 3  FAKIYTRGLLGLHAPLIEVEVHVSSGMPSLTIVGLPEAAVRESKDRVRSAILNSGFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  L +     DL
Sbjct: 61 ---PTKRLTINLAPADL 74


>gi|325479505|gb|EGC82601.1| Mg chelatase-like protein [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 509

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S+ +T    G++G  VEV+  ++ G     IVGLPD ++ ES++R++   I++G  F 
Sbjct: 1  MYSKTNTTTLIGLEGKLVEVESDITSGLPSFNIVGLPDSSIKESKDRVRVALINSGYKF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     DL
Sbjct: 60 ----PAGRITINLSPADL 73


>gi|226951726|ref|ZP_03822190.1| Mg chelatase, subunit ChlI [Acinetobacter sp. ATCC 27244]
 gi|226837516|gb|EEH69899.1| Mg chelatase, subunit ChlI [Acinetobacter sp. ATCC 27244]
          Length = 316

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           ++I T    G+    +EV+V +S G   + IVGLP+ AV ES++R++S  I++G LF  
Sbjct: 16 FAKIYTRGLLGLHAPQIEVEVHISSGLPSLTIVGLPEAAVRESKDRVRSAIINSGFLF-- 73

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  L +     DL
Sbjct: 74 ---PTKRLTINLAPADL 87


>gi|218247696|ref|YP_002373067.1| Mg chelatase subunit ChlI [Cyanothece sp. PCC 8801]
 gi|218168174|gb|ACK66911.1| Mg chelatase, subunit ChlI [Cyanothece sp. PCC 8801]
          Length = 509

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + +  GI  I V V+V V+ G   + IVGLPD AV ES+ER++S   ++G  F 
Sbjct: 1  MLARVWSASLMGIDAIKVGVEVDVTGGLPSITIVGLPDTAVQESKERVKSALKNSGFAF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PVRKITINLTPGDL 73


>gi|257060967|ref|YP_003138855.1| Mg chelatase, subunit ChlI [Cyanothece sp. PCC 8802]
 gi|256591133|gb|ACV02020.1| Mg chelatase, subunit ChlI [Cyanothece sp. PCC 8802]
          Length = 509

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + +  GI  I V V+V V+ G   + IVGLPD AV ES+ER++S   ++G  F 
Sbjct: 1  MLARVWSASLMGIDAIKVGVEVDVTGGLPSITIVGLPDTAVQESKERVKSALKNSGFAF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PVRKITINLTPGDL 73


>gi|317050039|ref|YP_004117687.1| Mg chelatase subunit ChlI [Pantoea sp. At-9b]
 gi|316951656|gb|ADU71131.1| Mg chelatase, subunit ChlI [Pantoea sp. At-9b]
          Length = 506

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +SR+ T A  G++   V V+V +S G   + +VGLP+  V E+RER++S  I++G  F  
Sbjct: 3  LSRVLTRAALGVQAPLVTVEVHISNGLPALTLVGLPETTVKEARERVRSAIINSGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRVTINLAPADL 74


>gi|270308255|ref|YP_003330313.1| magnesium chelatase [Dehalococcoides sp. VS]
 gi|270154147|gb|ACZ61985.1| magnesium chelatase [Dehalococcoides sp. VS]
          Length = 506

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++S+ A  G++G  VEV+  +S G     IVGLPD AV E+RER+++   ++G  F 
Sbjct: 1  MLAKVSSCALIGLEGTIVEVETDISAGLPSFTIVGLPDAAVQEARERVRAAIRNSGFTF- 59

Query: 61 VNELPSIYLQLIYQKKD 77
              P   +       D
Sbjct: 60 ----PVKRIVANLAPAD 72


>gi|90019864|ref|YP_525691.1| ComM-like protein [Saccharophagus degradans 2-40]
 gi|89949464|gb|ABD79479.1| magnesium chelatase, ChlI subunit [Saccharophagus degradans 2-40]
          Length = 284

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  GI    V V+V +S G  G  IVGLP+ AV ES++R++S  +++   F  
Sbjct: 3  LAIVHTRAQIGIDAPQVTVEVHLSNGLPGFTIVGLPETAVKESKDRVRSALLNSHFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PQRRITVNLAPADL 74


>gi|320333912|ref|YP_004170623.1| Mg chelatase subunit ChlI [Deinococcus maricopensis DSM 21211]
 gi|319755201|gb|ADV66958.1| Mg chelatase, subunit ChlI [Deinococcus maricopensis DSM 21211]
          Length = 500

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 48/78 (61%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R +++A  G+  +PV V+V VSPG     IVGLPD+A+ E+RER+++   ++GL F 
Sbjct: 1  MLARTTSVALIGVNAVPVTVEVDVSPGLPAFAIVGLPDQALSEARERVRAAVRNSGLPF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     DL
Sbjct: 60 ----PTARITVNLAPADL 73


>gi|150016068|ref|YP_001308322.1| Mg chelatase, subunit ChlI [Clostridium beijerinckii NCIMB 8052]
 gi|149902533|gb|ABR33366.1| Mg chelatase, subunit ChlI [Clostridium beijerinckii NCIMB 8052]
          Length = 506

 Score =  117 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  +I +    G++G  ++V+V +S G     IVGLPD +V E++ER+++  ++ G    
Sbjct: 1  MAVKIISATHNGLEGFLIKVEVDISKGLPVFNIVGLPDTSVKEAKERVRAAILNCGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     D+
Sbjct: 58 --EFPLGRITINLAPADV 73


>gi|304316919|ref|YP_003852064.1| Mg chelatase, subunit ChlI [Thermoanaerobacterium
          thermosaccharolyticum DSM 571]
 gi|302778421|gb|ADL68980.1| Mg chelatase, subunit ChlI [Thermoanaerobacterium
          thermosaccharolyticum DSM 571]
          Length = 510

 Score =  117 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S   ++A  GI G  V+V+V +S G     IVGL D  + ESR+R+++   ++G    
Sbjct: 1  MLSITKSMAIMGIDGYIVDVEVDISNGLPSFDIVGLGDTEIKESRDRVRAAIKNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKD 77
            E P   + +     +
Sbjct: 58 --EFPVEKITVNLAPAN 72


>gi|257066093|ref|YP_003152349.1| Mg chelatase, subunit ChlI [Anaerococcus prevotii DSM 20548]
 gi|256797973|gb|ACV28628.1| Mg chelatase, subunit ChlI [Anaerococcus prevotii DSM 20548]
          Length = 509

 Score =  117 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S+ +T    G+ G  VEV+  ++ G     IVGLPD ++ ESR+R++   +++G  F 
Sbjct: 1  MYSKTNTTTLIGLDGKLVEVESDITSGLPSFTIVGLPDSSIKESRDRVRVALLNSGYRF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     DL
Sbjct: 60 ----PAGRITINLSPADL 73


>gi|227499269|ref|ZP_03929381.1| ATPase [Anaerococcus tetradius ATCC 35098]
 gi|227218678|gb|EEI83909.1| ATPase [Anaerococcus tetradius ATCC 35098]
          Length = 509

 Score =  117 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S+ +T    G+ G  VEV+  ++ G     IVGLPD ++ ES++R++   I++G  F 
Sbjct: 1  MYSKTNTTTLIGLDGKLVEVESDITSGLPTFSIVGLPDSSIKESKDRVRVALINSGYKF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     DL
Sbjct: 60 ----PAGRITINLSPADL 73


>gi|332981645|ref|YP_004463086.1| Mg chelatase subunit ChlI [Mahella australiensis 50-1 BON]
 gi|332699323|gb|AEE96264.1| Mg chelatase, subunit ChlI [Mahella australiensis 50-1 BON]
          Length = 510

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S++ + A  GI G  V+++  VS G     IVGLPD AV ES+ER+++   ++G+   
Sbjct: 1  MFSKVKSCALMGIDGYAVDIETDVSNGLPVFDIVGLPDTAVKESKERVRTAIKNSGM--- 57

Query: 61 VNELPSIYLQLIYQKKD 77
            E P   + +     D
Sbjct: 58 --EFPLKRITINMAPAD 72


>gi|159897214|ref|YP_001543461.1| Mg chelatase subunit ChlI [Herpetosiphon aurantiacus ATCC 23779]
 gi|159890253|gb|ABX03333.1| Mg chelatase, subunit ChlI [Herpetosiphon aurantiacus ATCC 23779]
          Length = 504

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ + A  G+ G  VEV+V +S G     IVGLPD AV E++ER+++   ++G    
Sbjct: 1  MLAKVWSCAVVGLDGALVEVEVDLSRGLPSFTIVGLPDTAVQEAKERVRAAVRNSG---- 56

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   L +     DL
Sbjct: 57 -GSFPDSRLTVNLAPADL 73


>gi|255524248|ref|ZP_05391207.1| Mg chelatase, subunit ChlI [Clostridium carboxidivorans P7]
 gi|296185369|ref|ZP_06853779.1| Mg chelatase-like protein [Clostridium carboxidivorans P7]
 gi|255512073|gb|EET88354.1| Mg chelatase, subunit ChlI [Clostridium carboxidivorans P7]
 gi|296050203|gb|EFG89627.1| Mg chelatase-like protein [Clostridium carboxidivorans P7]
          Length = 505

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  +I++  F GI+G+ V V+V ++ G     IVGL D +V ES++R+++  +++G  F 
Sbjct: 1  MTIKINSATFTGIEGVVVSVEVDIARGMPCFNIVGLADTSVKESKDRVRAAIVNSGFDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 60 ----PVNRITVNLAPADI 73


>gi|183600247|ref|ZP_02961740.1| hypothetical protein PROSTU_03799 [Providencia stuartii ATCC
          25827]
 gi|188020035|gb|EDU58075.1| hypothetical protein PROSTU_03799 [Providencia stuartii ATCC
          25827]
          Length = 508

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  G+    V V+  +S G  G+ +VGLP+ AV ESR+R++S  +++G     
Sbjct: 3  LAIVYTRASIGMNAPLVTVEAHISNGLPGLTLVGLPETAVKESRDRVRSALLNSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKMTINLAPADL 74


>gi|212696915|ref|ZP_03305043.1| hypothetical protein ANHYDRO_01478 [Anaerococcus hydrogenalis DSM
          7454]
 gi|212676205|gb|EEB35812.1| hypothetical protein ANHYDRO_01478 [Anaerococcus hydrogenalis DSM
          7454]
          Length = 509

 Score =  117 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S+ +T+   G+ G  +EV+  ++ G     IVGLPD A+ ES++RI+   I++G  F 
Sbjct: 1  MYSKTNTVTLLGLDGKAIEVESDITSGMPAFNIVGLPDSAIKESKDRIRVALINSGFKF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 60 ----PQGRITINLSPADI 73


>gi|325847092|ref|ZP_08169918.1| Mg chelatase-like protein [Anaerococcus hydrogenalis
          ACS-025-V-Sch4]
 gi|325481064|gb|EGC84109.1| Mg chelatase-like protein [Anaerococcus hydrogenalis
          ACS-025-V-Sch4]
          Length = 509

 Score =  117 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S+ +T+   G+ G  +EV+  ++ G     IVGLPD A+ ES++RI+   I++G  F 
Sbjct: 1  MYSKTNTVTLLGLDGKAIEVESDITSGMPAFNIVGLPDSAIKESKDRIRVALINSGFKF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 60 ----PQGRITINLSPADI 73


>gi|253991639|ref|YP_003042995.1| 2-component regulator [Photorhabdus asymbiotica subsp.
          asymbiotica ATCC 43949]
 gi|253783089|emb|CAQ86254.1| putative 2-component regulator [Photorhabdus asymbiotica]
          Length = 516

 Score =  117 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  GI+   V V+  +S G  G+ +VGLP+ AV E+R+R++S  I++G  +  
Sbjct: 12 LAVIYTRATIGIQAPIVTVEAHISNGLPGLTLVGLPETAVKEARDRVRSALINSGFTY-- 69

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 70 ---PPKRITINLAPADL 83


>gi|332799161|ref|YP_004460660.1| Mg chelatase subunit ChlI [Tepidanaerobacter sp. Re1]
 gi|332696896|gb|AEE91353.1| Mg chelatase, subunit ChlI [Tepidanaerobacter sp. Re1]
          Length = 515

 Score =  117 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ + +  G++   V+V+V +S G     IVGLPD AV ESRER+++   +    F 
Sbjct: 1  MLAQVKSCSIYGLESFLVDVEVDISSGLPAFDIVGLPDIAVRESRERVRAAIKNQEFNF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + L     D+
Sbjct: 60 ----PIKRITLNLAPADI 73


>gi|301062574|ref|ZP_07203212.1| Mg chelatase-like protein [delta proteobacterium NaphS2]
 gi|300443339|gb|EFK07466.1| Mg chelatase-like protein [delta proteobacterium NaphS2]
          Length = 507

 Score =  117 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+++I + A  GI    VEV+V ++ G      VGLP+ AV ES+ER+++   ++G  F 
Sbjct: 1  MLAKILSSAVIGIDAYVVEVEVDIARGLPSFSTVGLPEGAVRESKERVKAAVTNSGYHF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              PS  + +     D+
Sbjct: 60 ----PSDRITVNLAPADI 73


>gi|222053810|ref|YP_002536172.1| Mg chelatase, subunit ChlI [Geobacter sp. FRC-32]
 gi|221563099|gb|ACM19071.1| Mg chelatase, subunit ChlI [Geobacter sp. FRC-32]
          Length = 245

 Score =  117 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ + A  GI  I V+V+V ++ G      VGLPD AV ES++R++S   ++G    
Sbjct: 1  MLAKVLSSALLGIDAIMVDVEVDIAQGLPQFATVGLPDGAVKESKDRVKSALKNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P+  + +     D+
Sbjct: 58 --EFPNRKITVNLAPADV 73


>gi|302389645|ref|YP_003825466.1| Mg chelatase, subunit ChlI [Thermosediminibacter oceani DSM
          16646]
 gi|302200273|gb|ADL07843.1| Mg chelatase, subunit ChlI [Thermosediminibacter oceani DSM
          16646]
          Length = 510

 Score =  117 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ + + A  G+    V+V+V +S G     IVGLPD AV ESRER+++   +    F 
Sbjct: 1  MLATLKSCAIYGLDSFLVDVEVDISSGLPAFDIVGLPDTAVRESRERVRAALKNQNFDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + L     D+
Sbjct: 60 ----PIKRITLNLAPADI 73


>gi|256004773|ref|ZP_05429748.1| Mg chelatase, subunit ChlI [Clostridium thermocellum DSM 2360]
 gi|255991223|gb|EEU01330.1| Mg chelatase, subunit ChlI [Clostridium thermocellum DSM 2360]
 gi|316940788|gb|ADU74822.1| Mg chelatase, subunit ChlI [Clostridium thermocellum DSM 1313]
          Length = 512

 Score =  117 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S+I T+   GI G  V V+  +S G     +VGL D AV ES+ER+++   +AG    
Sbjct: 1  MLSKIKTMGLMGIDGYVVMVETDISNGIPSFDMVGLGDTAVKESKERVRAAIKNAGF--- 57

Query: 61 VNELPSIYLQLIYQKKD 77
            E P   + +     D
Sbjct: 58 --EFPIKRITVNLAPAD 72


>gi|109900550|ref|YP_663805.1| Mg chelatase, subunit ChlI [Pseudoalteromonas atlantica T6c]
 gi|109702831|gb|ABG42751.1| Mg chelatase, subunit ChlI [Pseudoalteromonas atlantica T6c]
          Length = 516

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  GI    + V+V ++ G     +VGLP+ +V E+++R++S  I++G     
Sbjct: 15 LAVVFSRASVGIDAPLITVEVHLANGLPCFNLVGLPEASVREAKDRVRSALINSGF---- 70

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 71 -EFPARRITVNLAPADL 86


>gi|260551103|ref|ZP_05825307.1| competence protein comM [Acinetobacter sp. RUH2624]
 gi|260405870|gb|EEW99358.1| competence protein comM [Acinetobacter sp. RUH2624]
          Length = 495

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           S+I T    G+    +EV+V VS G   + IVGL + AV ES++R++S  I++G  F  
Sbjct: 3  FSKIYTRGLLGLHAPLIEVEVHVSQGLPSLTIVGLAEAAVRESKDRVRSAIINSGFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  L +     DL
Sbjct: 61 ---PTKRLTINLAPADL 74


>gi|255321002|ref|ZP_05362175.1| Mg chelatase homolog [Acinetobacter radioresistens SK82]
 gi|255301966|gb|EET81210.1| Mg chelatase homolog [Acinetobacter radioresistens SK82]
          Length = 494

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           ++I T    G+    +EV+V VS G   + IVGLP+ AV ES++R++S  I++G  F  
Sbjct: 3  FAKIYTRGVLGLHAPSIEVEVHVSQGLPSLTIVGLPEAAVRESKDRVRSAIINSGFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  L +     DL
Sbjct: 61 ---PTKRLTINLAPADL 74


>gi|254409927|ref|ZP_05023707.1| Mg chelatase family protein [Microcoleus chthonoplastes PCC 7420]
 gi|196182963|gb|EDX77947.1| Mg chelatase family protein [Microcoleus chthonoplastes PCC 7420]
          Length = 509

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + +  GI  + V V+V VS G  G+ +VGLPD AV ESRER+++   +AG +F 
Sbjct: 1  MLARVWSASLVGIDAVKVGVEVDVSGGLPGIVVVGLPDTAVQESRERVRAALKNAGFVF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PMRKIVINLTPADL 73


>gi|188996162|ref|YP_001930413.1| magnesium chelatase ChlI subunit [Sulfurihydrogenibium sp.
          YO3AOP1]
 gi|188931229|gb|ACD65859.1| magnesium chelatase ChlI subunit [Sulfurihydrogenibium sp.
          YO3AOP1]
          Length = 309

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 42/81 (51%), Gaps = 5/81 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S + +    GI G  V+V+V +S G     +VGLPD AV ESRER++S   + G  F 
Sbjct: 1  MLSVVKSGGTYGINGYVVDVEVNISQGLPQFTVVGLPDTAVKESRERVRSAIENIGYKF- 59

Query: 61 VNELPSIYLQLIYQKKDLIMI 81
              P   + +     D++ I
Sbjct: 60 ----PVKKITVNLAPADVLKI 76


>gi|262379908|ref|ZP_06073063.1| competence protein comM [Acinetobacter radioresistens SH164]
 gi|262298102|gb|EEY86016.1| competence protein comM [Acinetobacter radioresistens SH164]
          Length = 494

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           ++I T    G+    +EV+V VS G   + IVGLP+ AV ES++R++S  I++G  F  
Sbjct: 3  FAKIYTRGVLGLHAPSIEVEVHVSQGLPSLTIVGLPEAAVRESKDRVRSAIINSGFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  L +     DL
Sbjct: 61 ---PTKRLTINLAPADL 74


>gi|77917733|ref|YP_355548.1| Mg chelatase-like protein [Pelobacter carbinolicus DSM 2380]
 gi|77543816|gb|ABA87378.1| Mg chelatase-related protein [Pelobacter carbinolicus DSM 2380]
          Length = 313

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ + A  GI   PVEV+V +S G      VGLP+ AV ES++R++S   ++G    
Sbjct: 1  MLAKVLSGALLGIDAYPVEVEVDISQGLPQFATVGLPEGAVKESKDRVKSAIKNSGY--- 57

Query: 61 VNELPSIYLQLIYQKK 76
            E P   + +     
Sbjct: 58 --EFPVRRITINLAPA 71


>gi|57234283|ref|YP_181709.1| Mg chelatase-like protein [Dehalococcoides ethenogenes 195]
 gi|57224731|gb|AAW39788.1| Mg chelatase-like protein [Dehalococcoides ethenogenes 195]
          Length = 507

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++S+ A  G++G  VEV+  +S G     IVGLPD A+ E+RER+++   ++G  F 
Sbjct: 1  MLAKVSSCAIIGLEGTIVEVEADISAGLPSFTIVGLPDTAIQEARERVRAAIRNSGFTF- 59

Query: 61 VNELPSIYLQLIYQKKD 77
              P   +       D
Sbjct: 60 ----PVKRIVANLAPAD 72


>gi|125972976|ref|YP_001036886.1| Mg chelatase, subunit ChlI [Clostridium thermocellum ATCC 27405]
 gi|125713201|gb|ABN51693.1| Mg chelatase, subunit ChlI [Clostridium thermocellum ATCC 27405]
          Length = 512

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S+I T+   GI G  V V+  +S G     +VGL D AV ES+ER+++   +AG    
Sbjct: 1  MLSKIKTMGLMGIDGYVVIVETDISNGIPSFDMVGLGDTAVKESKERVRAAIKNAGF--- 57

Query: 61 VNELPSIYLQLIYQKKD 77
            E P   + +     D
Sbjct: 58 --EFPIKRITVNLAPAD 72


>gi|309790113|ref|ZP_07684686.1| Mg chelatase, subunit ChlI [Oscillochloris trichoides DG6]
 gi|308227838|gb|EFO81493.1| Mg chelatase, subunit ChlI [Oscillochloris trichoides DG6]
          Length = 506

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + A  G++G+ VEV+V +  G     +VGL D AV ESRER++S   ++GL F 
Sbjct: 1  MLARVHSCALVGLEGVLVEVEVDIVGGMPAFTVVGLGDAAVQESRERVRSAIRNSGLSF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   L +     DL
Sbjct: 60 ----PLKRLTVNLAPADL 73


>gi|281417187|ref|ZP_06248207.1| Mg chelatase, subunit ChlI [Clostridium thermocellum JW20]
 gi|281408589|gb|EFB38847.1| Mg chelatase, subunit ChlI [Clostridium thermocellum JW20]
          Length = 512

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S+I T+   GI G  V V+  +S G     +VGL D AV ES+ER+++   +AG    
Sbjct: 1  MLSKIKTMGLMGIDGYVVIVETDISNGIPSFDMVGLGDTAVKESKERVRAAIKNAGF--- 57

Query: 61 VNELPSIYLQLIYQKKD 77
            E P   + +     D
Sbjct: 58 --EFPIKRITVNLAPAD 72


>gi|89895316|ref|YP_518803.1| hypothetical protein DSY2570 [Desulfitobacterium hafniense Y51]
 gi|89334764|dbj|BAE84359.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 512

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M + +  +A  GI+   + V+V VS G     IVGL   AV ESRER++S   ++G  F 
Sbjct: 6  MFAAVHGMAVSGIQAHLIRVEVDVSNGLPEFSIVGLAKAAVRESRERVRSAIKNSGFDF- 64

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 65 ----PLQRITVNLAPADL 78


>gi|284006558|emb|CBA71819.1| magnesium-chelatase [Arsenophonus nasoniae]
          Length = 508

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  G+    V V+  +S G  G+ +VGLP+ AV E+R+R++S  I++G     
Sbjct: 3  LAVIYTRASIGMHAPRVTVEAHISNGLPGLTLVGLPETAVREARDRVRSALINSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           + PS  + +     DL
Sbjct: 59 -QYPSKRITINLAPADL 74


>gi|215484950|ref|YP_002327191.1| Competence protein comM [Acinetobacter baumannii AB307-0294]
 gi|332851515|ref|ZP_08433512.1| Mg chelatase-like protein [Acinetobacter baumannii 6013150]
 gi|332866785|ref|ZP_08437189.1| Mg chelatase-like protein [Acinetobacter baumannii 6013113]
 gi|213988191|gb|ACJ58490.1| Competence protein comM [Acinetobacter baumannii AB307-0294]
 gi|332729968|gb|EGJ61299.1| Mg chelatase-like protein [Acinetobacter baumannii 6013150]
 gi|332734393|gb|EGJ65513.1| Mg chelatase-like protein [Acinetobacter baumannii 6013113]
          Length = 495

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           S+I T    G+    +EV+V VS G   + IVGL + AV ES++R++S  I++G  F  
Sbjct: 3  FSKIYTRGLLGLHAPLIEVEVHVSQGLPSLTIVGLAEAAVRESKDRVRSAIINSGFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  L +     DL
Sbjct: 61 ---PTKRLTINLAPADL 74


>gi|326204633|ref|ZP_08194489.1| Mg chelatase, subunit ChlI [Clostridium papyrosolvens DSM 2782]
 gi|325985200|gb|EGD46040.1| Mg chelatase, subunit ChlI [Clostridium papyrosolvens DSM 2782]
          Length = 509

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S++ + A  GI G  V+V+  +S G     +VGL D AV ESRER+++   ++G+ F 
Sbjct: 1  MVSKVKSCALLGIDGCIVDVETDISNGIPNFDVVGLGDMAVRESRERVRAAIKNSGMDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +      L
Sbjct: 60 ----PVRRITINLAPASL 73


>gi|325124192|gb|ADY83715.1| magnesium chelatase family protein [Acinetobacter calcoaceticus
          PHEA-2]
          Length = 495

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           S+I T    G+    +EV+V VS G   + IVGL + AV ES++R++S  I++G  F  
Sbjct: 3  FSKIYTRGLLGLHAPLIEVEVHVSQGLPSLTIVGLAEAAVRESKDRVRSAIINSGFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  L +     DL
Sbjct: 61 ---PTKRLTINLAPADL 74


>gi|260556407|ref|ZP_05828626.1| competence protein comM [Acinetobacter baumannii ATCC 19606]
 gi|260410462|gb|EEX03761.1| competence protein comM [Acinetobacter baumannii ATCC 19606]
          Length = 495

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           S+I T    G+    +EV+V VS G   + IVGL + AV ES++R++S  I++G  F  
Sbjct: 3  FSKIYTRGLLGLHAPLIEVEVHVSQGLPSLTIVGLAEAAVRESKDRVRSAIINSGFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  L +     DL
Sbjct: 61 ---PTKRLTINLAPADL 74


>gi|254291107|ref|ZP_04961904.1| ComM-related protein [Vibrio cholerae AM-19226]
 gi|150422952|gb|EDN14902.1| ComM-related protein [Vibrio cholerae AM-19226]
          Length = 507

 Score =  116 bits (292), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++  PV V+V +S G  G  +VGLP+  V ESR+R++S  I++      
Sbjct: 3  LAIIHSRASIGVQAPPVTVEVHISNGMPGFTLVGLPETTVKESRDRVRSAIINSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKRITVNLAPADL 74


>gi|323705458|ref|ZP_08117033.1| Mg chelatase, subunit ChlI [Thermoanaerobacterium xylanolyticum
          LX-11]
 gi|323535360|gb|EGB25136.1| Mg chelatase, subunit ChlI [Thermoanaerobacterium xylanolyticum
          LX-11]
          Length = 510

 Score =  116 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S   ++A  GI G  V+V++ +S G     IVGL D  + ESR+R+++   ++G    
Sbjct: 1  MLSITKSMAILGIDGYVVDVEIDISNGLPAFDIVGLGDTEIKESRDRVRAAIKNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKD 77
            E P   + +     +
Sbjct: 58 --EFPVKKITVNLAPAN 72


>gi|158334534|ref|YP_001515706.1| Mg chelatase-like protein [Acaryochloris marina MBIC11017]
 gi|158304775|gb|ABW26392.1| Mg chelatase-like protein [Acaryochloris marina MBIC11017]
          Length = 508

 Score =  116 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 46/78 (58%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + +  GI+ I V V+V VS G  G+ IVGLPD AV ESRER+++   ++GL F 
Sbjct: 1  MLARVWSSSLIGIEAIKVGVEVDVSGGLPGIVIVGLPDTAVQESRERVKAALRNSGLAF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PMRRIVINLTPADL 73


>gi|299771893|ref|YP_003733919.1| Competence protein comM [Acinetobacter sp. DR1]
 gi|298701981|gb|ADI92546.1| Competence protein comM [Acinetobacter sp. DR1]
          Length = 494

 Score =  116 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           S+I T    G+    +EV+V VS G   + IVGL + AV ES++R++S  I++G  F  
Sbjct: 3  FSKIYTRGLLGLHAPLIEVEVHVSQGLPSLTIVGLAEAAVRESKDRVRSAIINSGFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  L +     DL
Sbjct: 61 ---PTKRLTINLAPADL 74


>gi|261213242|ref|ZP_05927524.1| ComM-related protein [Vibrio sp. RC341]
 gi|260837516|gb|EEX64219.1| ComM-related protein [Vibrio sp. RC341]
          Length = 508

 Score =  116 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++  PV V+V +S G  G  +VGLP+  V ESR+R++S  I++      
Sbjct: 3  LAIIHSRASIGVQAPPVTVEVHISNGMPGFTLVGLPETTVKESRDRVRSAIINSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKRITVNLAPADL 74


>gi|50083520|ref|YP_045030.1| magnesium chelatase, competence related protein (ComM)
          [Acinetobacter sp. ADP1]
 gi|49529496|emb|CAG67208.1| magnesium chelatase, competence related protein (ComM)
          [Acinetobacter sp. ADP1]
          Length = 495

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           ++I T    G+    +EV+V +S G   + IVGLP+ AV ES++R++S  I++G  F  
Sbjct: 3  FAKIFTRGVLGLHAPQIEVEVHLSQGLPSLTIVGLPEAAVRESKDRVRSAIINSGFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  L +     DL
Sbjct: 61 ---PTKRLTINLAPADL 74


>gi|297180796|gb|ADI17002.1| predicted ATPase with chaperone activity [uncultured Vibrionales
          bacterium HF0010_22E23]
          Length = 510

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V +S G     +VGL +  V E+R+R++S  +++G     
Sbjct: 3  LAIVQSRASIGVNAPQVTVEVHISNGLPAFTLVGLAETTVKEARDRVRSAIVNSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E PS  + +     DL
Sbjct: 59 -EFPSKRITVNLAPADL 74


>gi|262280651|ref|ZP_06058434.1| competence protein comM [Acinetobacter calcoaceticus RUH2202]
 gi|262257551|gb|EEY76286.1| competence protein comM [Acinetobacter calcoaceticus RUH2202]
          Length = 494

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           S+I T    G+    +EV+V VS G   + IVGL + AV ES++R++S  I++G  F  
Sbjct: 3  FSKIYTRGLLGLHAPLIEVEVHVSQGLPSLTIVGLAEAAVRESKDRVRSAIINSGFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  L +     DL
Sbjct: 61 ---PTKRLTINLAPADL 74


>gi|225848785|ref|YP_002728949.1| Mg chelatase family protein [Sulfurihydrogenibium azorense
          Az-Fu1]
 gi|225643178|gb|ACN98228.1| putative Mg chelatase family protein [Sulfurihydrogenibium
          azorense Az-Fu1]
          Length = 506

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 41/81 (50%), Gaps = 5/81 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S + +    GI G  V+V+V ++ G      VGLPD AV ESRER++S   + G  F 
Sbjct: 1  MLSVVKSGGTFGIDGYIVDVEVNITQGLPQFITVGLPDTAVKESRERVKSAIENIGFKF- 59

Query: 61 VNELPSIYLQLIYQKKDLIMI 81
              P   + +     D++ +
Sbjct: 60 ----PVKKITVNLAPADILKV 76


>gi|219669750|ref|YP_002460185.1| Mg chelatase, subunit ChlI [Desulfitobacterium hafniense DCB-2]
 gi|219540010|gb|ACL21749.1| Mg chelatase, subunit ChlI [Desulfitobacterium hafniense DCB-2]
          Length = 507

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M + +  +A  GI+   + V+V VS G     IVGL   AV ESRER++S   ++G  F 
Sbjct: 1  MFAAVHGMAVSGIQAHLIRVEVDVSNGLPEFSIVGLAKAAVRESRERVRSAIKNSGFDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PLQRITVNLAPADL 73


>gi|229520204|ref|ZP_04409631.1| Mg(2+) chelatase family protein/ComM-related protein [Vibrio
          cholerae TM 11079-80]
 gi|229342798|gb|EEO07789.1| Mg(2+) chelatase family protein/ComM-related protein [Vibrio
          cholerae TM 11079-80]
          Length = 507

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++  PV V+V +S G  G  +VGLP+  V ESR+R++S  I++      
Sbjct: 3  LAIIHSRASIGVQAPPVTVEVHISNGMPGFTLVGLPETTVKESRDRVRSAIINSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKRITVNLAPADL 74


>gi|332308552|ref|YP_004436403.1| Mg chelatase, subunit ChlI [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332175881|gb|AEE25135.1| Mg chelatase, subunit ChlI [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 504

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  GI    + V+V ++ G     +VGLP+ +V E+++R++S  I++G     
Sbjct: 3  LAVVLSRASVGIDAPLITVEVHLANGLPCFNLVGLPEASVREAKDRVRSALINSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITVNLAPADL 74


>gi|293610027|ref|ZP_06692328.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827259|gb|EFF85623.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 495

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           S+I T    G+    +EV+V VS G   + IVGL + AV ES++R++S  I++G  F  
Sbjct: 3  FSKIYTRGLLGLHAPLIEVEVHVSQGLPSLTIVGLAEAAVRESKDRVRSAIINSGFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  L +     DL
Sbjct: 61 ---PTKRLTINLAPADL 74


>gi|37528503|ref|NP_931848.1| hypothetical protein plu4686 [Photorhabdus luminescens subsp.
          laumondii TTO1]
 gi|36787941|emb|CAE17058.1| unnamed protein product [Photorhabdus luminescens subsp.
          laumondii TTO1]
          Length = 507

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  GI    V V+  +S G  G+ +VGLP+ AV E+R+R++S  I++G  +  
Sbjct: 3  LAVIYTRATIGIHAPIVTVEAHISNGLPGLTLVGLPETAVKEARDRVRSALINSGFTY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PPKRITVNLAPADL 74


>gi|297581934|ref|ZP_06943854.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297533801|gb|EFH72642.1| conserved hypothetical protein [Vibrio cholerae RC385]
          Length = 507

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++  PV V+V +S G  G  +VGLP+  V ESR+R++S  I++      
Sbjct: 3  LAIIHSRASIGVQAPPVTVEVHISNGMPGFTLVGLPETTVKESRDRVRSAIINSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKRITVNLAPADL 74


>gi|15640064|ref|NP_229691.1| ComM-related protein [Vibrio cholerae O1 biovar El Tor str.
          N16961]
 gi|121587270|ref|ZP_01677043.1| ComM-related protein [Vibrio cholerae 2740-80]
 gi|121727878|ref|ZP_01680937.1| ComM-related protein [Vibrio cholerae V52]
 gi|147673660|ref|YP_001218380.1| ComM-related protein [Vibrio cholerae O395]
 gi|153821920|ref|ZP_01974587.1| ComM-related protein [Vibrio cholerae B33]
 gi|227080269|ref|YP_002808820.1| ComM-related protein [Vibrio cholerae M66-2]
 gi|229508317|ref|ZP_04397821.1| Mg(2+) chelatase family protein/ComM-related protein [Vibrio
          cholerae BX 330286]
 gi|229508844|ref|ZP_04398335.1| Mg(2+) chelatase family protein/ComM-related protein [Vibrio
          cholerae B33]
 gi|229517115|ref|ZP_04406561.1| Mg(2+) chelatase family protein/ComM-related protein [Vibrio
          cholerae RC9]
 gi|229524934|ref|ZP_04414339.1| Mg(2+) chelatase family protein/ComM-related protein [Vibrio
          cholerae bv. albensis VL426]
 gi|229530182|ref|ZP_04419571.1| mg(2+) chelatase family protein/ComM-related protein [Vibrio
          cholerae 12129(1)]
 gi|229606591|ref|YP_002877239.1| Mg(2+) chelatase family protein/ComM-related protein [Vibrio
          cholerae MJ-1236]
 gi|254851596|ref|ZP_05240946.1| ComM-related protein [Vibrio cholerae MO10]
 gi|255746786|ref|ZP_05420732.1| Mg(2+) chelatase family protein/ComM-related protein [Vibrio
          cholera CIRS 101]
 gi|262155867|ref|ZP_06028989.1| Mg(2+) chelatase family protein/ComM-related protein [Vibrio
          cholerae INDRE 91/1]
 gi|262166909|ref|ZP_06034630.1| Mg(2+) chelatase family protein/ComM-related protein [Vibrio
          cholerae RC27]
 gi|298501216|ref|ZP_07011015.1| Mg chelatase [Vibrio cholerae MAK 757]
 gi|9654425|gb|AAF93210.1| ComM-related protein [Vibrio cholerae O1 biovar El Tor str.
          N16961]
 gi|121548516|gb|EAX58572.1| ComM-related protein [Vibrio cholerae 2740-80]
 gi|121629822|gb|EAX62237.1| ComM-related protein [Vibrio cholerae V52]
 gi|126520540|gb|EAZ77763.1| ComM-related protein [Vibrio cholerae B33]
 gi|146315543|gb|ABQ20082.1| ComM-related protein [Vibrio cholerae O395]
 gi|227008157|gb|ACP04369.1| ComM-related protein [Vibrio cholerae M66-2]
 gi|227011965|gb|ACP08175.1| ComM-related protein [Vibrio cholerae O395]
 gi|229332315|gb|EEN97802.1| mg(2+) chelatase family protein/ComM-related protein [Vibrio
          cholerae 12129(1)]
 gi|229338515|gb|EEO03532.1| Mg(2+) chelatase family protein/ComM-related protein [Vibrio
          cholerae bv. albensis VL426]
 gi|229346178|gb|EEO11150.1| Mg(2+) chelatase family protein/ComM-related protein [Vibrio
          cholerae RC9]
 gi|229354119|gb|EEO19051.1| Mg(2+) chelatase family protein/ComM-related protein [Vibrio
          cholerae B33]
 gi|229354590|gb|EEO19512.1| Mg(2+) chelatase family protein/ComM-related protein [Vibrio
          cholerae BX 330286]
 gi|229369246|gb|ACQ59669.1| Mg(2+) chelatase family protein/ComM-related protein [Vibrio
          cholerae MJ-1236]
 gi|254847301|gb|EET25715.1| ComM-related protein [Vibrio cholerae MO10]
 gi|255735543|gb|EET90942.1| Mg(2+) chelatase family protein/ComM-related protein [Vibrio
          cholera CIRS 101]
 gi|262024680|gb|EEY43360.1| Mg(2+) chelatase family protein/ComM-related protein [Vibrio
          cholerae RC27]
 gi|262030319|gb|EEY48961.1| Mg(2+) chelatase family protein/ComM-related protein [Vibrio
          cholerae INDRE 91/1]
 gi|297540088|gb|EFH76150.1| Mg chelatase [Vibrio cholerae MAK 757]
          Length = 507

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++  PV V+V +S G  G  +VGLP+  V ESR+R++S  I++      
Sbjct: 3  LAIIHSRASIGVQAPPVTVEVHISNGMPGFTLVGLPETTVKESRDRVRSAIINSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKRITVNLAPADL 74


>gi|256544687|ref|ZP_05472059.1| competence protein ComM [Anaerococcus vaginalis ATCC 51170]
 gi|256399576|gb|EEU13181.1| competence protein ComM [Anaerococcus vaginalis ATCC 51170]
          Length = 509

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S+ +T++  G+ G  +EV+  ++ G     IVGLPD ++ ES++RI+   I++G  F 
Sbjct: 1  MYSKTNTVSLLGLDGKAIEVESDITSGMPAFNIVGLPDSSIKESKDRIRVALINSGFKF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 60 ----PQGRITINLSPADI 73


>gi|217967911|ref|YP_002353417.1| Mg chelatase, subunit ChlI [Dictyoglomus turgidum DSM 6724]
 gi|217337010|gb|ACK42803.1| Mg chelatase, subunit ChlI [Dictyoglomus turgidum DSM 6724]
          Length = 506

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S+I +    G+    VE+++ +S G     IVGL ++ + ES+ER++S   ++G    
Sbjct: 1  MLSKIRSATLLGLNCHEVEIEIDISSGVPSFNIVGLAEQEIQESKERVRSALKNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     DL
Sbjct: 58 --EFPLKRITINLAPADL 73


>gi|153212967|ref|ZP_01948561.1| ComM-related protein [Vibrio cholerae 1587]
 gi|124116193|gb|EAY35013.1| ComM-related protein [Vibrio cholerae 1587]
          Length = 507

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++  PV V+V +S G  G  +VGLP+  V ESR+R++S  I++      
Sbjct: 3  LAIIHSRASIGVQAPPVTVEVHISNGMPGFTLVGLPETTVKESRDRVRSAIINSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKRITVNLAPADL 74


>gi|229515929|ref|ZP_04405386.1| Mg(2+) chelatase family protein/ComM-related protein [Vibrio
          cholerae TMA 21]
 gi|229347029|gb|EEO11991.1| Mg(2+) chelatase family protein/ComM-related protein [Vibrio
          cholerae TMA 21]
          Length = 507

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++  PV V+V +S G  G  +VGLP+  V ESR+R++S  I++      
Sbjct: 3  LAIIHSRASIGVQAPPVTVEVHISNGMPGFTLVGLPETTVKESRDRVRSAIINSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKRITVNLAPADL 74


>gi|153826404|ref|ZP_01979071.1| ComM-related protein [Vibrio cholerae MZO-2]
 gi|149739790|gb|EDM53985.1| ComM-related protein [Vibrio cholerae MZO-2]
          Length = 507

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++  PV V+V +S G  G  +VGLP+  V ESR+R++S  I++      
Sbjct: 3  LAIIHSRASIGVQAPPVTVEVHISNGMPGFTLVGLPETTVKESRDRVRSAIINSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKRITVNLAPADL 74


>gi|254225558|ref|ZP_04919167.1| ComM-related protein [Vibrio cholerae V51]
 gi|125621878|gb|EAZ50203.1| ComM-related protein [Vibrio cholerae V51]
          Length = 507

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++  PV V+V +S G  G  +VGLP+  V ESR+R++S  I++      
Sbjct: 3  LAIIHSRASIGVQAPPVTVEVHISNGMPGFTLVGLPETTVKESRDRVRSAIINSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKRITVNLAPADL 74


>gi|239502083|ref|ZP_04661393.1| Mg chelatase-related protein [Acinetobacter baumannii AB900]
          Length = 308

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           S+I T    G+    +EV+V VS G   + IVGL + AV ES++R++S  I++G  F  
Sbjct: 3  FSKIYTRGLLGLHAPLIEVEVHVSQGLPSLTIVGLAEAAVRESKDRVRSAIINSGFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  L +     DL
Sbjct: 61 ---PTKRLTINLAPADL 74


>gi|88807217|ref|ZP_01122729.1| Mg chelatase-related protein [Synechococcus sp. WH 7805]
 gi|88788431|gb|EAR19586.1| Mg chelatase-related protein [Synechococcus sp. WH 7805]
          Length = 525

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R  + +  GI   PV V+V ++PG  G+Q+VGLPD A+ ESRER++S   ++G    
Sbjct: 1  MLARCLSASLLGIDARPVTVEVDLAPGLPGLQLVGLPDTAIQESRERVRSALRNSGFRG- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P + + +     DL
Sbjct: 60 ----PLVKVVVNLAPADL 73


>gi|262172799|ref|ZP_06040477.1| ComM-related protein [Vibrio mimicus MB-451]
 gi|261893875|gb|EEY39861.1| ComM-related protein [Vibrio mimicus MB-451]
          Length = 507

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++  PV V+V +S G  G  +VGLP+  V ESR+R++S  I++      
Sbjct: 3  LAIIHSRASIGVQAPPVTVEVHISNGMPGFTLVGLPETTVKESRDRVRSAIINSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKRITVNLAPADL 74


>gi|262402061|ref|ZP_06078625.1| ComM-related protein [Vibrio sp. RC586]
 gi|262351707|gb|EEZ00839.1| ComM-related protein [Vibrio sp. RC586]
          Length = 507

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++  PV V+V +S G  G  +VGLP+  V ESR+R++S  I++      
Sbjct: 3  LAIIHSRASIGVQAPPVTVEVHISNGMPGFTLVGLPETTVKESRDRVRSAIINSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKRITVNLAPADL 74


>gi|303240295|ref|ZP_07326814.1| Mg chelatase, subunit ChlI [Acetivibrio cellulolyticus CD2]
 gi|302592205|gb|EFL61934.1| Mg chelatase, subunit ChlI [Acetivibrio cellulolyticus CD2]
          Length = 508

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S++ +    GI G  V V+  +S G     +VGL D AV ES+ER+++   +AGL   
Sbjct: 1  MLSKVKSFGLMGIDGYVVIVETDISNGIPSFDMVGLGDTAVKESKERVRAAIKNAGL--- 57

Query: 61 VNELPSIYLQLIYQKKD 77
            E P   + +     D
Sbjct: 58 --EFPIRRITVNLAPAD 72


>gi|220929475|ref|YP_002506384.1| Mg chelatase, subunit ChlI [Clostridium cellulolyticum H10]
 gi|219999803|gb|ACL76404.1| Mg chelatase, subunit ChlI [Clostridium cellulolyticum H10]
          Length = 509

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S++ + A  GI G  V+V+  +S G     +VGL D AV ESRER+++   + G+ F 
Sbjct: 1  MVSKVKSCALLGIDGCIVDVETDISNGIPNFDVVGLGDMAVRESRERVRAAIKNTGIDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     +L
Sbjct: 60 ----PVRRITINLAPANL 73


>gi|187932749|ref|YP_001885452.1| Mg chelatase homolog [Clostridium botulinum B str. Eklund 17B]
 gi|187720902|gb|ACD22123.1| Mg chelatase family protein [Clostridium botulinum B str. Eklund
          17B]
          Length = 506

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  +I +    G++G+ +EV+V +S G     IVGL D +V ES+ER++S  +++G  F 
Sbjct: 1  MSIKIISATQNGLEGLLIEVEVDISKGLPSFSIVGLADTSVKESKERVRSAILNSGYDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 60 ----PLGRITINLAPADM 73


>gi|153802493|ref|ZP_01957079.1| ComM-related protein [Vibrio cholerae MZO-3]
 gi|124121963|gb|EAY40706.1| ComM-related protein [Vibrio cholerae MZO-3]
          Length = 237

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++  PV V+V +S G  G  +VGLP+  V ESR+R++S  I++      
Sbjct: 3  LAIIHSRASIGVQAPPVTVEVHISNGMPGFTLVGLPETTVKESRDRVRSAIINSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKRITVNLAPADL 74


>gi|330721701|gb|EGG99703.1| MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein [gamma
          proteobacterium IMCC2047]
          Length = 499

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  GI    V V+  +S G   + IVGLP+ AV ESR+R++S  I++      
Sbjct: 3  LAIIYSRAKVGIDAPLVTVEAHLSNGLPSLSIVGLPEAAVKESRDRVRSAIINSQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITINLAPADL 74


>gi|258626101|ref|ZP_05720952.1| ComM-related protein [Vibrio mimicus VM603]
 gi|258581627|gb|EEW06525.1| ComM-related protein [Vibrio mimicus VM603]
          Length = 507

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++  PV V+V +S G  G  +VGLP+  V ESR+R++S  I++      
Sbjct: 3  LAIIHSRASIGVQAPPVTVEVHISNGMPGFTLVGLPETTVKESRDRVRSAIINSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKRITVNLAPADL 74


>gi|218711013|ref|YP_002418634.1| competence protein ComM [Vibrio splendidus LGP32]
 gi|218324032|emb|CAV20394.1| Competence protein comM [Vibrio splendidus LGP32]
          Length = 507

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V V+V +S G  G  +VGLP+  V ES++R++S  I++      
Sbjct: 3  LAIIHSRASVGVEAPEVTVEVHISNGMPGFTLVGLPETTVKESKDRVRSAIINSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E PS  + +     DL
Sbjct: 59 -EFPSKRITVNLAPADL 74


>gi|206900267|ref|YP_002251238.1| putative Mg chelatase [Dictyoglomus thermophilum H-6-12]
 gi|206739370|gb|ACI18428.1| putative Mg chelatase [Dictyoglomus thermophilum H-6-12]
          Length = 506

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S+I +    G+    VE+++ +S G     IVGL ++ + ES+ER++S   ++G  F 
Sbjct: 1  MLSKIKSATLWGLNCYEVEIEIDISSGVPSFNIVGLAEQEIQESKERVRSALKNSGYDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PLKRITINLAPADL 73


>gi|84393426|ref|ZP_00992183.1| ComM-related protein [Vibrio splendidus 12B01]
 gi|84375942|gb|EAP92832.1| ComM-related protein [Vibrio splendidus 12B01]
          Length = 507

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V V+V +S G  G  +VGLP+  V ES++R++S  I++      
Sbjct: 3  LAIIHSRASVGVEAPEVTVEVHISNGMPGFTLVGLPETTVKESKDRVRSAIINSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E PS  + +     DL
Sbjct: 59 -EFPSKRITVNLAPADL 74


>gi|86147144|ref|ZP_01065460.1| ComM-related protein [Vibrio sp. MED222]
 gi|85835028|gb|EAQ53170.1| ComM-related protein [Vibrio sp. MED222]
          Length = 507

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V V+V +S G  G  +VGLP+  V ES++R++S  I++      
Sbjct: 3  LAIIHSRASVGVEAPEVTVEVHISNGMPGFTLVGLPETTVKESKDRVRSAIINSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E PS  + +     DL
Sbjct: 59 -EFPSKRITVNLAPADL 74


>gi|167553332|ref|ZP_02347082.1| Mg chelatase homolog [Salmonella enterica subsp. enterica serovar
          Saintpaul str. SARA29]
 gi|205322211|gb|EDZ10050.1| Mg chelatase homolog [Salmonella enterica subsp. enterica serovar
          Saintpaul str. SARA29]
          Length = 506

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  G+   P+ ++V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LAIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITINLAPADL 74


>gi|168244950|ref|ZP_02669882.1| Mg chelatase homolog [Salmonella enterica subsp. enterica serovar
          Heidelberg str. SL486]
 gi|168263209|ref|ZP_02685182.1| Mg chelatase homolog [Salmonella enterica subsp. enterica serovar
          Hadar str. RI_05P066]
 gi|194448893|ref|YP_002047922.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Heidelberg str. SL476]
 gi|194407197|gb|ACF67416.1| putative Mg chelatase homolog [Salmonella enterica subsp.
          enterica serovar Heidelberg str. SL476]
 gi|205336235|gb|EDZ22999.1| Mg chelatase homolog [Salmonella enterica subsp. enterica serovar
          Heidelberg str. SL486]
 gi|205348186|gb|EDZ34817.1| Mg chelatase homolog [Salmonella enterica subsp. enterica serovar
          Hadar str. RI_05P066]
          Length = 506

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  G+   P+ ++V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LAIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITINLAPADL 74


>gi|258622977|ref|ZP_05717992.1| ComM-related protein [Vibrio mimicus VM573]
 gi|258584760|gb|EEW09494.1| ComM-related protein [Vibrio mimicus VM573]
          Length = 507

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++  PV V+V +S G  G  +VGLP+  V ESR+R++S  I++      
Sbjct: 3  LAIIHSRASIGVQAPPVTVEVHISNGMPGFTLVGLPETTVKESRDRVRSAIINSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKRITVNLAPADL 74


>gi|254507274|ref|ZP_05119410.1| putative Mg chelatase [Vibrio parahaemolyticus 16]
 gi|219549734|gb|EED26723.1| putative Mg chelatase [Vibrio parahaemolyticus 16]
          Length = 507

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V V+V +S G  G  +VGLP+  V ESR+R++S  I++      
Sbjct: 3  LAIIHSRASVGVEAPSVTVEVHISNGMPGFTLVGLPETTVKESRDRVRSAIINSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKRITVNLAPADL 74


>gi|157144396|ref|YP_001451715.1| hypothetical protein CKO_00105 [Citrobacter koseri ATCC BAA-895]
 gi|157081601|gb|ABV11279.1| hypothetical protein CKO_00105 [Citrobacter koseri ATCC BAA-895]
          Length = 506

 Score =  115 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ ++V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITINLAPADL 74


>gi|73748753|ref|YP_307992.1| Mg chelatase,-like protein [Dehalococcoides sp. CBDB1]
 gi|289432779|ref|YP_003462652.1| Mg chelatase, subunit ChlI [Dehalococcoides sp. GT]
 gi|73660469|emb|CAI83076.1| Mg chelatase, homolog [Dehalococcoides sp. CBDB1]
 gi|288946499|gb|ADC74196.1| Mg chelatase, subunit ChlI [Dehalococcoides sp. GT]
          Length = 506

 Score =  115 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++S+ A  G++G  VEV+  +S G     IVGLPD A+ E+RER++    ++G  F 
Sbjct: 1  MLAKVSSCALIGLEGTIVEVEADISAGLPSFTIVGLPDTAIQEARERVRVAIRNSGFTF- 59

Query: 61 VNELPSIYLQLIYQKKD 77
              P   +       D
Sbjct: 60 ----PVKRIVANLAPAD 72


>gi|322612980|gb|EFY09931.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. 315996572]
 gi|322617432|gb|EFY14332.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. 495297-1]
 gi|322625576|gb|EFY22398.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. 495297-3]
 gi|322626999|gb|EFY23792.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. 495297-4]
 gi|322631285|gb|EFY28048.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. 515920-1]
 gi|322638318|gb|EFY35017.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. 515920-2]
 gi|322642832|gb|EFY39418.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. 531954]
 gi|322647012|gb|EFY43514.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322650400|gb|EFY46813.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. OH_2009072675]
 gi|322656310|gb|EFY52604.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322657535|gb|EFY53805.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. 19N]
 gi|322665946|gb|EFY62127.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. 81038-01]
 gi|322666686|gb|EFY62863.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. MD_MDA09249507]
 gi|322671072|gb|EFY67202.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. 414877]
 gi|322679221|gb|EFY75273.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. 366867]
 gi|322681625|gb|EFY77652.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. 413180]
 gi|322686048|gb|EFY82036.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. 446600]
 gi|323195800|gb|EFZ80974.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. 609458-1]
 gi|323197819|gb|EFZ82950.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. 556150-1]
 gi|323203708|gb|EFZ88729.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. 609460]
 gi|323205416|gb|EFZ90390.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. 507440-20]
 gi|323210787|gb|EFZ95663.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. 556152]
 gi|323215954|gb|EGA00687.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB101509-0077]
 gi|323221447|gb|EGA05865.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB102109-0047]
 gi|323227347|gb|EGA11514.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB110209-0055]
 gi|323231721|gb|EGA15832.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB111609-0052]
 gi|323236135|gb|EGA20212.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. 2009083312]
 gi|323239628|gb|EGA23676.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. 2009085258]
 gi|323244276|gb|EGA28284.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. 315731156]
 gi|323249626|gb|EGA33538.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2009159199]
 gi|323250281|gb|EGA34167.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008282]
 gi|323256488|gb|EGA40219.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008283]
 gi|323259814|gb|EGA43447.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008284]
 gi|323265222|gb|EGA48720.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008285]
 gi|323268349|gb|EGA51821.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008287]
          Length = 506

 Score =  115 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  G+   P+ ++V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LAIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITINLAPADL 74


>gi|161617016|ref|YP_001590981.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Paratyphi B str. SPB7]
 gi|200387599|ref|ZP_03214211.1| Mg chelatase homolog [Salmonella enterica subsp. enterica serovar
          Virchow str. SL491]
 gi|161366380|gb|ABX70148.1| hypothetical protein SPAB_04844 [Salmonella enterica subsp.
          enterica serovar Paratyphi B str. SPB7]
 gi|199604697|gb|EDZ03242.1| Mg chelatase homolog [Salmonella enterica subsp. enterica serovar
          Virchow str. SL491]
          Length = 506

 Score =  115 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  G+   P+ ++V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LAIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITINLAPADL 74


>gi|225077199|ref|ZP_03720398.1| hypothetical protein NEIFLAOT_02254 [Neisseria flavescens
          NRL30031/H210]
 gi|224951451|gb|EEG32660.1| hypothetical protein NEIFLAOT_02254 [Neisseria flavescens
          NRL30031/H210]
          Length = 498

 Score =  115 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G  F  
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKKITVNLAPADL 74


>gi|33864863|ref|NP_896422.1| Mg(2+) chelatase family protein [Synechococcus sp. WH 8102]
 gi|33632386|emb|CAE06842.1| Mg(2+) chelatase family protein [Synechococcus sp. WH 8102]
          Length = 514

 Score =  115 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 48/78 (61%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R  + + QG++  PV V+V ++PG  G+Q+VGLPDKA+ ESRER++S   ++G    
Sbjct: 1  MLARCLSASLQGLQAHPVTVEVDLAPGLPGIQLVGLPDKAIQESRERVRSALRNSGFRG- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P + + +     DL
Sbjct: 60 ----PLVRVVINLAPADL 73


>gi|323132252|gb|ADX19682.1| putative ATP-dependent protease [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
          Length = 538

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2   ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           ++ + T A  G+   P+ ++V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 35  LAIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 90

Query: 62  NELPSIYLQLIYQKKDL 78
            E P+  + +     DL
Sbjct: 91  -EFPAKKITINLAPADL 106


>gi|301160422|emb|CBW19949.1| Putative competence protein (chelatase) [Salmonella enterica
          subsp. enterica serovar Typhimurium str. SL1344]
          Length = 506

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  G+   P+ ++V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LAIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITINLAPADL 74


>gi|153817610|ref|ZP_01970277.1| ComM-related protein [Vibrio cholerae NCTC 8457]
 gi|126511878|gb|EAZ74472.1| ComM-related protein [Vibrio cholerae NCTC 8457]
          Length = 313

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++  PV V+V +S G  G  +VGLP+  V ESR+R++S  I++      
Sbjct: 3  LAIIHSRASIGVQAPPVTVEVHISNGMPGFTLVGLPETTVKESRDRVRSAIINSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKRITVNLAPADL 74


>gi|184156561|ref|YP_001844900.1| ATPase [Acinetobacter baumannii ACICU]
 gi|332874955|ref|ZP_08442806.1| putative Mg chelatase-like protein [Acinetobacter baumannii
          6014059]
 gi|183208155|gb|ACC55553.1| predicted ATPase with chaperone activity [Acinetobacter baumannii
          ACICU]
 gi|322506448|gb|ADX01902.1| ATPase [Acinetobacter baumannii 1656-2]
 gi|323516327|gb|ADX90708.1| ATPase with chaperone activity [Acinetobacter baumannii
          TCDC-AB0715]
 gi|332736898|gb|EGJ67874.1| putative Mg chelatase-like protein [Acinetobacter baumannii
          6014059]
          Length = 285

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           S+I T    G+    +EV+V VS G   + IVGL + AV ES++R++S  I++G  F  
Sbjct: 3  FSKIYTRGLLGLHAPLIEVEVHVSQGLPSLTIVGLAEAAVRESKDRVRSAIINSGFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  L +     DL
Sbjct: 61 ---PTKRLTINLAPADL 74


>gi|241759379|ref|ZP_04757484.1| Mg chelatase family protein [Neisseria flavescens SK114]
 gi|241320324|gb|EER56643.1| Mg chelatase family protein [Neisseria flavescens SK114]
          Length = 498

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G  F  
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKKITVNLAPADL 74


>gi|147669519|ref|YP_001214337.1| Mg chelatase, subunit ChlI [Dehalococcoides sp. BAV1]
 gi|146270467|gb|ABQ17459.1| Mg chelatase, subunit ChlI [Dehalococcoides sp. BAV1]
          Length = 506

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++S+ A  G++G  VEV+  +S G     IVGLPD A+ E+RER++    ++G  F 
Sbjct: 1  MLAKVSSCALIGLEGTIVEVEADISAGLPSFTIVGLPDTAIQEARERVRVAIRNSGFTF- 59

Query: 61 VNELPSIYLQLIYQKKD 77
              P   +       D
Sbjct: 60 ----PVKRIVANLAPAD 72


>gi|194445964|ref|YP_002043139.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Newport str. SL254]
 gi|194404627|gb|ACF64849.1| putative Mg chelatase homolog [Salmonella enterica subsp.
          enterica serovar Newport str. SL254]
          Length = 506

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  G+   P+ ++V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LAIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITINLAPADL 74


>gi|319637616|ref|ZP_07992382.1| competence protein ComM [Neisseria mucosa C102]
 gi|317400771|gb|EFV81426.1| competence protein ComM [Neisseria mucosa C102]
          Length = 498

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G  F  
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKKITVNLAPADL 74


>gi|197250076|ref|YP_002148828.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Agona str. SL483]
 gi|197213779|gb|ACH51176.1| Mg chelatase homolog [Salmonella enterica subsp. enterica serovar
          Agona str. SL483]
          Length = 506

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  G+   P+ ++V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LAIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITINLAPADL 74


>gi|16767175|ref|NP_462790.1| ATP-dependent protease [Salmonella enterica subsp. enterica
          serovar Typhimurium str. LT2]
 gi|167994594|ref|ZP_02575685.1| Mg chelatase homolog [Salmonella enterica subsp. enterica serovar
          4,[5],12:i:- str. CVM23701]
 gi|168238353|ref|ZP_02663411.1| Mg chelatase homolog [Salmonella enterica subsp. enterica serovar
          Schwarzengrund str. SL480]
 gi|168822954|ref|ZP_02834954.1| Mg chelatase homolog [Salmonella enterica subsp. enterica serovar
          Weltevreden str. HI_N05-537]
 gi|194734470|ref|YP_002116834.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Schwarzengrund str. CVM19633]
 gi|197262388|ref|ZP_03162462.1| Mg chelatase homolog [Salmonella enterica subsp. enterica serovar
          Saintpaul str. SARA23]
 gi|204930234|ref|ZP_03221211.1| Mg chelatase homolog [Salmonella enterica subsp. enterica serovar
          Javiana str. GA_MM04042433]
 gi|9911015|sp|P57015|YIFB_SALTY RecName: Full=Uncharacterized protein YifB
 gi|6960294|gb|AAF33484.1| 85% identity to E. coli hypothetical protein (YIFB) (SP:P22787);
          contains similarity to Pfam family PF01078 (Magnesium
          chelatase, subunit ChlI), score=351.8, E=7.6e-102, N=1
          [Salmonella enterica subsp. enterica serovar
          Typhimurium str. LT2]
 gi|16422467|gb|AAL22749.1| putative magnesium chelatase, subunit ChlI [Salmonella enterica
          subsp. enterica serovar Typhimurium str. LT2]
 gi|194709972|gb|ACF89193.1| Mg chelatase homolog [Salmonella enterica subsp. enterica serovar
          Schwarzengrund str. CVM19633]
 gi|197240643|gb|EDY23263.1| Mg chelatase homolog [Salmonella enterica subsp. enterica serovar
          Saintpaul str. SARA23]
 gi|197288745|gb|EDY28120.1| Mg chelatase homolog [Salmonella enterica subsp. enterica serovar
          Schwarzengrund str. SL480]
 gi|204320638|gb|EDZ05840.1| Mg chelatase homolog [Salmonella enterica subsp. enterica serovar
          Javiana str. GA_MM04042433]
 gi|205327556|gb|EDZ14320.1| Mg chelatase homolog [Salmonella enterica subsp. enterica serovar
          4,[5],12:i:- str. CVM23701]
 gi|205340703|gb|EDZ27467.1| Mg chelatase homolog [Salmonella enterica subsp. enterica serovar
          Weltevreden str. HI_N05-537]
 gi|261249030|emb|CBG26888.1| Putative competence protein (chelatase) [Salmonella enterica
          subsp. enterica serovar Typhimurium str. D23580]
 gi|267996179|gb|ACY91064.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Typhimurium str. 14028S]
 gi|312915022|dbj|BAJ38996.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Typhimurium str. T000240]
 gi|320088317|emb|CBY98077.1| Uncharacterized protein yifB [Salmonella enterica subsp. enterica
          serovar Weltevreden str. 2007-60-3289-1]
 gi|321225427|gb|EFX50484.1| MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein
          [Salmonella enterica subsp. enterica serovar
          Typhimurium str. TN061786]
 gi|332990740|gb|AEF09723.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Typhimurium str. UK-1]
          Length = 506

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  G+   P+ ++V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LAIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITINLAPADL 74


>gi|300900690|ref|ZP_07118842.1| Mg chelatase-like protein [Escherichia coli MS 198-1]
 gi|300355819|gb|EFJ71689.1| Mg chelatase-like protein [Escherichia coli MS 198-1]
          Length = 516

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 13 LSIVHTRAALGVDAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 68

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 69 -EYPAKKITINLAPADL 84


>gi|326625626|gb|EGE31971.1| putative ATP-dependent protease [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
          Length = 538

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2   ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           ++ + T A  G+   P+ ++V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 35  LAIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 90

Query: 62  NELPSIYLQLIYQKKDL 78
            E P+  + +     DL
Sbjct: 91  -EFPAKKITINLAPADL 106


>gi|326629663|gb|EGE36006.1| putative ATP-dependent protease [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 538

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2   ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           ++ + T A  G+   P+ ++V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 35  LAIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 90

Query: 62  NELPSIYLQLIYQKKDL 78
            E P+  + +     DL
Sbjct: 91  -EFPAKKITINLAPADL 106


>gi|168467684|ref|ZP_02701521.1| Mg chelatase homolog [Salmonella enterica subsp. enterica serovar
          Newport str. SL317]
 gi|207859113|ref|YP_002245764.1| ATP-dependent protease [Salmonella enterica subsp. enterica
          serovar Enteritidis str. P125109]
 gi|195630013|gb|EDX48673.1| Mg chelatase homolog [Salmonella enterica subsp. enterica serovar
          Newport str. SL317]
 gi|206710916|emb|CAR35281.1| Putative competence protein (chelatase) [Salmonella enterica
          subsp. enterica serovar Enteritidis str. P125109]
          Length = 506

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  G+   P+ ++V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LAIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITINLAPADL 74


>gi|56415758|ref|YP_152833.1| magnesium chelatase, subunit ChlI [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. ATCC 9150]
 gi|197364688|ref|YP_002144325.1| magnesium chelatase, subunit ChlI [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. AKU_12601]
 gi|56130015|gb|AAV79521.1| putative magnesium chelatase, subunit ChlI [Salmonella enterica
          subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|197096165|emb|CAR61761.1| putative magnesium chelatase, subunit ChlI [Salmonella enterica
          subsp. enterica serovar Paratyphi A str. AKU_12601]
          Length = 478

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  G+   P+ ++V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LAIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITINLAPADL 74


>gi|205354528|ref|YP_002228329.1| ATP-dependent protease [Salmonella enterica subsp. enterica
          serovar Gallinarum str. 287/91]
 gi|205274309|emb|CAR39331.1| Putative competence protein (chelatase) [Salmonella enterica
          subsp. enterica serovar Gallinarum str. 287/91]
          Length = 506

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  G+   P+ ++V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LAIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITINLAPADL 74


>gi|62182376|ref|YP_218793.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Choleraesuis str. SC-B67]
 gi|224585720|ref|YP_002639519.1| ATP-dependent protease [Salmonella enterica subsp. enterica
          serovar Paratyphi C strain RKS4594]
 gi|62130009|gb|AAX67712.1| putative magnesium chelatase, subunit ChlI [Salmonella enterica
          subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|224470248|gb|ACN48078.1| putative magnesium chelatase, subunit ChlI [Salmonella enterica
          subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|322716868|gb|EFZ08439.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Choleraesuis str. A50]
          Length = 506

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  G+   P+ ++V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LAIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITINLAPADL 74


>gi|168234219|ref|ZP_02659277.1| Mg chelatase homolog [Salmonella enterica subsp. enterica serovar
          Kentucky str. CDC 191]
 gi|194471414|ref|ZP_03077398.1| putative Mg chelatase homolog [Salmonella enterica subsp.
          enterica serovar Kentucky str. CVM29188]
 gi|194457778|gb|EDX46617.1| putative Mg chelatase homolog [Salmonella enterica subsp.
          enterica serovar Kentucky str. CVM29188]
 gi|205331804|gb|EDZ18568.1| Mg chelatase homolog [Salmonella enterica subsp. enterica serovar
          Kentucky str. CDC 191]
          Length = 506

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  G+   P+ ++V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LAIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITINLAPADL 74


>gi|198242242|ref|YP_002217839.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Dublin str. CT_02021853]
 gi|197936758|gb|ACH74091.1| Mg chelatase homolog [Salmonella enterica subsp. enterica serovar
          Dublin str. CT_02021853]
          Length = 506

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  G+   P+ ++V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LAIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITINLAPADL 74


>gi|213155671|ref|YP_002317716.1| Mg chelatase-related protein [Acinetobacter baumannii AB0057]
 gi|301346219|ref|ZP_07226960.1| Mg chelatase-related protein [Acinetobacter baumannii AB056]
 gi|90265417|emb|CAJ77099.1| 3' partial ATPase (5' is 1_837) [Acinetobacter baumannii]
 gi|213054831|gb|ACJ39733.1| Mg chelatase-related protein [Acinetobacter baumannii AB0057]
          Length = 285

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           S+I T    G+    +EV+V VS G   + IVGL + AV ES++R++S  I++G  F  
Sbjct: 3  FSKIYTRGLLGLHAPLIEVEVHVSQGLPSLTIVGLAEAAVRESKDRVRSAIINSGFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  L +     DL
Sbjct: 61 ---PTKRLTINLAPADL 74


>gi|27262516|gb|AAN87539.1| unknown [Heliobacillus mobilis]
          Length = 360

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++RI ++  +G+    +EV+V VS G     +VGLP  AV E+RER++S   ++G  F 
Sbjct: 1  MLARIHSVVLEGLTAKTIEVEVDVSNGLPAFDMVGLPATAVREARERVRSAIRNSGYDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 60 ----PLRRITVNLAPADV 73


>gi|16331658|ref|NP_442386.1| hypothetical protein slr0904 [Synechocystis sp. PCC 6803]
 gi|1001214|dbj|BAA10456.1| slr0904 [Synechocystis sp. PCC 6803]
          Length = 509

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + +  GI  I V V+V VS G   + +VGLPD AV ESRER+++   +AG  F 
Sbjct: 1  MLARVWSASLLGIDAIKVGVEVDVSAGLPAIAVVGLPDTAVQESRERVKAALKNAGFAF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PVRRIVINLTPADL 73


>gi|320197581|gb|EFW72193.1| MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein
          [Escherichia coli WV_060327]
          Length = 506

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|269926022|ref|YP_003322645.1| Mg chelatase, subunit ChlI [Thermobaculum terrenum ATCC BAA-798]
 gi|269789682|gb|ACZ41823.1| Mg chelatase, subunit ChlI [Thermobaculum terrenum ATCC BAA-798]
          Length = 506

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ +++ A  G+ G  V+++V + PG     IVGLPD AV E++ER+++   ++G  F 
Sbjct: 1  MLASVASCAVIGLNGALVDIEVDIGPGLPTFTIVGLPDTAVQEAKERVRTAIKNSGCAF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     DL
Sbjct: 60 ----PNRKITVNMAPADL 73


>gi|24371947|ref|NP_715989.1| magnesium chelatase family protein [Shewanella oneidensis MR-1]
 gi|24345788|gb|AAN53434.1|AE015482_8 magnesium chelatase family protein [Shewanella oneidensis MR-1]
          Length = 508

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I+ + T A  G++   V V+V +S G     +VGLP+ +V E+RER++S  I+AG     
Sbjct: 3  IACVHTRASCGVEAPEVTVEVHLSNGLPAFNLVGLPEASVKEARERVRSALINAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPMRRITVNLAPADL 74


>gi|118578722|ref|YP_899972.1| magnesium chelatase, ChlI subunit [Pelobacter propionicus DSM
          2379]
 gi|118501432|gb|ABK97914.1| magnesium chelatase, ChlI subunit [Pelobacter propionicus DSM
          2379]
          Length = 309

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ +    GI  I V+V+V ++PG      VGLPD AV ES++R+++   ++G  F 
Sbjct: 1  MLAKVLSSTLIGIDAIIVDVEVDLAPGLPAFATVGLPDGAVRESKDRVRAALKNSGYDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  +       D+
Sbjct: 60 ----PTRRITANLAPADI 73


>gi|206890761|ref|YP_002247931.1| putative Mg chelatase [Thermodesulfovibrio yellowstonii DSM
          11347]
 gi|206742699|gb|ACI21756.1| putative Mg chelatase [Thermodesulfovibrio yellowstonii DSM
          11347]
          Length = 508

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 42/79 (53%), Gaps = 6/79 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVS-PGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M++++ +    GI+   V+V+V ++  G     IVGLPD AV ESR+RI++ F + G  F
Sbjct: 1  MLAKVQSAHLIGIEPYAVDVEVDIAQRGLPHFNIVGLPDTAVKESRDRIKAAFKNTGFPF 60

Query: 60 LVNELPSIYLQLIYQKKDL 78
               P   + +     DL
Sbjct: 61 -----PIKQITVNLAPADL 74


>gi|331660105|ref|ZP_08361041.1| Mg chelatase-like protein [Escherichia coli TA206]
 gi|331052673|gb|EGI24708.1| Mg chelatase-like protein [Escherichia coli TA206]
          Length = 506

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|302877312|ref|YP_003845876.1| Mg chelatase, subunit ChlI [Gallionella capsiferriformans ES-2]
 gi|302580101|gb|ADL54112.1| Mg chelatase, subunit ChlI [Gallionella capsiferriformans ES-2]
          Length = 496

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A +G++   V V+V ++ G  G  IVGLP+  V ESRER+++   +    F  
Sbjct: 3  LAVLYSRALEGMEADLVTVEVHLANGLPGFTIVGLPETEVKESRERVRAALQNCQFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PARRITVNLAPADL 74


>gi|170680083|ref|YP_001746088.1| putative ATP-dependent protease [Escherichia coli SMS-3-5]
 gi|170517801|gb|ACB15979.1| ATPase, AAA family [Escherichia coli SMS-3-5]
          Length = 506

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|262040921|ref|ZP_06014147.1| competence protein ComM [Klebsiella pneumoniae subsp.
          rhinoscleromatis ATCC 13884]
 gi|259041810|gb|EEW42855.1| competence protein ComM [Klebsiella pneumoniae subsp.
          rhinoscleromatis ATCC 13884]
          Length = 506

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  GI+   + V+V +S G  G+ +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 3  LAIVYTRAALGIEAPLITVEVHLSNGLPGLTMVGLPETTVKEARDRVRSALINSGYAF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKKITINLAPADL 74


>gi|212710211|ref|ZP_03318339.1| hypothetical protein PROVALCAL_01270 [Providencia alcalifaciens
          DSM 30120]
 gi|212687210|gb|EEB46738.1| hypothetical protein PROVALCAL_01270 [Providencia alcalifaciens
          DSM 30120]
          Length = 508

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  G+    V V+  +S G  G+ +VGLP+ AV E+R+R++S  +++G     
Sbjct: 3  LAIVYTRASIGLDAPLVTVEAHISNGLPGLTLVGLPETAVKEARDRVRSALVNSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EYPVKKMTVNLAPADL 74


>gi|152972759|ref|YP_001337905.1| putative 2-component regulator [Klebsiella pneumoniae subsp.
          pneumoniae MGH 78578]
 gi|238892368|ref|YP_002917102.1| putative 2-component regulator [Klebsiella pneumoniae NTUH-K2044]
 gi|150957608|gb|ABR79638.1| putative 2-component regulator [Klebsiella pneumoniae subsp.
          pneumoniae MGH 78578]
 gi|238544684|dbj|BAH61035.1| putative 2-component regulator [Klebsiella pneumoniae subsp.
          pneumoniae NTUH-K2044]
          Length = 506

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  GI+   + V+V +S G  G+ +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 3  LAIVYTRAALGIEAPLITVEVHLSNGLPGLTMVGLPETTVKEARDRVRSALINSGYAF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKKITINLAPADL 74


>gi|110644098|ref|YP_671828.1| putative ATP-dependent protease [Escherichia coli 536]
 gi|191174369|ref|ZP_03035874.1| ATPase, AAA family [Escherichia coli F11]
 gi|306815193|ref|ZP_07449346.1| putative ATP-dependent protease [Escherichia coli NC101]
 gi|110345690|gb|ABG71927.1| putative magnesium chelatase family protein [Escherichia coli
          536]
 gi|190905346|gb|EDV64980.1| ATPase, AAA family [Escherichia coli F11]
 gi|222035471|emb|CAP78216.1| Uncharacterized protein yifB [Escherichia coli LF82]
 gi|281180816|dbj|BAI57146.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|294491645|gb|ADE90401.1| ATPase, AAA family [Escherichia coli IHE3034]
 gi|305851562|gb|EFM52016.1| putative ATP-dependent protease [Escherichia coli NC101]
 gi|307555897|gb|ADN48672.1| putative 2-component regulator [Escherichia coli ABU 83972]
 gi|307628832|gb|ADN73136.1| putative ATP-dependent protease [Escherichia coli UM146]
 gi|312948324|gb|ADR29151.1| putative ATP-dependent protease [Escherichia coli O83:H1 str. NRG
          857C]
 gi|323949346|gb|EGB45236.1| magnesium chelatase [Escherichia coli H252]
 gi|323954083|gb|EGB49880.1| magnesium chelatase [Escherichia coli H263]
          Length = 506

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|121635461|ref|YP_975706.1| putative chelatase [Neisseria meningitidis FAM18]
 gi|120867167|emb|CAM10934.1| putative chelatase [Neisseria meningitidis FAM18]
 gi|325132951|gb|EGC55628.1| Mg chelatase [Neisseria meningitidis M6190]
 gi|325138939|gb|EGC61489.1| Mg chelatase [Neisseria meningitidis ES14902]
          Length = 498

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITVNLAPADL 74


>gi|167627168|ref|YP_001677668.1| magnesium chelatase [Francisella philomiragia subsp. philomiragia
          ATCC 25017]
 gi|167597169|gb|ABZ87167.1| magnesium chelatase [Francisella philomiragia subsp. philomiragia
          ATCC 25017]
          Length = 502

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  GI+   V ++V +S G  G+ IVGLP+ AV ES++R++S  I++G  F  
Sbjct: 3  LAILKSRAQLGIEAPLVSIEVHLSNGLPGLSIVGLPEAAVKESKDRVRSAIINSGFNF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PNKRITINLAPADL 74


>gi|303231460|ref|ZP_07318191.1| Mg chelatase-like protein [Veillonella atypica ACS-049-V-Sch6]
 gi|302513897|gb|EFL55908.1| Mg chelatase-like protein [Veillonella atypica ACS-049-V-Sch6]
          Length = 523

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +++      G+ G+ V V+V +S G     IVGLP++AV ESRER+++   ++G  F 
Sbjct: 1  MYAKVYGATIDGLDGVVVTVEVDISQGLPVFDIVGLPNQAVKESRERVRAAIKNSGFDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     ++
Sbjct: 60 ----PMRRIVVNLGPAEV 73


>gi|328951664|ref|YP_004368999.1| Mg chelatase, subunit ChlI [Marinithermus hydrothermalis DSM
          14884]
 gi|328451988|gb|AEB12889.1| Mg chelatase, subunit ChlI [Marinithermus hydrothermalis DSM
          14884]
          Length = 497

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+++  T    GI+  PV V+V VSPG  G  +VGLPD AV ESR+R+++   ++G  + 
Sbjct: 1  MLAKTRTFTLYGIEAYPVTVEVDVSPGLPGYTVVGLPDTAVQESRDRVRAALKNSGFPY- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     +L
Sbjct: 60 ----PQARIVVNLAPAEL 73


>gi|325128822|gb|EGC51681.1| Mg chelatase [Neisseria meningitidis N1568]
 gi|325203512|gb|ADY98965.1| Mg chelatase [Neisseria meningitidis M01-240355]
          Length = 498

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITVNLAPADL 74


>gi|312969502|ref|ZP_07783704.1| competence protein comM [Escherichia coli 2362-75]
 gi|312286049|gb|EFR13967.1| competence protein comM [Escherichia coli 2362-75]
          Length = 506

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|330908071|gb|EGH36590.1| MG(2+) chelatase family protein/ ComM-related protein
          [Escherichia coli AA86]
          Length = 506

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|197334013|ref|YP_002157342.1| putative Mg chelatase family protein [Vibrio fischeri MJ11]
 gi|197315503|gb|ACH64950.1| putative Mg chelatase family protein [Vibrio fischeri MJ11]
          Length = 508

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++  PV V+V +S G  G  +VGLP+  V E+++R++S  I+A      
Sbjct: 3  LAIIHSRACVGVEAPPVTVEVHISNGMPGFSLVGLPETTVKEAKDRVRSAIINANF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E PS  + +     DL
Sbjct: 59 -EFPSKKITVNLAPADL 74


>gi|293413212|ref|ZP_06655874.1| Mg chelatase [Escherichia coli B354]
 gi|291468160|gb|EFF10657.1| Mg chelatase [Escherichia coli B354]
          Length = 506

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|330447304|ref|ZP_08310954.1| competence protein comM [Photobacterium leiognathi subsp.
          mandapamensis svers.1.1.]
 gi|328491495|dbj|GAA05451.1| competence protein comM [Photobacterium leiognathi subsp.
          mandapamensis svers.1.1.]
          Length = 508

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++  PV V+V +S G     +VGLP+  V E+++R++S  I+A      
Sbjct: 3  LAIVHSRACVGVQAPPVTVEVHLSNGLPSFTLVGLPETTVKEAKDRVRSAIINANF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E PS  + +     DL
Sbjct: 59 -EFPSRRITVNLAPADL 74


>gi|308388607|gb|ADO30927.1| competence protein ComM [Neisseria meningitidis alpha710]
          Length = 498

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITVNLAPADL 74


>gi|215489096|ref|YP_002331527.1| putative ATP-dependent protease [Escherichia coli O127:H6 str.
          E2348/69]
 gi|215267168|emb|CAS11616.1| predicted bifunctional enzyme and transcriptional regulator
          [Escherichia coli O127:H6 str. E2348/69]
          Length = 506

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|313667800|ref|YP_004048084.1| chelatase [Neisseria lactamica ST-640]
 gi|313005262|emb|CBN86695.1| putative chelatase [Neisseria lactamica 020-06]
          Length = 498

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITVNLAPADL 74


>gi|188590734|ref|YP_001920599.1| putative Mg chelatase homolog [Clostridium botulinum E3 str.
          Alaska E43]
 gi|188501015|gb|ACD54151.1| Mg chelatase family protein [Clostridium botulinum E3 str. Alaska
          E43]
          Length = 506

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  +I +    G++G+ +EV+V +S G     IVGL D +V ES+ER++S  +++G  F 
Sbjct: 1  MSIKIISATQNGLEGLLIEVEVDISKGLPSFSIVGLADTSVKESKERVRSAILNSGYDF- 59

Query: 61 VNELPSIYLQLIYQKKD 77
              P   + +     D
Sbjct: 60 ----PLGRITINLAPAD 72


>gi|323189509|gb|EFZ74789.1| competence protein comM [Escherichia coli RN587/1]
          Length = 506

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|254805563|ref|YP_003083784.1| putative competence protein ComM [Neisseria meningitidis alpha14]
 gi|254669105|emb|CBA07692.1| putative competence protein ComM [Neisseria meningitidis alpha14]
 gi|319411066|emb|CBY91466.1| putative Mg chelatase-like protein [Neisseria meningitidis WUE
          2594]
          Length = 498

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITVNLAPADL 74


>gi|71905692|ref|YP_283279.1| Mg chelatase-related protein [Dechloromonas aromatica RCB]
 gi|71845313|gb|AAZ44809.1| Mg chelatase-related protein [Dechloromonas aromatica RCB]
          Length = 498

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++   +    G+   PV V+  ++ G     +VGLPD  V E+R+R+++  +++G     
Sbjct: 3  LAIAYSRGLDGLNAPPVIVEAHLASGLPSFTLVGLPDTEVKEARDRVRAAIVNSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E PS  + +     DL
Sbjct: 59 -EFPSKRITVNLAPADL 74


>gi|218768826|ref|YP_002343338.1| putative chelatase [Neisseria meningitidis Z2491]
 gi|121052834|emb|CAM09182.1| putative chelatase [Neisseria meningitidis Z2491]
          Length = 498

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITVNLAPADL 74


>gi|157156172|ref|YP_001465248.1| putative ATP-dependent protease [Escherichia coli E24377A]
 gi|157078202|gb|ABV17910.1| ATPase, AAA family [Escherichia coli E24377A]
          Length = 506

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|304386659|ref|ZP_07368941.1| Mg chelatase-like protein [Neisseria meningitidis ATCC 13091]
 gi|304339244|gb|EFM05322.1| Mg chelatase-like protein [Neisseria meningitidis ATCC 13091]
          Length = 498

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITVNLAPADL 74


>gi|325130831|gb|EGC53564.1| Mg chelatase [Neisseria meningitidis OX99.30304]
 gi|325136972|gb|EGC59569.1| Mg chelatase [Neisseria meningitidis M0579]
          Length = 498

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITVNLAPADL 74


>gi|331685487|ref|ZP_08386071.1| Mg chelatase-like protein [Escherichia coli H299]
 gi|331077188|gb|EGI48402.1| Mg chelatase-like protein [Escherichia coli H299]
          Length = 506

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|323964016|gb|EGB59506.1| magnesium chelatase [Escherichia coli M863]
 gi|327250619|gb|EGE62325.1| competence protein comM [Escherichia coli STEC_7v]
          Length = 506

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|303228936|ref|ZP_07315746.1| Mg chelatase-like protein [Veillonella atypica ACS-134-V-Col7a]
 gi|302516350|gb|EFL58282.1| Mg chelatase-like protein [Veillonella atypica ACS-134-V-Col7a]
          Length = 523

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +++      G+ G+ V V+V +S G     IVGLP++AV ESRER+++   ++G  F 
Sbjct: 1  MYAKVYGATIDGLDGVVVTVEVDISQGLPVFDIVGLPNQAVKESRERVRAAIKNSGFDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     ++
Sbjct: 60 ----PMRRIVVNLGPAEV 73


>gi|293407398|ref|ZP_06651318.1| ATP-dependent protease [Escherichia coli FVEC1412]
 gi|298383138|ref|ZP_06992732.1| ATP-dependent protease [Escherichia coli FVEC1302]
 gi|331665414|ref|ZP_08366313.1| Mg chelatase-like protein [Escherichia coli TA143]
 gi|291425509|gb|EFE98547.1| ATP-dependent protease [Escherichia coli FVEC1412]
 gi|298276374|gb|EFI17893.1| ATP-dependent protease [Escherichia coli FVEC1302]
 gi|323943830|gb|EGB39925.1| magnesium chelatase [Escherichia coli H120]
 gi|324115768|gb|EGC09703.1| magnesium chelatase [Escherichia coli E1167]
 gi|331057312|gb|EGI29301.1| Mg chelatase-like protein [Escherichia coli TA143]
          Length = 506

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|256021490|ref|ZP_05435355.1| putative ATP-dependent protease [Shigella sp. D9]
          Length = 506

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|240126232|ref|ZP_04739118.1| Competence protein ComM [Neisseria gonorrhoeae SK-92-679]
 gi|268684813|ref|ZP_06151675.1| chelatase [Neisseria gonorrhoeae SK-92-679]
 gi|268625097|gb|EEZ57497.1| chelatase [Neisseria gonorrhoeae SK-92-679]
          Length = 498

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITVNLAPADL 74


>gi|168751724|ref|ZP_02776746.1| putative Mg chelatase homolog [Escherichia coli O157:H7 str.
          EC4113]
 gi|168753660|ref|ZP_02778667.1| putative Mg chelatase homolog [Escherichia coli O157:H7 str.
          EC4401]
 gi|168764156|ref|ZP_02789163.1| ATPase, AAA family [Escherichia coli O157:H7 str. EC4501]
 gi|168768044|ref|ZP_02793051.1| putative Mg chelatase homolog [Escherichia coli O157:H7 str.
          EC4486]
 gi|168775686|ref|ZP_02800693.1| putative Mg chelatase homolog [Escherichia coli O157:H7 str.
          EC4196]
 gi|168780662|ref|ZP_02805669.1| putative Mg chelatase homolog [Escherichia coli O157:H7 str.
          EC4076]
 gi|168786601|ref|ZP_02811608.1| ATPase, AAA family [Escherichia coli O157:H7 str. EC869]
 gi|168800983|ref|ZP_02825990.1| ATPase, AAA family [Escherichia coli O157:H7 str. EC508]
 gi|195938056|ref|ZP_03083438.1| putative ATP-dependent protease [Escherichia coli O157:H7 str.
          EC4024]
 gi|208808868|ref|ZP_03251205.1| Mg chelatase homolog [Escherichia coli O157:H7 str. EC4206]
 gi|208814019|ref|ZP_03255348.1| Mg chelatase homolog [Escherichia coli O157:H7 str. EC4045]
 gi|208819972|ref|ZP_03260292.1| Mg chelatase homolog [Escherichia coli O157:H7 str. EC4042]
 gi|209397578|ref|YP_002273286.1| Mg chelatase homolog [Escherichia coli O157:H7 str. EC4115]
 gi|217325281|ref|ZP_03441365.1| ATPase, AAA family [Escherichia coli O157:H7 str. TW14588]
 gi|254795765|ref|YP_003080602.1| putative ATP-dependent protease [Escherichia coli O157:H7 str.
          TW14359]
 gi|261225541|ref|ZP_05939822.1| predicted bifunctional enzyme and transcriptional regulator
          [Escherichia coli O157:H7 str. FRIK2000]
 gi|261255588|ref|ZP_05948121.1| predicted bifunctional enzyme and transcriptional regulator
          [Escherichia coli O157:H7 str. FRIK966]
 gi|293417233|ref|ZP_06659858.1| Mg chelatase [Escherichia coli B185]
 gi|187768827|gb|EDU32671.1| putative Mg chelatase homolog [Escherichia coli O157:H7 str.
          EC4196]
 gi|188014284|gb|EDU52406.1| putative Mg chelatase homolog [Escherichia coli O157:H7 str.
          EC4113]
 gi|189001434|gb|EDU70420.1| putative Mg chelatase homolog [Escherichia coli O157:H7 str.
          EC4076]
 gi|189358932|gb|EDU77351.1| putative Mg chelatase homolog [Escherichia coli O157:H7 str.
          EC4401]
 gi|189362578|gb|EDU80997.1| putative Mg chelatase homolog [Escherichia coli O157:H7 str.
          EC4486]
 gi|189365790|gb|EDU84206.1| ATPase, AAA family [Escherichia coli O157:H7 str. EC4501]
 gi|189373425|gb|EDU91841.1| ATPase, AAA family [Escherichia coli O157:H7 str. EC869]
 gi|189376802|gb|EDU95218.1| ATPase, AAA family [Escherichia coli O157:H7 str. EC508]
 gi|208728669|gb|EDZ78270.1| Mg chelatase homolog [Escherichia coli O157:H7 str. EC4206]
 gi|208735296|gb|EDZ83983.1| Mg chelatase homolog [Escherichia coli O157:H7 str. EC4045]
 gi|208740095|gb|EDZ87777.1| Mg chelatase homolog [Escherichia coli O157:H7 str. EC4042]
 gi|209158978|gb|ACI36411.1| Mg chelatase homolog [Escherichia coli O157:H7 str. EC4115]
 gi|217321502|gb|EEC29926.1| ATPase, AAA family [Escherichia coli O157:H7 str. TW14588]
 gi|254595165|gb|ACT74526.1| predicted bifunctional enzyme and transcriptional regulator
          [Escherichia coli O157:H7 str. TW14359]
 gi|291431001|gb|EFF03996.1| Mg chelatase [Escherichia coli B185]
 gi|320191138|gb|EFW65788.1| MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein
          [Escherichia coli O157:H7 str. EC1212]
 gi|320639252|gb|EFX08874.1| putative ATP-dependent protease [Escherichia coli O157:H7 str.
          G5101]
 gi|320644637|gb|EFX13687.1| putative ATP-dependent protease [Escherichia coli O157:H- str.
          493-89]
 gi|320649962|gb|EFX18465.1| putative ATP-dependent protease [Escherichia coli O157:H- str. H
          2687]
 gi|320655308|gb|EFX23250.1| putative ATP-dependent protease [Escherichia coli O55:H7 str.
          3256-97 TW 07815]
 gi|320666057|gb|EFX33071.1| putative ATP-dependent protease [Escherichia coli O157:H7 str.
          LSU-61]
 gi|326344226|gb|EGD67986.1| MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein
          [Escherichia coli O157:H7 str. 1125]
 gi|326347947|gb|EGD71661.1| MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein
          [Escherichia coli O157:H7 str. 1044]
          Length = 506

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|157960161|ref|YP_001500195.1| Mg chelatase subunit ChlI [Shewanella pealeana ATCC 700345]
 gi|157845161|gb|ABV85660.1| Mg chelatase, subunit ChlI [Shewanella pealeana ATCC 700345]
          Length = 506

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I+ I+T A  G++  PV V+V +S G     +VGLP+ +V E++ER++S  I+AG     
Sbjct: 3  IASIATRASFGVQAPPVTVEVHLSNGLPAFNLVGLPEASVKEAKERVRSALINAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPMRRITVNLAPADL 74


>gi|91213288|ref|YP_543274.1| putative ATP-dependent protease [Escherichia coli UTI89]
 gi|117626030|ref|YP_859353.1| putative ATP-dependent protease [Escherichia coli APEC O1]
 gi|218560833|ref|YP_002393746.1| ATP-dependent protease [Escherichia coli S88]
 gi|218692046|ref|YP_002400258.1| putative ATP-dependent protease [Escherichia coli ED1a]
 gi|227888648|ref|ZP_04006453.1| ATPase [Escherichia coli 83972]
 gi|237702777|ref|ZP_04533258.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|300979295|ref|ZP_07174479.1| Mg chelatase-like protein [Escherichia coli MS 200-1]
 gi|300985821|ref|ZP_07177613.1| Mg chelatase-like protein [Escherichia coli MS 45-1]
 gi|301047353|ref|ZP_07194438.1| Mg chelatase-like protein [Escherichia coli MS 185-1]
 gi|91074862|gb|ABE09743.1| putative 2-component regulator [Escherichia coli UTI89]
 gi|115515154|gb|ABJ03229.1| putative bifunctional enzyme and transcriptional regulator
          [Escherichia coli APEC O1]
 gi|218367602|emb|CAR05386.1| putative bifunctional enzyme and transcriptional regulator
          [Escherichia coli S88]
 gi|218429610|emb|CAR10433.1| putative bifunctional enzyme and transcriptional regulator
          [Escherichia coli ED1a]
 gi|226902948|gb|EEH89207.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|227834487|gb|EEJ44953.1| ATPase [Escherichia coli 83972]
 gi|300300770|gb|EFJ57155.1| Mg chelatase-like protein [Escherichia coli MS 185-1]
 gi|300308048|gb|EFJ62568.1| Mg chelatase-like protein [Escherichia coli MS 200-1]
 gi|300407972|gb|EFJ91510.1| Mg chelatase-like protein [Escherichia coli MS 45-1]
 gi|315293117|gb|EFU52469.1| Mg chelatase-like protein [Escherichia coli MS 153-1]
 gi|315300836|gb|EFU60058.1| Mg chelatase-like protein [Escherichia coli MS 16-3]
 gi|324007439|gb|EGB76658.1| Mg chelatase-like protein [Escherichia coli MS 57-2]
 gi|324014748|gb|EGB83967.1| Mg chelatase-like protein [Escherichia coli MS 60-1]
          Length = 516

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 13 LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 68

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 69 -EYPAKKITINLAPADL 84


>gi|325134872|gb|EGC57505.1| Mg chelatase [Neisseria meningitidis M13399]
          Length = 498

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITVNLAPADL 74


>gi|324110996|gb|EGC04983.1| magnesium chelatase [Escherichia fergusonii B253]
          Length = 506

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|261391919|emb|CAX49381.1| putative Mg chelatase-like protein [Neisseria meningitidis 8013]
 gi|325202783|gb|ADY98237.1| Mg chelatase [Neisseria meningitidis M01-240149]
          Length = 498

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITVNLAPADL 74


>gi|323974350|gb|EGB69478.1| magnesium chelatase [Escherichia coli TW10509]
          Length = 506

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|300940018|ref|ZP_07154643.1| Mg chelatase-like protein [Escherichia coli MS 21-1]
 gi|300455151|gb|EFK18644.1| Mg chelatase-like protein [Escherichia coli MS 21-1]
          Length = 516

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 13 LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 68

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 69 -EYPAKKITINLAPADL 84


>gi|298370225|ref|ZP_06981541.1| Mg chelatase-like protein [Neisseria sp. oral taxon 014 str.
          F0314]
 gi|298281685|gb|EFI23174.1| Mg chelatase-like protein [Neisseria sp. oral taxon 014 str.
          F0314]
          Length = 499

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           + +++ A  G+    VEV+V ++ G     IVGLPD  V ESR+R+++  I +G  F  
Sbjct: 3  FAVVNSRALCGMSAPLVEVEVHLANGLPQFNIVGLPDTEVKESRDRVRAAIIQSGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKKITVNLAPADL 74


>gi|253702368|ref|YP_003023557.1| Mg chelatase, subunit ChlI [Geobacter sp. M21]
 gi|251777218|gb|ACT19799.1| Mg chelatase, subunit ChlI [Geobacter sp. M21]
          Length = 509

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ + A  GI  I ++V+V ++ G   +  VGLPD AV ES++R+++   ++G    
Sbjct: 1  MLAKVLSSALVGIDAILIDVEVDIAQGLPQLATVGLPDNAVKESKDRVKAALKNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P+  + +     D+
Sbjct: 58 --EFPNRKITVNLAPADV 73


>gi|332184781|gb|AEE27035.1| MG(2+) chelatase family protein / ComM-related protein
          [Francisella cf. novicida 3523]
          Length = 502

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  GI+   V ++V +S G  G+ IVGLP+ AV ES++R++S  I++G  F  
Sbjct: 3  LAVLKSRAQLGIEAPLVSIEVHLSNGLPGLSIVGLPEAAVKESKDRVRSAIINSGFSF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PNKRITINLAPADL 74


>gi|89091844|ref|ZP_01164799.1| Mg chelatase-like protein [Oceanospirillum sp. MED92]
 gi|89083579|gb|EAR62796.1| Mg chelatase-like protein [Oceanospirillum sp. MED92]
          Length = 220

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  GI    V V+V +S G     IVGLP+ AV ESRER++S  I++G  F  
Sbjct: 3  LAVVLTRALVGIDAPQVTVEVHLSGGLPSFSIVGLPEAAVKESRERVRSALINSGYDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PQRRITVNLAPADL 74


>gi|332976606|gb|EGK13447.1| competence protein ComM [Desmospora sp. 8437]
          Length = 510

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +++ + +  GI G  VEV+V +S G     +VGLPD AV ESRER+++   ++     
Sbjct: 1  MYAKLYSSSVLGIDGYIVEVEVDISNGLPVFDLVGLPDSAVRESRERVRAAVKNS----- 55

Query: 61 VNELPSIYLQLIYQKKDL 78
            + P   +       DL
Sbjct: 56 DCQFPLQRITTNLAPADL 73


>gi|268592946|ref|ZP_06127167.1| Mg chelatase-like protein [Providencia rettgeri DSM 1131]
 gi|291311738|gb|EFE52191.1| Mg chelatase-like protein [Providencia rettgeri DSM 1131]
          Length = 508

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  G++   V V+  +S G  G+ +VGLP+ AV E+R+R++S  +++G     
Sbjct: 3  LAIVYTRASIGLEAPLVTVEAHISNGLPGLTLVGLPETAVKEARDRVRSALLNSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKMTVNLAPADL 74


>gi|240113331|ref|ZP_04727821.1| Competence protein ComM [Neisseria gonorrhoeae MS11]
 gi|268599405|ref|ZP_06133572.1| chelatase [Neisseria gonorrhoeae MS11]
 gi|268583536|gb|EEZ48212.1| chelatase [Neisseria gonorrhoeae MS11]
          Length = 498

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITVNLAPADL 74


>gi|218783099|ref|YP_002434417.1| Mg chelatase, subunit ChlI [Desulfatibacillum alkenivorans AK-01]
 gi|218764483|gb|ACL06949.1| Mg chelatase, subunit ChlI [Desulfatibacillum alkenivorans AK-01]
          Length = 517

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + A  GI    VEV+V +S G      VGLP+ +V ES++R+++   ++G  F 
Sbjct: 1  MLARVLSSAVLGIDATIVEVEVDISSGLPLFSTVGLPETSVKESKDRVKAAIGNSGYGF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P  ++ +     DL
Sbjct: 60 ----PEDHITVNLAPADL 73


>gi|301021442|ref|ZP_07185466.1| Mg chelatase-like protein [Escherichia coli MS 69-1]
 gi|300398078|gb|EFJ81616.1| Mg chelatase-like protein [Escherichia coli MS 69-1]
          Length = 516

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 13 LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 68

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 69 -EYPAKKITINLAPADL 84


>gi|161505582|ref|YP_001572694.1| putative ATP-dependent protease [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160866929|gb|ABX23552.1| hypothetical protein SARI_03752 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 538

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2   ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           +S + T A  G+   P+ ++V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 35  LSIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 90

Query: 62  NELPSIYLQLIYQKKDL 78
            E P+  + +     DL
Sbjct: 91  -EFPAKKITINLAPADL 106


>gi|322421602|ref|YP_004200825.1| Mg chelatase subunit ChlI [Geobacter sp. M18]
 gi|320127989|gb|ADW15549.1| Mg chelatase, subunit ChlI [Geobacter sp. M18]
          Length = 508

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ + A  GI  I ++V+V ++ G   +  VGLPD AV ES++R+++   ++G  F 
Sbjct: 1  MLAKVLSSALLGIDAILIDVEVDIAQGLPQLATVGLPDGAVKESKDRVKAALKNSGYDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     D+
Sbjct: 60 ----PNRKITVNLAPADV 73


>gi|59713162|ref|YP_205938.1| magnesium chelatase [Vibrio fischeri ES114]
 gi|59481263|gb|AAW87050.1| magnesium chelatase [Vibrio fischeri ES114]
          Length = 508

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++  PV V+V +S G  G  +VGLP+  V E+++R++S  I+A      
Sbjct: 3  LAIIHSRACVGVEAPPVTVEVHISNGMPGFSLVGLPETTVKEAKDRVRSAIINANF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E PS  + +     DL
Sbjct: 59 -EFPSKKITVNLAPADL 74


>gi|331649592|ref|ZP_08350674.1| Mg chelatase-like protein [Escherichia coli M605]
 gi|331041462|gb|EGI13610.1| Mg chelatase-like protein [Escherichia coli M605]
          Length = 516

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 13 LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 68

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 69 -EYPAKKITINLAPADL 84


>gi|254494336|ref|ZP_05107507.1| chelatase [Neisseria gonorrhoeae 1291]
 gi|226513376|gb|EEH62721.1| chelatase [Neisseria gonorrhoeae 1291]
          Length = 498

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITVNLAPADL 74


>gi|261401187|ref|ZP_05987312.1| Mg chelatase-like protein [Neisseria lactamica ATCC 23970]
 gi|269208867|gb|EEZ75322.1| Mg chelatase-like protein [Neisseria lactamica ATCC 23970]
          Length = 498

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITVNLAPADL 74


>gi|325198912|gb|ADY94368.1| Mg chelatase [Neisseria meningitidis G2136]
          Length = 498

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITVNLAPADL 74


>gi|170769867|ref|ZP_02904320.1| ATPase, AAA family [Escherichia albertii TW07627]
 gi|170121305|gb|EDS90236.1| ATPase, AAA family [Escherichia albertii TW07627]
          Length = 506

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|59801886|ref|YP_208598.1| hypothetical protein NGO1550 [Neisseria gonorrhoeae FA 1090]
 gi|240014796|ref|ZP_04721709.1| Competence protein ComM [Neisseria gonorrhoeae DGI18]
 gi|240017244|ref|ZP_04723784.1| Competence protein ComM [Neisseria gonorrhoeae FA6140]
 gi|240116322|ref|ZP_04730384.1| Competence protein ComM [Neisseria gonorrhoeae PID18]
 gi|240118609|ref|ZP_04732671.1| Competence protein ComM [Neisseria gonorrhoeae PID1]
 gi|240121319|ref|ZP_04734281.1| Competence protein ComM [Neisseria gonorrhoeae PID24-1]
 gi|240128822|ref|ZP_04741483.1| Competence protein ComM [Neisseria gonorrhoeae SK-93-1035]
 gi|268601989|ref|ZP_06136156.1| chelatase [Neisseria gonorrhoeae PID18]
 gi|268604321|ref|ZP_06138488.1| chelatase [Neisseria gonorrhoeae PID1]
 gi|268687204|ref|ZP_06154066.1| chelatase [Neisseria gonorrhoeae SK-93-1035]
 gi|293398473|ref|ZP_06642651.1| Mg chelatase [Neisseria gonorrhoeae F62]
 gi|59718781|gb|AAW90186.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|268586120|gb|EEZ50796.1| chelatase [Neisseria gonorrhoeae PID18]
 gi|268588452|gb|EEZ53128.1| chelatase [Neisseria gonorrhoeae PID1]
 gi|268627488|gb|EEZ59888.1| chelatase [Neisseria gonorrhoeae SK-93-1035]
 gi|291610944|gb|EFF40041.1| Mg chelatase [Neisseria gonorrhoeae F62]
          Length = 498

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITVNLAPADL 74


>gi|218551007|ref|YP_002384798.1| ATP-dependent protease [Escherichia fergusonii ATCC 35469]
 gi|218358548|emb|CAQ91196.1| putative bifunctional enzyme and transcriptional regulator
          [Escherichia fergusonii ATCC 35469]
          Length = 516

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 13 LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 68

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 69 -EYPAKKITINLAPADL 84


>gi|261365473|ref|ZP_05978356.1| Mg chelatase-like protein [Neisseria mucosa ATCC 25996]
 gi|288566003|gb|EFC87563.1| Mg chelatase-like protein [Neisseria mucosa ATCC 25996]
          Length = 498

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G  F  
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKKITVNLAPADL 74


>gi|194099365|ref|YP_002002465.1| Competence protein ComM [Neisseria gonorrhoeae NCCP11945]
 gi|193934655|gb|ACF30479.1| Competence protein ComM [Neisseria gonorrhoeae NCCP11945]
          Length = 498

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITVNLAPADL 74


>gi|309379050|emb|CBX22352.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 498

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITVNLAPADL 74


>gi|300923265|ref|ZP_07139315.1| Mg chelatase-like protein [Escherichia coli MS 182-1]
 gi|301325454|ref|ZP_07218939.1| Mg chelatase-like protein [Escherichia coli MS 78-1]
 gi|300420446|gb|EFK03757.1| Mg chelatase-like protein [Escherichia coli MS 182-1]
 gi|300847715|gb|EFK75475.1| Mg chelatase-like protein [Escherichia coli MS 78-1]
          Length = 516

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 13 LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 68

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 69 -EYPAKKITINLAPADL 84


>gi|332345748|gb|AEE59082.1| competence protein ComM [Escherichia coli UMNK88]
          Length = 506

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|294787678|ref|ZP_06752922.1| Mg chelatase-like protein [Simonsiella muelleri ATCC 29453]
 gi|294483971|gb|EFG31654.1| Mg chelatase-like protein [Simonsiella muelleri ATCC 29453]
          Length = 497

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           S I++ A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  FSVINSRALSGMDAPLVEVETHLANGLPQFNIVGLPDTEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPTQKITVNLAPADL 74


>gi|220931585|ref|YP_002508493.1| Mg chelatase, subunit ChlI [Halothermothrix orenii H 168]
 gi|219992895|gb|ACL69498.1| Mg chelatase, subunit ChlI [Halothermothrix orenii H 168]
          Length = 508

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ + + +GI G+ V V+V +S G     IVGLPD AV ESRER+++   ++G    
Sbjct: 1  MLAKVISASLKGINGVKVRVEVDLSRGLPSFDIVGLPDTAVRESRERVRAGIKNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +      L
Sbjct: 58 --EFPIKKIIINLAPAAL 73


>gi|291285182|ref|YP_003502000.1| putative 2-component regulator [Escherichia coli O55:H7 str.
          CB9615]
 gi|290765055|gb|ADD59016.1| Putative 2-component regulator [Escherichia coli O55:H7 str.
          CB9615]
          Length = 516

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 13 LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 68

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 69 -EYPAKKITINLAPADL 84


>gi|239999621|ref|ZP_04719545.1| Competence protein ComM [Neisseria gonorrhoeae 35/02]
 gi|268595432|ref|ZP_06129599.1| competence protein ComM [Neisseria gonorrhoeae 35/02]
 gi|268548821|gb|EEZ44239.1| competence protein ComM [Neisseria gonorrhoeae 35/02]
 gi|317164872|gb|ADV08413.1| hypothetical protein NGTW08_1452 [Neisseria gonorrhoeae
          TCDC-NG08107]
          Length = 498

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITVNLAPADL 74


>gi|164688550|ref|ZP_02212578.1| hypothetical protein CLOBAR_02195 [Clostridium bartlettii DSM
          16795]
 gi|164602963|gb|EDQ96428.1| hypothetical protein CLOBAR_02195 [Clostridium bartlettii DSM
          16795]
          Length = 509

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S +++    GI G  V V+V ++ G     IVGL    + E++ER++S  I++G    
Sbjct: 1  MLSIVNSCNLIGIDGFIVNVEVDITRGMPCFNIVGLASIEIKEAKERVKSAIINSGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P+  + +     D+
Sbjct: 58 --EFPAKRIVVNLSPADI 73


>gi|240081119|ref|ZP_04725662.1| Competence protein ComM [Neisseria gonorrhoeae FA19]
 gi|240124152|ref|ZP_04737108.1| Competence protein ComM [Neisseria gonorrhoeae PID332]
 gi|260439861|ref|ZP_05793677.1| Competence protein ComM [Neisseria gonorrhoeae DGI2]
 gi|268597230|ref|ZP_06131397.1| competence protein ComM [Neisseria gonorrhoeae FA19]
 gi|268682777|ref|ZP_06149639.1| chelatase [Neisseria gonorrhoeae PID332]
 gi|291043137|ref|ZP_06568860.1| competence protein ComM [Neisseria gonorrhoeae DGI2]
 gi|268551018|gb|EEZ46037.1| competence protein ComM [Neisseria gonorrhoeae FA19]
 gi|268623061|gb|EEZ55461.1| chelatase [Neisseria gonorrhoeae PID332]
 gi|291012743|gb|EFE04726.1| competence protein ComM [Neisseria gonorrhoeae DGI2]
          Length = 498

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITVNLAPADL 74


>gi|71279064|ref|YP_271480.1| competence protein ComM [Colwellia psychrerythraea 34H]
 gi|71144804|gb|AAZ25277.1| competence protein ComM [Colwellia psychrerythraea 34H]
          Length = 509

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + + A  G++   V V+V ++ G     IVGLP+ +V ES++R++S  I+ G     
Sbjct: 3  LSCVYSRARIGLESPLVTVEVHLANGLPAFNIVGLPEASVKESKDRVRSAIINCGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKRITVNLAPADL 74


>gi|87299252|emb|CAJ77009.1| 3' partial ATPase [Acinetobacter baumannii]
          Length = 286

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           S+I T    G+    +EV+V VS G   + IVGL + AV ES++R++S  I++G  F  
Sbjct: 3  FSKIYTRGLLGLHAPLIEVEVHVSQGLPSLTIVGLAEAAVRESKDRVRSAIINSGFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  L +     DL
Sbjct: 61 ---PTKRLTINLAPADL 74


>gi|313888001|ref|ZP_07821679.1| Mg chelatase-like protein [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312845956|gb|EFR33339.1| Mg chelatase-like protein [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 506

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S   T    G+ G PV+V+V +S G   + +VGL D AV ES ER++S   ++G  F 
Sbjct: 1  MYSCTKTCTLTGLNGYPVDVEVDLSNGMPKIILVGLADTAVKESTERVKSAIKNSGFDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     +L
Sbjct: 60 ----PKKRITINLAPANL 73


>gi|261345280|ref|ZP_05972924.1| Mg chelatase-like protein [Providencia rustigianii DSM 4541]
 gi|282566981|gb|EFB72516.1| Mg chelatase-like protein [Providencia rustigianii DSM 4541]
          Length = 508

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  G+    V V+  +S G  G+ +VGLP+ AV E+R+R++S  I++G     
Sbjct: 3  LAIVYTRASIGMDAPLVTVEAHISNGLPGLTLVGLPETAVKEARDRVRSAIINSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EYPVKKMTINLAPADL 74


>gi|332282726|ref|ZP_08395139.1| conserved hypothetical protein [Shigella sp. D9]
 gi|332105078|gb|EGJ08424.1| conserved hypothetical protein [Shigella sp. D9]
          Length = 516

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 13 LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 68

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 69 -EYPAKKITINLAPADL 84


>gi|331675238|ref|ZP_08375989.1| Mg chelatase-like protein [Escherichia coli TA280]
 gi|331067524|gb|EGI38928.1| Mg chelatase-like protein [Escherichia coli TA280]
          Length = 516

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 13 LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 68

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 69 -EYPAKKITINLAPADL 84


>gi|260857827|ref|YP_003231718.1| putative bifunctional enzyme and transcriptional regulator
          [Escherichia coli O26:H11 str. 11368]
 gi|257756476|dbj|BAI27978.1| predicted bifunctional enzyme and transcriptional regulator
          [Escherichia coli O26:H11 str. 11368]
          Length = 506

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|218707404|ref|YP_002414923.1| putative ATP-dependent protease [Escherichia coli UMN026]
 gi|218434501|emb|CAR15429.1| putative bifunctional enzyme and transcriptional regulator
          [Escherichia coli UMN026]
 gi|284923872|emb|CBG36971.1| Putative magnesium chelatase [Escherichia coli 042]
          Length = 516

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 13 LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 68

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 69 -EYPAKKITINLAPADL 84


>gi|218701320|ref|YP_002408949.1| putative ATP-dependent protease [Escherichia coli IAI39]
 gi|218371306|emb|CAR19138.1| putative bifunctional enzyme and transcriptional regulator
          [Escherichia coli IAI39]
          Length = 516

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 13 LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 68

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 69 -EYPAKKITINLAPADL 84


>gi|145698331|ref|NP_418214.2| predicted bifunctional enzyme and transcriptional regulator
          [Escherichia coli str. K-12 substr. MG1655]
 gi|188496249|ref|ZP_03003519.1| ATPase, AAA family [Escherichia coli 53638]
 gi|194438621|ref|ZP_03070709.1| ATPase, AAA family [Escherichia coli 101-1]
 gi|238902850|ref|YP_002928646.1| putative bifunctional enzyme and transcriptional regulator
          [Escherichia coli BW2952]
 gi|253775606|ref|YP_003038437.1| ATP-dependent protease [Escherichia coli 'BL21-Gold(DE3)pLysS
          AG']
 gi|256026115|ref|ZP_05439980.1| putative ATP-dependent protease [Escherichia sp. 4_1_40B]
 gi|297517346|ref|ZP_06935732.1| putative ATP-dependent protease [Escherichia coli OP50]
 gi|301028973|ref|ZP_07192133.1| Mg chelatase-like protein [Escherichia coli MS 196-1]
 gi|307140467|ref|ZP_07499823.1| putative ATP-dependent protease [Escherichia coli H736]
 gi|152031749|sp|P22787|YIFB_ECOLI RecName: Full=Uncharacterized protein YifB
 gi|145693202|gb|AAC77486.2| predicted bifunctional enzyme and transcriptional regulator
          [Escherichia coli str. K-12 substr. MG1655]
 gi|188491448|gb|EDU66551.1| ATPase, AAA family [Escherichia coli 53638]
 gi|194422425|gb|EDX38424.1| ATPase, AAA family [Escherichia coli 101-1]
 gi|238862180|gb|ACR64178.1| predicted bifunctional enzyme and transcriptional regulator
          [Escherichia coli BW2952]
 gi|253326650|gb|ACT31252.1| Mg chelatase, subunit ChlI [Escherichia coli 'BL21-Gold(DE3)pLysS
          AG']
 gi|260451386|gb|ACX41808.1| Mg chelatase, subunit ChlI [Escherichia coli DH1]
 gi|299878057|gb|EFI86268.1| Mg chelatase-like protein [Escherichia coli MS 196-1]
 gi|315138343|dbj|BAJ45502.1| transcriptional regulator [Escherichia coli DH1]
 gi|315618532|gb|EFU99118.1| competence protein comM [Escherichia coli 3431]
 gi|323938907|gb|EGB35126.1| magnesium chelatase [Escherichia coli E482]
 gi|323969290|gb|EGB64590.1| magnesium chelatase [Escherichia coli TA007]
          Length = 506

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|325205475|gb|ADZ00928.1| Mg chelatase [Neisseria meningitidis M04-240196]
          Length = 498

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITVNLAPADL 74


>gi|325144944|gb|EGC67227.1| Mg chelatase [Neisseria meningitidis M01-240013]
          Length = 498

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITVNLAPADL 74


>gi|15804357|ref|NP_290397.1| putative ATP-dependent protease [Escherichia coli O157:H7 EDL933]
 gi|15833954|ref|NP_312727.1| ATP-dependent protease [Escherichia coli O157:H7 str. Sakai]
 gi|12518624|gb|AAG58961.1|AE005608_2 putative 2-component regulator [Escherichia coli O157:H7 str.
          EDL933]
 gi|13364175|dbj|BAB38123.1| putative 2-component regulator [Escherichia coli O157:H7 str.
          Sakai]
 gi|209753628|gb|ACI75121.1| ilvGEDA operon leader peptide [Escherichia coli]
 gi|209753630|gb|ACI75122.1| ilvGEDA operon leader peptide [Escherichia coli]
 gi|209753632|gb|ACI75123.1| ilvGEDA operon leader peptide [Escherichia coli]
 gi|209753634|gb|ACI75124.1| ilvGEDA operon leader peptide [Escherichia coli]
 gi|209753636|gb|ACI75125.1| ilvGEDA operon leader peptide [Escherichia coli]
          Length = 516

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 13 LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 68

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 69 -EYPAKKITINLAPADL 84


>gi|191166090|ref|ZP_03027925.1| ATPase, AAA family [Escherichia coli B7A]
 gi|193066131|ref|ZP_03047186.1| putative Mg chelatase homolog [Escherichia coli E22]
 gi|193071049|ref|ZP_03051976.1| ATPase, AAA family [Escherichia coli E110019]
 gi|194429758|ref|ZP_03062273.1| ATPase, AAA family [Escherichia coli B171]
 gi|209921239|ref|YP_002295323.1| putative ATP-dependent protease [Escherichia coli SE11]
 gi|260846457|ref|YP_003224235.1| putative bifunctional enzyme and transcriptional regulator
          [Escherichia coli O103:H2 str. 12009]
 gi|260870492|ref|YP_003236894.1| putative bifunctional enzyme and transcriptional regulator
          [Escherichia coli O111:H- str. 11128]
 gi|293468086|ref|ZP_06664498.1| Mg chelatase [Escherichia coli B088]
 gi|307313655|ref|ZP_07593275.1| Mg chelatase, subunit ChlI [Escherichia coli W]
 gi|331670611|ref|ZP_08371448.1| Mg chelatase-like protein [Escherichia coli TA271]
 gi|190903866|gb|EDV63580.1| ATPase, AAA family [Escherichia coli B7A]
 gi|192926228|gb|EDV80867.1| putative Mg chelatase homolog [Escherichia coli E22]
 gi|192955636|gb|EDV86112.1| ATPase, AAA family [Escherichia coli E110019]
 gi|194412170|gb|EDX28477.1| ATPase, AAA family [Escherichia coli B171]
 gi|209914498|dbj|BAG79572.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|257761604|dbj|BAI33101.1| predicted bifunctional enzyme and transcriptional regulator
          [Escherichia coli O103:H2 str. 12009]
 gi|257766848|dbj|BAI38343.1| predicted bifunctional enzyme and transcriptional regulator
          [Escherichia coli O111:H- str. 11128]
 gi|291321464|gb|EFE60902.1| Mg chelatase [Escherichia coli B088]
 gi|306906636|gb|EFN37148.1| Mg chelatase, subunit ChlI [Escherichia coli W]
 gi|315063064|gb|ADT77391.1| predicted bifunctional enzyme and transcriptional regulator
          [Escherichia coli W]
 gi|320198524|gb|EFW73125.1| MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein
          [Escherichia coli EC4100B]
 gi|323155170|gb|EFZ41354.1| competence protein comM [Escherichia coli EPECa14]
 gi|323160989|gb|EFZ46908.1| competence protein comM [Escherichia coli E128010]
 gi|323177778|gb|EFZ63362.1| competence protein comM [Escherichia coli 1180]
 gi|323182541|gb|EFZ67945.1| competence protein comM [Escherichia coli 1357]
 gi|323380873|gb|ADX53141.1| Mg chelatase, subunit ChlI [Escherichia coli KO11]
 gi|331062084|gb|EGI34006.1| Mg chelatase-like protein [Escherichia coli TA271]
          Length = 506

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|157163241|ref|YP_001460559.1| putative ATP-dependent protease [Escherichia coli HS]
 gi|170022205|ref|YP_001727159.1| putative ATP-dependent protease [Escherichia coli ATCC 8739]
 gi|312971949|ref|ZP_07786123.1| competence protein comM [Escherichia coli 1827-70]
 gi|157068921|gb|ABV08176.1| ATPase, AAA family [Escherichia coli HS]
 gi|169757133|gb|ACA79832.1| Mg chelatase, subunit ChlI [Escherichia coli ATCC 8739]
 gi|310334326|gb|EFQ00531.1| competence protein comM [Escherichia coli 1827-70]
          Length = 506

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|323959026|gb|EGB54695.1| magnesium chelatase [Escherichia coli H489]
          Length = 506

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|116073812|ref|ZP_01471074.1| Mg(2+) chelatase family protein [Synechococcus sp. RS9916]
 gi|116069117|gb|EAU74869.1| Mg(2+) chelatase family protein [Synechococcus sp. RS9916]
          Length = 523

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 46/78 (58%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R  + +  G++  PV V+V ++PG  G+Q+VGLPD A+ ESRER+++   ++G    
Sbjct: 1  MLARCQSASLLGLEACPVTVEVDLAPGLPGLQLVGLPDAAIQESRERVRAALRNSGFRG- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P + + +     DL
Sbjct: 60 ----PLVRVVVNLAPADL 73


>gi|238794313|ref|ZP_04637926.1| hypothetical protein yinte0001_40290 [Yersinia intermedia ATCC
          29909]
 gi|238726397|gb|EEQ17938.1| hypothetical protein yinte0001_40290 [Yersinia intermedia ATCC
          29909]
          Length = 507

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  GI+  PV V+V +S G  G+ +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 3  LATIHTRATLGIQAPPVTVEVHISNGLPGLILVGLPETTVKEARDRVRSALINSGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVSLAPADL 74


>gi|260771073|ref|ZP_05880001.1| predicted ATPase with chaperone activity [Vibrio furnissii CIP
          102972]
 gi|260613962|gb|EEX39153.1| predicted ATPase with chaperone activity [Vibrio furnissii CIP
          102972]
 gi|315178601|gb|ADT85515.1| ComM-related protein [Vibrio furnissii NCTC 11218]
          Length = 507

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V V+V +S G  G  +VGLP+  V ESR+R++S  I++      
Sbjct: 3  LAIIHSRASIGVQAPAVTVEVHISNGMPGFTLVGLPETTVKESRDRVRSAIINSKF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKRITVNLAPADL 74


>gi|325142960|gb|EGC65317.1| Mg chelatase [Neisseria meningitidis 961-5945]
          Length = 498

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITVNLAPADL 74


>gi|325208779|gb|ADZ04231.1| Mg chelatase [Neisseria meningitidis NZ-05/33]
          Length = 498

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITVNLAPADL 74


>gi|301598141|ref|ZP_07243149.1| Mg chelatase-related protein [Acinetobacter baumannii AB059]
          Length = 282

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 27/76 (35%), Positives = 41/76 (53%), Gaps = 5/76 (6%)

Query: 3  SRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVN 62
          S+I T    G+    +EV+V VS G   + IVGL + AV ES++R++S  I++G  F   
Sbjct: 1  SKIYTRGLLGLHAPLIEVEVHVSQGLPSLTIVGLAEAAVRESKDRVRSAIINSGFQF--- 57

Query: 63 ELPSIYLQLIYQKKDL 78
            P+  L +     DL
Sbjct: 58 --PTKRLTINLAPADL 71


>gi|219849188|ref|YP_002463621.1| Mg chelatase subunit ChlI [Chloroflexus aggregans DSM 9485]
 gi|219543447|gb|ACL25185.1| Mg chelatase, subunit ChlI [Chloroflexus aggregans DSM 9485]
          Length = 505

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ + A  G+ G+ V+V+V V+ G     +VGL D AV ESRER++S   ++G+ F 
Sbjct: 1  MLAKVLSCAVIGLDGVLVDVEVDVAGGMPAFSVVGLGDAAVHESRERVRSAVRNSGMRF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PMQRITVNLAPADL 73


>gi|296313567|ref|ZP_06863508.1| Mg chelatase-like protein [Neisseria polysaccharea ATCC 43768]
 gi|296839868|gb|EFH23806.1| Mg chelatase-like protein [Neisseria polysaccharea ATCC 43768]
          Length = 498

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPTKKITVNLAPADL 74


>gi|146294722|ref|YP_001185146.1| Mg chelatase subunit ChlI [Shewanella putrefaciens CN-32]
 gi|145566412|gb|ABP77347.1| Mg chelatase, subunit ChlI [Shewanella putrefaciens CN-32]
 gi|319427957|gb|ADV56031.1| Mg chelatase, subunit ChlI [Shewanella putrefaciens 200]
          Length = 509

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I+ ++T A  G++   V V+V +S G     +VGLP+ +V E+RER++S  I+AG     
Sbjct: 3  IACVNTRASCGVEAPKVTVEVHLSNGLPAFNLVGLPEASVKEARERVRSALINAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPMRRITVNLAPADL 74


>gi|148173|gb|AAA67569.1| unknown [Escherichia coli str. K-12 substr. MG1655]
          Length = 516

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 13 LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 68

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 69 -EYPAKKITINLAPADL 84


>gi|89110249|ref|AP_004029.1| predicted bifunctional protein, enzyme and transcriptional
          regulator [Escherichia coli str. K-12 substr. W3110]
 gi|170083257|ref|YP_001732577.1| transcriptional regulator [Escherichia coli str. K-12 substr.
          DH10B]
 gi|254038978|ref|ZP_04873029.1| transcriptional regulator [Escherichia sp. 1_1_43]
 gi|254163711|ref|YP_003046819.1| putative ATP-dependent protease [Escherichia coli B str. REL606]
 gi|301646170|ref|ZP_07246068.1| Mg chelatase-like protein [Escherichia coli MS 146-1]
 gi|331644499|ref|ZP_08345619.1| Mg chelatase-like protein [Escherichia coli H736]
 gi|147774|gb|AAA24609.1| ORF III [Escherichia coli]
 gi|85676280|dbj|BAE77530.1| predicted bifunctional protein, enzyme and transcriptional
          regulator [Escherichia coli str. K12 substr. W3110]
 gi|169891092|gb|ACB04799.1| predicted bifunctional enzyme and transcriptional regulator
          [Escherichia coli str. K-12 substr. DH10B]
 gi|226838669|gb|EEH70697.1| transcriptional regulator [Escherichia sp. 1_1_43]
 gi|242379299|emb|CAQ34110.1| predicted ATP-dependent protease [Escherichia coli BL21(DE3)]
 gi|253975612|gb|ACT41283.1| predicted bifunctional enzyme and transcriptional regulator
          [Escherichia coli B str. REL606]
 gi|253979768|gb|ACT45438.1| predicted bifunctional enzyme and transcriptional regulator
          [Escherichia coli BL21(DE3)]
 gi|301075600|gb|EFK90406.1| Mg chelatase-like protein [Escherichia coli MS 146-1]
 gi|309704206|emb|CBJ03553.1| Putative magnesium chelatase [Escherichia coli ETEC H10407]
 gi|331036171|gb|EGI08406.1| Mg chelatase-like protein [Escherichia coli H736]
          Length = 516

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 13 LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 68

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 69 -EYPAKKITINLAPADL 84


>gi|120600564|ref|YP_965138.1| Mg chelatase subunit ChlI [Shewanella sp. W3-18-1]
 gi|120560657|gb|ABM26584.1| Mg chelatase, subunit ChlI [Shewanella sp. W3-18-1]
          Length = 509

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I+ ++T A  G++   V V+V +S G     +VGLP+ +V E+RER++S  I+AG     
Sbjct: 3  IACVNTRASCGVEAPKVTVEVHLSNGLPAFNLVGLPEASVKEARERVRSALINAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPMRRITVNLAPADL 74


>gi|197120046|ref|YP_002140473.1| magnesium chelatase, ChlI subunit [Geobacter bemidjiensis Bem]
 gi|197089406|gb|ACH40677.1| magnesium chelatase, ChlI subunit [Geobacter bemidjiensis Bem]
          Length = 232

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ + A  GI  I ++V+V ++ G   +  VGLPD AV ES++R+++   ++G  F 
Sbjct: 1  MLAKVLSSALVGIDAILIDVEVDIAQGLPQLATVGLPDNAVKESKDRVKAALKNSGYDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     D+
Sbjct: 60 ----PNRKITVNLAPADV 73


>gi|126176228|ref|YP_001052377.1| Mg chelatase subunit ChlI [Shewanella baltica OS155]
 gi|125999433|gb|ABN63508.1| Mg chelatase, subunit ChlI [Shewanella baltica OS155]
          Length = 508

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I+ ++T A  G++   V V+V +S G     +VGLP+ +V E+RER++S  I+AG     
Sbjct: 3  IACVNTRASCGVEAPQVTVEVHLSNGLPAFNLVGLPEASVKEARERVRSALINAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPMRRITVNLAPADL 74


>gi|89074749|ref|ZP_01161207.1| Putative ComM-related protein [Photobacterium sp. SKA34]
 gi|89049513|gb|EAR55074.1| Putative ComM-related protein [Photobacterium sp. SKA34]
          Length = 508

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+   PV V+V +S G     +VGLP+  V E+++R++S  I+A      
Sbjct: 3  LAIVHSRACVGVHAPPVTVEVHLSNGLPSFTLVGLPETTVKEAKDRVRSAIINANF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E PS  + +     DL
Sbjct: 59 -EFPSRRITVNLAPADL 74


>gi|309796292|ref|ZP_07690702.1| Mg chelatase-like protein [Escherichia coli MS 145-7]
 gi|308120174|gb|EFO57436.1| Mg chelatase-like protein [Escherichia coli MS 145-7]
          Length = 516

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 13 LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 68

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 69 -EYPAKKITINLAPADL 84


>gi|238765135|ref|ZP_04626068.1| hypothetical protein ykris0001_17020 [Yersinia kristensenii ATCC
          33638]
 gi|238696625|gb|EEP89409.1| hypothetical protein ykris0001_17020 [Yersinia kristensenii ATCC
          33638]
          Length = 507

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  GI+   V V+V +S G  G+ +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 3  LATIHTRAILGIQAPAVTVEVHISNGLPGLVLVGLPETTVKEARDRVRSALINSGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVSLAPADL 74


>gi|300930073|ref|ZP_07145501.1| Mg chelatase-like protein [Escherichia coli MS 187-1]
 gi|300462024|gb|EFK25517.1| Mg chelatase-like protein [Escherichia coli MS 187-1]
          Length = 516

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 13 LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 68

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 69 -EYPAKKITINLAPADL 84


>gi|153002518|ref|YP_001368199.1| Mg chelatase subunit ChlI [Shewanella baltica OS185]
 gi|151367136|gb|ABS10136.1| Mg chelatase, subunit ChlI [Shewanella baltica OS185]
          Length = 508

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I+ ++T A  G++   V V+V +S G     +VGLP+ +V E+RER++S  I+AG     
Sbjct: 3  IACVNTRASCGVEAPQVTVEVHLSNGLPAFNLVGLPEASVKEARERVRSALINAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPMRRITVNLAPADL 74


>gi|94502066|ref|ZP_01308571.1| Mg chelatase-related protein [Oceanobacter sp. RED65]
 gi|94425820|gb|EAT10823.1| Mg chelatase-related protein [Oceanobacter sp. RED65]
          Length = 501

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ +   A  GI    V+V+  +S G     IVGLP+ AV ES++R++S  ++AG     
Sbjct: 3  LAVVHARAKVGIDAPLVQVETHLSNGLPSFSIVGLPETAVKESKDRVRSAILNAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P++ + +     DL
Sbjct: 59 -EFPAMRITVNLAPADL 74


>gi|323493800|ref|ZP_08098918.1| ATPase [Vibrio brasiliensis LMG 20546]
 gi|323311934|gb|EGA65080.1| ATPase [Vibrio brasiliensis LMG 20546]
          Length = 507

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+V +S G  G  +VGLP+  V ESR+R++S  +++      
Sbjct: 3  LAIVHSRACVGVEAPSVTVEVHISNGMPGFCLVGLPETTVKESRDRVRSAIVNSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPPKRITVNLAPADL 74


>gi|304412207|ref|ZP_07393816.1| Mg chelatase, subunit ChlI [Shewanella baltica OS183]
 gi|307306951|ref|ZP_07586691.1| Mg chelatase, subunit ChlI [Shewanella baltica BA175]
 gi|304349473|gb|EFM13882.1| Mg chelatase, subunit ChlI [Shewanella baltica OS183]
 gi|306910529|gb|EFN40959.1| Mg chelatase, subunit ChlI [Shewanella baltica BA175]
          Length = 508

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I+ ++T A  G++   V V+V +S G     +VGLP+ +V E+RER++S  I+AG     
Sbjct: 3  IACVNTRASCGVEAPQVTVEVHLSNGLPAFNLVGLPEASVKEARERVRSALINAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPMRRITVNLAPADL 74


>gi|90416393|ref|ZP_01224325.1| competence protein ComM [marine gamma proteobacterium HTCC2207]
 gi|90332118|gb|EAS47332.1| competence protein ComM [marine gamma proteobacterium HTCC2207]
          Length = 521

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ ++T A  GI    V ++V +S G     +VGLP+ AV ES++R++S  +++   F  
Sbjct: 3  LAAVNTRAKLGINAPLVSIEVHLSNGLPSFHMVGLPETAVKESKDRVRSAILNSHFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     +L
Sbjct: 61 ---PARRITVNLAPAEL 74


>gi|300947381|ref|ZP_07161575.1| Mg chelatase-like protein [Escherichia coli MS 116-1]
 gi|300955233|ref|ZP_07167627.1| Mg chelatase-like protein [Escherichia coli MS 175-1]
 gi|300317852|gb|EFJ67636.1| Mg chelatase-like protein [Escherichia coli MS 175-1]
 gi|300453016|gb|EFK16636.1| Mg chelatase-like protein [Escherichia coli MS 116-1]
          Length = 516

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 13 LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 68

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 69 -EYPAKKITINLAPADL 84


>gi|218556329|ref|YP_002389243.1| putative ATP-dependent protease [Escherichia coli IAI1]
 gi|218697484|ref|YP_002405151.1| putative ATP-dependent protease [Escherichia coli 55989]
 gi|300825278|ref|ZP_07105362.1| Mg chelatase-like protein [Escherichia coli MS 119-7]
 gi|300904016|ref|ZP_07121899.1| Mg chelatase-like protein [Escherichia coli MS 84-1]
 gi|301303661|ref|ZP_07209782.1| Mg chelatase-like protein [Escherichia coli MS 124-1]
 gi|331679874|ref|ZP_08380537.1| Mg chelatase-like protein [Escherichia coli H591]
 gi|218354216|emb|CAV00862.1| putative bifunctional enzyme and transcriptional regulator
          [Escherichia coli 55989]
 gi|218363098|emb|CAR00738.1| putative bifunctional enzyme and transcriptional regulator
          [Escherichia coli IAI1]
 gi|300404003|gb|EFJ87541.1| Mg chelatase-like protein [Escherichia coli MS 84-1]
 gi|300522243|gb|EFK43312.1| Mg chelatase-like protein [Escherichia coli MS 119-7]
 gi|300840961|gb|EFK68721.1| Mg chelatase-like protein [Escherichia coli MS 124-1]
 gi|315254130|gb|EFU34098.1| Mg chelatase-like protein [Escherichia coli MS 85-1]
 gi|324016162|gb|EGB85381.1| Mg chelatase-like protein [Escherichia coli MS 117-3]
 gi|331072421|gb|EGI43753.1| Mg chelatase-like protein [Escherichia coli H591]
          Length = 516

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 13 LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 68

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 69 -EYPAKKITINLAPADL 84


>gi|238759835|ref|ZP_04620992.1| hypothetical protein yaldo0001_670 [Yersinia aldovae ATCC 35236]
 gi|238701978|gb|EEP94538.1| hypothetical protein yaldo0001_670 [Yersinia aldovae ATCC 35236]
          Length = 507

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  GI+  PV V+V +S G  G+ +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 3  LAIIHTRATLGIQAPPVTVEVHISNGLPGLVLVGLPETTVKEARDRVRSALINSGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVSLAPADL 74


>gi|300921529|ref|ZP_07137872.1| Mg chelatase-like protein [Escherichia coli MS 115-1]
 gi|300411563|gb|EFJ94873.1| Mg chelatase-like protein [Escherichia coli MS 115-1]
          Length = 516

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 13 LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 68

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 69 -EYPAKKITINLAPADL 84


>gi|331655451|ref|ZP_08356444.1| Mg chelatase-like protein [Escherichia coli M718]
 gi|331046772|gb|EGI18856.1| Mg chelatase-like protein [Escherichia coli M718]
          Length = 516

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 13 LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 68

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 69 -EYPAKKITINLAPADL 84


>gi|90581163|ref|ZP_01236962.1| Putative ComM-related protein [Vibrio angustum S14]
 gi|90437684|gb|EAS62876.1| Putative ComM-related protein [Vibrio angustum S14]
          Length = 312

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++  PV V+V +S G     +VGLP+  V E+++R++S  I+A      
Sbjct: 3  LAIVHSRACVGVQAPPVTVEVHLSNGLPSFTLVGLPETTVKEAKDRVRSAIINANF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E PS  + +     DL
Sbjct: 59 -EFPSRRITVNLAPADL 74


>gi|326791407|ref|YP_004309228.1| Mg chelatase, subunit ChlI [Clostridium lentocellum DSM 5427]
 gi|326542171|gb|ADZ84030.1| Mg chelatase, subunit ChlI [Clostridium lentocellum DSM 5427]
          Length = 503

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  ++++ +  GI  +P+EV++ +  G  G  IVGLPD AV E++ER++S   ++G  F 
Sbjct: 1  MFCKLNSYSLNGIDALPIEVEIDLHDGLPGFDIVGLPDSAVKEAKERVKSAIKNSGYKF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P  ++ +     D+
Sbjct: 60 ----PICHITVNLAPADI 73


>gi|121533782|ref|ZP_01665609.1| Mg chelatase, subunit ChlI [Thermosinus carboxydivorans Nor1]
 gi|121307773|gb|EAX48688.1| Mg chelatase, subunit ChlI [Thermosinus carboxydivorans Nor1]
          Length = 508

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M ++       GI G+ + V+V ++ G  G+ IVGLPD AV ESRER+++   +AG    
Sbjct: 1  MYAQTFGSTTLGINGVVITVEVDIANGIPGLDIVGLPDAAVRESRERVRAAIKNAGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P+  + +     DL
Sbjct: 58 --EFPARRITVNLAPADL 73


>gi|163748605|ref|ZP_02155858.1| magnesium chelatase family protein [Shewanella benthica KT99]
 gi|161331715|gb|EDQ02519.1| magnesium chelatase family protein [Shewanella benthica KT99]
          Length = 507

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I+ ++T A +G+   PV V+V +S G     +VGLP+ +V E++ER++S  I+AG     
Sbjct: 3  IACVATRANKGVDAPPVTVEVHLSNGLPAFNLVGLPETSVKEAKERVRSAIINAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPMRRITVNLAPADL 74


>gi|283834539|ref|ZP_06354280.1| Mg chelatase-like protein [Citrobacter youngae ATCC 29220]
 gi|291069669|gb|EFE07778.1| Mg chelatase-like protein [Citrobacter youngae ATCC 29220]
          Length = 506

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+    + ++V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPAITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITINLAPADL 74


>gi|261378437|ref|ZP_05983010.1| Mg chelatase-like protein [Neisseria cinerea ATCC 14685]
 gi|269145215|gb|EEZ71633.1| Mg chelatase-like protein [Neisseria cinerea ATCC 14685]
          Length = 498

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G  F  
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKKITVNLAPADL 74


>gi|300818764|ref|ZP_07098971.1| Mg chelatase-like protein [Escherichia coli MS 107-1]
 gi|300528730|gb|EFK49792.1| Mg chelatase-like protein [Escherichia coli MS 107-1]
          Length = 516

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 13 LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 68

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 69 -EYPAKKITINLAPADL 84


>gi|237809794|ref|YP_002894234.1| Mg chelatase, subunit ChlI [Tolumonas auensis DSM 9187]
 gi|237502055|gb|ACQ94648.1| Mg chelatase, subunit ChlI [Tolumonas auensis DSM 9187]
          Length = 506

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  GI    V V+V +S G     +VGLP+ +V ESR+R++S  I+       
Sbjct: 3  LAVVYSRASLGIDAPLVSVEVHLSNGLPAFNMVGLPEASVKESRDRVRSALINGNF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKRITVNLAPADL 74


>gi|255066114|ref|ZP_05317969.1| Mg chelatase-like protein [Neisseria sicca ATCC 29256]
 gi|255049659|gb|EET45123.1| Mg chelatase-like protein [Neisseria sicca ATCC 29256]
          Length = 498

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G  F  
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKKITVNLAPADL 74


>gi|237727891|ref|ZP_04558372.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226910340|gb|EEH96258.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 518

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+    + ++V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 15 LSIVHTRAALGVNAPAITIEVHISNGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 70

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 71 -EFPAKKITINLAPADL 86


>gi|209693672|ref|YP_002261600.1| putative competence protein [Aliivibrio salmonicida LFI1238]
 gi|208007623|emb|CAQ77727.1| putative competence protein [Aliivibrio salmonicida LFI1238]
          Length = 508

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V V+V +S G  G  +VGLP+  V E+++R++S  I++      
Sbjct: 3  LAIIHSRACVGVEAPEVTVEVHISNGMPGFNLVGLPETTVKEAKDRVRSAIINSNF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E PS  + +     DL
Sbjct: 59 -EFPSKKITVNLAPADL 74


>gi|332159769|ref|YP_004296346.1| putative magnesium chelatase family protein [Yersinia
          enterocolitica subsp. palearctica 105.5R(r)]
 gi|318607693|emb|CBY29191.1| Mg(2+) CHELATASE FAMILY protein; ComM-related protein [Yersinia
          enterocolitica subsp. palearctica Y11]
 gi|325663999|gb|ADZ40643.1| putative magnesium chelatase family protein [Yersinia
          enterocolitica subsp. palearctica 105.5R(r)]
          Length = 507

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  GI+   V V+V +S G  G+ +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 3  LATIYTRATLGIQAPSVTVEVHISNGLPGLVLVGLPETTVKEARDRVRSALINSGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVSLAPADL 74


>gi|118498226|ref|YP_899276.1| magnesium chelatase [Francisella tularensis subsp. novicida U112]
 gi|194324410|ref|ZP_03058183.1| putative Mg chelatase-like protein [Francisella tularensis subsp.
          novicida FTE]
 gi|118424132|gb|ABK90522.1| magnesium chelatase [Francisella novicida U112]
 gi|194321475|gb|EDX18960.1| putative Mg chelatase-like protein [Francisella tularensis subsp.
          novicida FTE]
          Length = 502

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  GI+   V ++V +S G  G+ IVGLP+ AV ES++R++S  I++G  F  
Sbjct: 3  LAVLKSRAQLGIEAPLVCIEVHLSNGLPGLSIVGLPEAAVKESKDRVRSAIINSGFNF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PNKRITINLAPADL 74


>gi|208780253|ref|ZP_03247595.1| putative Mg chelatase like protein [Francisella novicida FTG]
 gi|208743902|gb|EDZ90204.1| putative Mg chelatase like protein [Francisella novicida FTG]
          Length = 502

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  GI+   V ++V +S G  G+ IVGLP+ AV ES++R++S  I++G  F  
Sbjct: 3  LAVLKSRAQLGIEAPLVCIEVHLSNGLPGLSIVGLPEAAVKESKDRVRSAIINSGFNF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PNKRITINLAPADL 74


>gi|114561605|ref|YP_749118.1| Mg chelatase, subunit ChlI [Shewanella frigidimarina NCIMB 400]
 gi|114332898|gb|ABI70280.1| Mg chelatase, subunit ChlI [Shewanella frigidimarina NCIMB 400]
          Length = 507

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I+ + T A  G++   V V+V +S G     +VGLP+ +V E++ER++S  I+AG     
Sbjct: 3  IACVFTRASCGVEAPRVTVEVHLSNGLPAFNLVGLPETSVKEAKERVRSALINAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPQKRITVNLAPADL 74


>gi|282850259|ref|ZP_06259638.1| Mg chelatase-like protein [Veillonella parvula ATCC 17745]
 gi|282579752|gb|EFB85156.1| Mg chelatase-like protein [Veillonella parvula ATCC 17745]
          Length = 565

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +++      GI G  + V+V +S G     IVGLP+++V E+RER+++   ++G    
Sbjct: 1  MYAKLYGATLHGIDGCIITVEVDISQGLPVFDIVGLPNQSVKEARERVRAAIKNSGY--- 57

Query: 61 VNELPSIYLQLIYQKK 76
            E P   + +     
Sbjct: 58 --EFPMRRIVVNLAPA 71


>gi|156935901|ref|YP_001439817.1| hypothetical protein ESA_03789 [Cronobacter sakazakii ATCC BAA-894]
 gi|156534155|gb|ABU78981.1| hypothetical protein ESA_03789 [Cronobacter sakazakii ATCC BAA-894]
          Length = 546

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2   ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           +S I T A  G+K   V V+V +S G  G+ IVGLP+  V E+R+R++S  I++G     
Sbjct: 43  LSVIHTRAALGVKAPLVTVEVHISAGLPGLTIVGLPETTVKEARDRVRSALINSGY---- 98

Query: 62  NELPSIYLQLIYQKKDL 78
            E P+  + +     DL
Sbjct: 99  -EFPAKKITINLAPADL 114


>gi|254375034|ref|ZP_04990514.1| hypothetical protein FTDG_01222 [Francisella novicida GA99-3548]
 gi|151572752|gb|EDN38406.1| hypothetical protein FTDG_01222 [Francisella novicida GA99-3548]
          Length = 502

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  GI+   V ++V +S G  G+ IVGLP+ AV ES++R++S  I++G  F  
Sbjct: 3  LAVLKSRAQLGIEAPLVCIEVHLSNGLPGLSIVGLPEAAVKESKDRVRSAIINSGFNF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PNKRITINLAPADL 74


>gi|262166802|ref|ZP_06034539.1| ComM-related protein [Vibrio mimicus VM223]
 gi|262026518|gb|EEY45186.1| ComM-related protein [Vibrio mimicus VM223]
          Length = 517

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V V+V +S G  G  +VGLP+  V ESR+R++S  I++      
Sbjct: 13 LAIIHSRASIGVQAPSVTVEVHISNGMPGFTLVGLPETTVKESRDRVRSAIINSRF---- 68

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 69 -EFPAKRITVNLAPADL 84


>gi|332678962|gb|AEE88091.1| MG(2+) chelatase family protein / ComM-related protein
          [Francisella cf. novicida Fx1]
          Length = 502

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  GI+   V ++V +S G  G+ IVGLP+ AV ES++R++S  I++G  F  
Sbjct: 3  LAVLKSRAQLGIEAPLVCIEVHLSNGLPGLSIVGLPEAAVKESKDRVRSAIINSGFNF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PNKRITINLAPADL 74


>gi|238750636|ref|ZP_04612135.1| hypothetical protein yrohd0001_8910 [Yersinia rohdei ATCC 43380]
 gi|238711026|gb|EEQ03245.1| hypothetical protein yrohd0001_8910 [Yersinia rohdei ATCC 43380]
          Length = 507

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  GI+   V V+V +S G  G+ +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 3  LATIHTRATLGIQAPSVTVEVHISNGLPGLILVGLPETTVKEARDRVRSALINSGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVSLAPADL 74


>gi|123440545|ref|YP_001004539.1| putative magnesium chelatase family protein [Yersinia
          enterocolitica subsp. enterocolitica 8081]
 gi|122087506|emb|CAL10287.1| putative magnesium chelatase family protein [Yersinia
          enterocolitica subsp. enterocolitica 8081]
          Length = 507

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  GI+   V V+V +S G  G+ +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 3  LATIYTRATLGIQAPSVTVEVHISNGLPGLVLVGLPETTVKEARDRVRSALINSGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVSLAPADL 74


>gi|15676318|ref|NP_273454.1| competence protein ComM [Neisseria meningitidis MC58]
 gi|7225627|gb|AAF40844.1| competence protein ComM [Neisseria meningitidis MC58]
 gi|316984911|gb|EFV63867.1| competence protein comM [Neisseria meningitidis H44/76]
 gi|325140920|gb|EGC63427.1| Mg chelatase [Neisseria meningitidis CU385]
 gi|325199594|gb|ADY95049.1| Mg chelatase [Neisseria meningitidis H44/76]
          Length = 498

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDMEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITVNLAPADL 74


>gi|294791911|ref|ZP_06757059.1| Mg chelatase-like protein [Veillonella sp. 6_1_27]
 gi|294457141|gb|EFG25503.1| Mg chelatase-like protein [Veillonella sp. 6_1_27]
          Length = 565

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +++      GI G  + V+V +S G     IVGLP+++V E+RER+++   ++G    
Sbjct: 1  MYAKLYGATLHGIDGCIITVEVDISQGLPVFDIVGLPNQSVKEARERVRAAIKNSGY--- 57

Query: 61 VNELPSIYLQLIYQKK 76
            E P   + +     
Sbjct: 58 --EFPMRRIVVNLAPA 71


>gi|320154870|ref|YP_004187249.1| Mg(2+) chelatase family protein/ComM-related protein [Vibrio
          vulnificus MO6-24/O]
 gi|319930182|gb|ADV85046.1| MG(2+) chelatase family protein / ComM-related protein [Vibrio
          vulnificus MO6-24/O]
          Length = 507

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V V+V +S G  G  +VGLP+  V ES++R++S  +++   F  
Sbjct: 3  LAIIHSRASVGVEAPSVSVEVHISNGLPGFTLVGLPETTVKESKDRVRSAIVNSNFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|149912046|ref|ZP_01900638.1| ComM-related protein [Moritella sp. PE36]
 gi|149804874|gb|EDM64910.1| ComM-related protein [Moritella sp. PE36]
          Length = 505

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  GI    + ++V +S G  G  IVGLP+ +V E+++R++S  +++  +   
Sbjct: 3  LAVIYSRAILGINAPLITIEVHISEGLPGFTIVGLPETSVKEAKDRVRSALMNSNFV--- 59

Query: 62 NELPSIYLQLIYQKKDL 78
            +P+  + +     DL
Sbjct: 60 --MPAKRITVNLGPADL 74


>gi|294793771|ref|ZP_06758908.1| Mg chelatase-like protein [Veillonella sp. 3_1_44]
 gi|294455341|gb|EFG23713.1| Mg chelatase-like protein [Veillonella sp. 3_1_44]
          Length = 565

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +++      GI G  + V+V +S G     IVGLP+++V E+RER+++   ++G    
Sbjct: 1  MYAKLYGATLHGIDGCIITVEVDISQGLPVFDIVGLPNQSVKEARERVRAAIKNSGY--- 57

Query: 61 VNELPSIYLQLIYQKK 76
            E P   + +     
Sbjct: 58 --EFPMRRIVVNLAPA 71


>gi|54310630|ref|YP_131650.1| putative ComM-related protein [Photobacterium profundum SS9]
 gi|46915073|emb|CAG21848.1| Putative ComM-related protein [Photobacterium profundum SS9]
          Length = 510

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V +S G     +VGLP+  V E+R+R++S  ++A      
Sbjct: 3  LAIVHSRACVGVDAPAVTVEVHLSNGMPAFNLVGLPETTVKEARDRVRSAIVNANF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E PS  L +     DL
Sbjct: 59 -EFPSKRLTVNLAPADL 74


>gi|37681423|ref|NP_936032.1| ComM-related protein [Vibrio vulnificus YJ016]
 gi|37200175|dbj|BAC96003.1| ComM-related protein [Vibrio vulnificus YJ016]
          Length = 508

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V V+V +S G  G  +VGLP+  V ES++R++S  +++   F  
Sbjct: 4  LAIIHSRASVGVEAPSVSVEVHISNGLPGFTLVGLPETTVKESKDRVRSAIVNSNFQF-- 61

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 62 ---PAKRITVNLAPADL 75


>gi|238022645|ref|ZP_04603071.1| hypothetical protein GCWU000324_02554 [Kingella oralis ATCC
          51147]
 gi|237865848|gb|EEP66984.1| hypothetical protein GCWU000324_02554 [Kingella oralis ATCC
          51147]
          Length = 496

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           S +++ A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  + +G  F  
Sbjct: 3  FSVVNSRALSGMDAPLVEVETHLANGLPQFNIVGLPDTEVKESRDRVRAAILQSGFAF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAQKITVNLAPADL 74


>gi|329119674|ref|ZP_08248355.1| competence protein ComM [Neisseria bacilliformis ATCC BAA-1200]
 gi|327464271|gb|EGF10575.1| competence protein ComM [Neisseria bacilliformis ATCC BAA-1200]
          Length = 496

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           + + + A  G    PVEV+  ++ G     IVGLPD  V ESR+R+++  I +G     
Sbjct: 3  FAVVHSRALAGANAPPVEVETHLANGLPQFNIVGLPDTEVKESRDRVRAAIIQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITVNLAPADL 74


>gi|163803333|ref|ZP_02197211.1| predicted kinase [Vibrio sp. AND4]
 gi|159172903|gb|EDP57742.1| predicted kinase [Vibrio sp. AND4]
          Length = 507

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V V+V +S G  G  +VGLP+  V ES++R++S  +++   F  
Sbjct: 3  LAIIYSRASVGVQAPSVSVEVHISNGMPGFTLVGLPETTVKESKDRVRSAIVNSNFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|304397988|ref|ZP_07379864.1| Mg chelatase, subunit ChlI [Pantoea sp. aB]
 gi|304354699|gb|EFM19070.1| Mg chelatase, subunit ChlI [Pantoea sp. aB]
          Length = 506

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S++ T A  G++   V ++  +S G   + +VGLP+  V E+RER++S  I++G  F  
Sbjct: 3  LSKVLTRAALGVEAPLVTIEAHISNGLPALTLVGLPETTVKEARERVRSAIINSGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRVTINLAPADL 74


>gi|290968767|ref|ZP_06560304.1| Mg chelatase-like protein [Megasphaera genomosp. type_1 str. 28L]
 gi|290781063|gb|EFD93654.1| Mg chelatase-like protein [Megasphaera genomosp. type_1 str. 28L]
          Length = 505

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +RI      G++G  + V+  +  G    +IVGL   AV ES+ER++S   ++G    
Sbjct: 1  MFARIYGSTILGLQGNIITVETDIGNGLPSFEIVGLATTAVKESKERVRSALKNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     DL
Sbjct: 58 --EFPMRRITINLAPADL 73


>gi|269798031|ref|YP_003311931.1| Mg chelatase, subunit ChlI [Veillonella parvula DSM 2008]
 gi|269094660|gb|ACZ24651.1| Mg chelatase, subunit ChlI [Veillonella parvula DSM 2008]
          Length = 568

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +++      GI G  + V+V +S G     IVGLP+++V E+RER+++   ++G    
Sbjct: 1  MYAKLYGATLHGIDGCIITVEVDISQGLPVFDIVGLPNQSVKEARERVRAAIKNSGY--- 57

Query: 61 VNELPSIYLQLIYQKK 76
            E P   + +     
Sbjct: 58 --EFPMRRIVVNLAPA 71


>gi|251778347|ref|ZP_04821267.1| Mg chelatase-related protein [Clostridium botulinum E1 str. 'BoNT
          E Beluga']
 gi|243082662|gb|EES48552.1| Mg chelatase-related protein [Clostridium botulinum E1 str. 'BoNT
          E Beluga']
          Length = 219

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  +I +    G++G+ +EV+V +S G     IVGL D +V ES+ER++S  +++G  F 
Sbjct: 1  MSIKIISATQNGLEGLLIEVEVDISKGLPSFSIVGLADTSVKESKERVRSAILNSGYDF- 59

Query: 61 VNELPSIYLQLIYQKKD 77
              P   + +     D
Sbjct: 60 ----PLGRITINLAPAD 72


>gi|327395706|dbj|BAK13128.1| Mg chelatase-related protein YifB [Pantoea ananatis AJ13355]
          Length = 506

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S++ T A  G++   V ++V +S G   + +VGLP+  V E+RER++S  I++G  F  
Sbjct: 3  LSKVLTRAAIGVEAPLVTIEVHISNGLPALTLVGLPETTVKEARERVRSAIINSGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PARRITINLGPADL 74


>gi|308188579|ref|YP_003932710.1| Competence protein comM [Pantoea vagans C9-1]
 gi|308059089|gb|ADO11261.1| Competence protein comM [Pantoea vagans C9-1]
          Length = 507

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S++ T A  G++   V ++  +S G   + +VGLP+  V E+RER++S  I++G  F  
Sbjct: 3  LSKVLTRAALGVEAPLVTIEAHISNGLPALTLVGLPETTVKEARERVRSAIINSGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRVTINLAPADL 74


>gi|315284683|gb|EFU44128.1| Mg chelatase-like protein [Escherichia coli MS 110-3]
          Length = 516

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  + E+R+R++S  I++G     
Sbjct: 13 LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTLKEARDRVRSAIINSGY---- 68

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 69 -EYPAKKITINLAPADL 84


>gi|291619383|ref|YP_003522125.1| YifB [Pantoea ananatis LMG 20103]
 gi|291154413|gb|ADD78997.1| YifB [Pantoea ananatis LMG 20103]
          Length = 510

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S++ T A  G++   V ++V +S G   + +VGLP+  V E+RER++S  I++G  F  
Sbjct: 7  LSKVLTRAAIGVEAPLVTIEVHISNGLPALTLVGLPETTVKEARERVRSAIINSGFDF-- 64

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 65 ---PARRITINLGPADL 78


>gi|153954036|ref|YP_001394801.1| hypothetical protein CKL_1411 [Clostridium kluyveri DSM 555]
 gi|219854650|ref|YP_002471772.1| hypothetical protein CKR_1307 [Clostridium kluyveri NBRC 12016]
 gi|146346917|gb|EDK33453.1| Conserved hypothetical protein [Clostridium kluyveri DSM 555]
 gi|219568374|dbj|BAH06358.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 505

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  +I+T +F GI+G  + V+V V  G     IVGL D +V ES+ER+++  I++G    
Sbjct: 1  MAIKINTASFLGIEGNIISVEVDVKRGFPSFNIVGLADTSVKESKERVRTSIINSGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     D+
Sbjct: 58 --EFPVKKITVNLAPADI 73


>gi|192359858|ref|YP_001983848.1| Mg chelatase-like protein [Cellvibrio japonicus Ueda107]
 gi|190686023|gb|ACE83701.1| Mg chelatase homolog [Cellvibrio japonicus Ueda107]
          Length = 537

 Score =  113 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2   ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           ++ I + A  GI    V V+V +S G  G+ IVGLP+ AV ES++R++S  +++ L    
Sbjct: 40  LAIIFSRAKLGINAPQVTVEVHLSNGLPGLSIVGLPETAVKESKDRVRSAILNSHL---- 95

Query: 62  NELPSIYLQLIYQKKDL 78
            E P+  + +     DL
Sbjct: 96  -EFPARRITVNLAPADL 111


>gi|160877238|ref|YP_001556554.1| Mg chelatase subunit ChlI [Shewanella baltica OS195]
 gi|160862760|gb|ABX51294.1| Mg chelatase, subunit ChlI [Shewanella baltica OS195]
 gi|315269443|gb|ADT96296.1| Mg chelatase, subunit ChlI [Shewanella baltica OS678]
          Length = 508

 Score =  113 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I+ ++T A  G++   V V+V +S G     +VGLP+ +V E+RER++S   +AG     
Sbjct: 3  IACVNTRASCGVEAPQVTVEVHLSNGLPAFNLVGLPEASVKEARERVRSALFNAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPMRRITVNLAPADL 74


>gi|302874645|ref|YP_003843278.1| Mg chelatase, subunit ChlI [Clostridium cellulovorans 743B]
 gi|302577502|gb|ADL51514.1| Mg chelatase, subunit ChlI [Clostridium cellulovorans 743B]
          Length = 505

 Score =  113 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M   +++  F GI G+ V+V+V +S G     IVGL   AV E++ER++S  +++G    
Sbjct: 1  MSVNLNSATFNGIDGVIVQVEVDISRGLPSFTIVGLATTAVKEAKERVRSAIVNSGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     D+
Sbjct: 58 --EFPMGRIVINLSPADI 73


>gi|331005815|ref|ZP_08329172.1| Mg(2+) chelatase family protein [gamma proteobacterium IMCC1989]
 gi|330420376|gb|EGG94685.1| Mg(2+) chelatase family protein [gamma proteobacterium IMCC1989]
          Length = 497

 Score =  113 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S I T A +GI    + V+V +S G  G+ IVG+P+  V ES++R++S  I++      
Sbjct: 3  LSIIYTRARRGIDAPLITVEVHLSNGLPGLSIVGMPETVVKESKDRVRSALINSQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITINLAPADL 74


>gi|313892677|ref|ZP_07826260.1| Mg chelatase-like protein [Veillonella sp. oral taxon 158 str.
          F0412]
 gi|313442768|gb|EFR61177.1| Mg chelatase-like protein [Veillonella sp. oral taxon 158 str.
          F0412]
          Length = 526

 Score =  113 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +++      GI G  + V+V +S G     IVGLP+++V E+RER+++   ++G  F 
Sbjct: 1  MYAKLYGATLHGIDGCIITVEVDISQGLPVFDIVGLPNQSVKEARERVRAAIKNSGYDF- 59

Query: 61 VNELPSIYLQLIYQKK 76
              P   + +     
Sbjct: 60 ----PMRRIVVNLAPA 71


>gi|323934159|gb|EGB30590.1| magnesium chelatase [Escherichia coli E1520]
          Length = 402

 Score =  113 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 13 LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 68

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 69 -EYPAKKITINLAPADL 84


>gi|217975086|ref|YP_002359837.1| Mg chelatase subunit ChlI [Shewanella baltica OS223]
 gi|217500221|gb|ACK48414.1| Mg chelatase, subunit ChlI [Shewanella baltica OS223]
          Length = 508

 Score =  113 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I+ ++T A  G++   V V+V +S G     +VGLP+ +V E+RER++S  I+AG     
Sbjct: 3  IACVNTRASCGVEAPQVTVEVHLSNGLPAFSLVGLPEASVKEARERVRSALINAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPMRRITVNLAPADL 74


>gi|156972744|ref|YP_001443651.1| ATPase [Vibrio harveyi ATCC BAA-1116]
 gi|156524338|gb|ABU69424.1| hypothetical protein VIBHAR_00409 [Vibrio harveyi ATCC BAA-1116]
          Length = 507

 Score =  113 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V V+V +S G  G  +VGLP+  V ES++R++S  +++   F  
Sbjct: 3  LAIIHSRASVGVQAPSVSVEVHISNGMPGFTLVGLPETTVKESKDRVRSAIVNSNFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|27364466|ref|NP_759994.1| Mg(2+) chelatase family protein [Vibrio vulnificus CMCP6]
 gi|27360585|gb|AAO09521.1| MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein [Vibrio
          vulnificus CMCP6]
          Length = 507

 Score =  113 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V V+V +S G  G  +VGLP+  V ES++R++S  +++   F  
Sbjct: 3  LAIIHSRASVGVEAPSVSVEVHISNGLPGFTLVGLPETTVKESKDRVRSAIVNSNFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|153834313|ref|ZP_01986980.1| putative Mg chelatase homolog [Vibrio harveyi HY01]
 gi|148869321|gb|EDL68335.1| putative Mg chelatase homolog [Vibrio harveyi HY01]
          Length = 507

 Score =  113 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V V+V +S G  G  +VGLP+  V ES++R++S  +++   F  
Sbjct: 3  LAIIHSRASVGVQAPSVSVEVHISNGMPGFTLVGLPETTVKESKDRVRSAIVNSNFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|288937806|ref|YP_003441865.1| Mg chelatase, subunit ChlI [Klebsiella variicola At-22]
 gi|288892515|gb|ADC60833.1| Mg chelatase, subunit ChlI [Klebsiella variicola At-22]
          Length = 506

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  GI+   + ++V +S G  G+ +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 3  LAIVYTRAALGIEAPLITIEVHLSSGLPGLTMVGLPETTVKEARDRVRSALINSGYAF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKKITINLAPADL 74


>gi|308273132|emb|CBX29735.1| Competence protein comM [uncultured Desulfobacterium sp.]
          Length = 509

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ + + A  GI   PVEV+V ++ G      VGLP+ +V ESRER++S   ++G  F 
Sbjct: 1  MLAMVLSSAVIGIDAYPVEVEVDIAKGLPSFTTVGLPEASVKESRERVKSAIANSGYFF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +      +
Sbjct: 60 ----PDDRITVNLAPASI 73


>gi|294670593|ref|ZP_06735472.1| hypothetical protein NEIELOOT_02316 [Neisseria elongata subsp.
          glycolytica ATCC 29315]
 gi|291307718|gb|EFE48961.1| hypothetical protein NEIELOOT_02316 [Neisseria elongata subsp.
          glycolytica ATCC 29315]
          Length = 500

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           S +++ A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G  F  
Sbjct: 3  FSLVNSRALYGMDAPLVEVETHLANGLPAFNIVGLPDTEVKESRDRVRAAIIQSGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKKITVNLAPADL 74


>gi|261856966|ref|YP_003264249.1| Mg chelatase, subunit ChlI [Halothiobacillus neapolitanus c2]
 gi|261837435|gb|ACX97202.1| Mg chelatase, subunit ChlI [Halothiobacillus neapolitanus c2]
          Length = 503

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I+++ + A  GI    V V+  V+ G   + +VGL + AV ESR+R+++  + +G     
Sbjct: 3  IAKVYSRAQVGIDAPLVTVEAHVTNGLPAITLVGLAETAVRESRDRVRAAILSSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   L +     DL
Sbjct: 59 -EFPPKRLTINLAPADL 74


>gi|312882727|ref|ZP_07742462.1| competence protein ComM [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309369585|gb|EFP97102.1| competence protein ComM [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 507

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V V+V +  G  G  +VGLP+  V ESR+R++S  I++      
Sbjct: 3  LAIIYSRACIGVEAPQVAVEVHIGNGMPGFTLVGLPETTVKESRDRVRSALINSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKRITVNLAPADL 74


>gi|290513202|ref|ZP_06552564.1| Mg chelatase [Klebsiella sp. 1_1_55]
 gi|289774413|gb|EFD82419.1| Mg chelatase [Klebsiella sp. 1_1_55]
          Length = 506

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  GI+   + ++V +S G  G+ +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 3  LAIVYTRAALGIEAPLITIEVHLSSGLPGLTMVGLPETTVKEARDRVRSALINSGYAF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKKITINLAPADL 74


>gi|90413766|ref|ZP_01221754.1| Putative ComM-related protein [Photobacterium profundum 3TCK]
 gi|90325235|gb|EAS41732.1| Putative ComM-related protein [Photobacterium profundum 3TCK]
          Length = 510

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V +S G     +VGLP+  V E+R+R++S  ++A      
Sbjct: 3  LAIVHSRACVGVDAPAVTVEVHLSNGMPAFNLVGLPETTVKEARDRVRSAIVNANF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E PS  L +     DL
Sbjct: 59 -EFPSKRLTVNLAPADL 74


>gi|73539994|ref|YP_294514.1| Mg chelatase-related protein [Ralstonia eutropha JMP134]
 gi|72117407|gb|AAZ59670.1| Mg chelatase-related protein [Ralstonia eutropha JMP134]
          Length = 513

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  GI+  PV V+  ++ G     IVGL D  V ESRER+++  I++G     
Sbjct: 3  LAVLHSRALTGIEAPPVRVETHLANGLPVFTIVGLADTGVRESRERVRAAIINSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPNRRITVNLAPADL 74


>gi|238789338|ref|ZP_04633124.1| hypothetical protein yfred0001_22670 [Yersinia frederiksenii ATCC
          33641]
 gi|238722481|gb|EEQ14135.1| hypothetical protein yfred0001_22670 [Yersinia frederiksenii ATCC
          33641]
          Length = 507

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  GI+   V V+V +S G  G+ +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 3  LATIHTRATLGIQAPSVTVEVHISNGLPGLVLVGLPETTVKEARDRVRSALINSGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVSLAPADL 74


>gi|238755788|ref|ZP_04617120.1| hypothetical protein yruck0001_400 [Yersinia ruckeri ATCC 29473]
 gi|238706015|gb|EEP98400.1| hypothetical protein yruck0001_400 [Yersinia ruckeri ATCC 29473]
          Length = 507

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  G++  PV ++V +S G  G+ +VGLP+  V E+R+R++S  +++G  F  
Sbjct: 3  LAVIHTRATIGVQAPPVTIEVHISNGLPGLTLVGLPETTVKEARDRVRSALLNSGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PARRITISLAPADL 74


>gi|206577543|ref|YP_002241169.1| ATPase, AAA family [Klebsiella pneumoniae 342]
 gi|206566601|gb|ACI08377.1| ATPase, AAA family [Klebsiella pneumoniae 342]
          Length = 506

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  GI+   + ++V +S G  G+ +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 3  LAIVYTRAALGIEAPLITIEVHLSSGLPGLTMVGLPETTVKEARDRVRSALINSGYAF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKKITINLAPADL 74


>gi|332707070|ref|ZP_08427128.1| Mg chelatase-related protein [Lyngbya majuscula 3L]
 gi|332354095|gb|EGJ33577.1| Mg chelatase-related protein [Lyngbya majuscula 3L]
          Length = 509

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + +  GI  + V V+V VS G  G+ +VGLPD AV ESRER+++   +AG  F 
Sbjct: 1  MLARVWSGSIIGIDAVKVGVEVDVSGGLPGIVVVGLPDTAVQESRERVKAALKNAGFAF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PIRKIVINLTPADL 73


>gi|323703448|ref|ZP_08115096.1| Mg chelatase, subunit ChlI [Desulfotomaculum nigrificans DSM 574]
 gi|323531629|gb|EGB21520.1| Mg chelatase, subunit ChlI [Desulfotomaculum nigrificans DSM 574]
          Length = 509

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ I ++A QG+ G  V V+V VS G   + +VGLPD AV E+++R+++   ++GL   
Sbjct: 1  MLAIIDSVALQGLDGQRVRVEVDVSHGLPCLDLVGLPDAAVREAKDRVRTAIKNSGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     DL
Sbjct: 58 --EFPIQRITVNLAPADL 73


>gi|262273094|ref|ZP_06050911.1| Mg(2+) chelatase family protein/ComM-related protein [Grimontia
          hollisae CIP 101886]
 gi|262222850|gb|EEY74158.1| Mg(2+) chelatase family protein/ComM-related protein [Grimontia
          hollisae CIP 101886]
          Length = 508

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V V+V +S G     +VGL +  V E+R+R++S  ++AG     
Sbjct: 3  LAIIQSRACVGVEAPQVTVEVHISNGLPAFTLVGLAETTVKEARDRVRSAIVNAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITVNLAPADL 74


>gi|323496946|ref|ZP_08101974.1| competence protein ComM [Vibrio sinaloensis DSM 21326]
 gi|323318020|gb|EGA71003.1| competence protein ComM [Vibrio sinaloensis DSM 21326]
          Length = 508

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V V+V +S G  G  +VGLP+  V ESR+R++S  I++      
Sbjct: 3  LAIIYSRASVGVQAPSVSVEVHISNGMPGFTLVGLPETTVKESRDRVRSAIINSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKRITVNLAPADL 74


>gi|108810231|ref|YP_645998.1| magnesium chelatase family protein [Yersinia pestis Nepal516]
 gi|229900396|ref|ZP_04515525.1| putative magnesium chelatase family protein [Yersinia pestis
          Nepal516]
 gi|108773879|gb|ABG16398.1| magnesium chelatase family protein [Yersinia pestis Nepal516]
 gi|229682415|gb|EEO78502.1| putative magnesium chelatase family protein [Yersinia pestis
          Nepal516]
          Length = 507

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  GI+  PV V+V +S G  G+ +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 3  LATIHTRATLGIQAPPVAVEVHISNGLPGLILVGLPETTVKEARDRVRSALINSGFNF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVSLAPADL 74


>gi|254483268|ref|ZP_05096500.1| putative Mg chelatase [marine gamma proteobacterium HTCC2148]
 gi|214036491|gb|EEB77166.1| putative Mg chelatase [marine gamma proteobacterium HTCC2148]
          Length = 495

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + + A  G+    V V+  +S G     IVGLP+ AV ES+ER++S  +++      
Sbjct: 3  LSVVHSRALSGLSAPAVRVETHLSNGLPAFNIVGLPETAVRESKERVRSAILNSHF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPDRRITINLAPADL 74


>gi|113953395|ref|YP_731662.1| Mg chelatase-like protein [Synechococcus sp. CC9311]
 gi|113880746|gb|ABI45704.1| Mg chelatase homolog [Synechococcus sp. CC9311]
          Length = 528

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 48/77 (62%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R S+ + QG++ +PV V+V ++PG  G+Q+VGLPD A+ ESRER+++   ++G    
Sbjct: 1  MLARCSSASLQGMEALPVTVEVDLAPGLPGLQLVGLPDTAIQESRERVRAALRNSGFRG- 59

Query: 61 VNELPSIYLQLIYQKKD 77
              P + + +     D
Sbjct: 60 ----PLVRVIVNLAPAD 72


>gi|77461729|ref|YP_351236.1| Mg chelatase-like protein [Pseudomonas fluorescens Pf0-1]
 gi|77385732|gb|ABA77245.1| putative magnesium chelatase protein [Pseudomonas fluorescens
          Pf0-1]
          Length = 497

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V ++ G   + +VGLP+ AV ES++R++S  I++GL F  
Sbjct: 3  LAIVHSRAQIGVDAPAVTVEVHLANGLPSLTMVGLPEAAVKESKDRVRSAIINSGLQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|269962658|ref|ZP_06177003.1| ComM-related protein [Vibrio harveyi 1DA3]
 gi|269832581|gb|EEZ86695.1| ComM-related protein [Vibrio harveyi 1DA3]
          Length = 507

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V V+V +S G  G  +VGLP+  V ES++R++S  +++   F  
Sbjct: 3  LAIIHSRASVGVQAPSVSVEVHISNGMPGFTLVGLPETTVKESKDRVRSAIVNSNFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|148240473|ref|YP_001225860.1| ATPase with chaperone activity [Synechococcus sp. WH 7803]
 gi|147849012|emb|CAK24563.1| Predicted ATPase with chaperone activity [Synechococcus sp. WH
          7803]
          Length = 525

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R  + +  GI   PV V+V ++PG  G+ +VGL D A+ ESRER++S   ++G    
Sbjct: 1  MLARCLSASLLGIDARPVTVEVDLAPGLPGLHLVGLADTAIQESRERVRSALRNSGFRG- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P + + +     DL
Sbjct: 60 ----PLVKVVVNLAPADL 73


>gi|300705306|ref|YP_003746909.1| ATPase [Ralstonia solanacearum CFBP2957]
 gi|299072970|emb|CBJ44327.1| putative ATPase, Mg chelatase-related protein [Ralstonia
          solanacearum CFBP2957]
          Length = 510

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  GI    V V+V ++ G     IVGLPD  V ES++R+++   ++      
Sbjct: 3  LAVLRSRALAGIDAPAVSVEVHLANGLPSFTIVGLPDTEVKESKDRVRAAIQNSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITVNLAPADL 74


>gi|117924138|ref|YP_864755.1| Mg chelatase, subunit ChlI [Magnetococcus sp. MC-1]
 gi|117607894|gb|ABK43349.1| Mg chelatase, subunit ChlI [Magnetococcus sp. MC-1]
          Length = 520

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++RI +IA +G+    VEV+V ++ G   + +VGLP+ AV E+++R+++   + G    
Sbjct: 11 MLARIYSIALEGVSAQTVEVEVDLANGLPSLNMVGLPEGAVREAKDRVRAALKNGG---- 66

Query: 61 VNELPSIYLQLIYQKKDL 78
            ++P   + +     +L
Sbjct: 67 -WQIPPKRVTINLAPANL 83


>gi|224368233|ref|YP_002602396.1| Mg chelatase-related protein [Desulfobacterium autotrophicum
          HRM2]
 gi|223690949|gb|ACN14232.1| Mg chelatase-related protein [Desulfobacterium autotrophicum
          HRM2]
          Length = 518

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 25/76 (32%), Positives = 40/76 (52%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+SR+ + A  GI    V+V+V +S G     +VG+P+ AV ESRER++S   ++G  F 
Sbjct: 1  MLSRVKSAAVAGIDAYIVDVEVDISFGLPMFNMVGMPETAVRESRERVKSAVKNSGYKF- 59

Query: 61 VNELPSIYLQLIYQKK 76
              P   + +     
Sbjct: 60 ----PVDRIVVNLAPA 71


>gi|260774564|ref|ZP_05883477.1| predicted ATPase with chaperone activity [Vibrio metschnikovii
          CIP 69.14]
 gi|260610470|gb|EEX35676.1| predicted ATPase with chaperone activity [Vibrio metschnikovii
          CIP 69.14]
          Length = 507

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V V+V +S G  G  +VGLP+  V ES++R++S  I++      
Sbjct: 3  LAIIHSRASIGVQAPEVTVEVHISNGMPGFTLVGLPETTVKESKDRVRSAIINSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKRITVNLAPADL 74


>gi|91226250|ref|ZP_01261090.1| ComM-related protein [Vibrio alginolyticus 12G01]
 gi|91189261|gb|EAS75540.1| ComM-related protein [Vibrio alginolyticus 12G01]
          Length = 220

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V V+V +S G  G  +VGLP+  V ES++R++S  I++   F  
Sbjct: 3  LAIIHSRASVGVQAPSVSVEVHISNGMPGFTLVGLPETTVKESKDRVRSAIINSNFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|170724778|ref|YP_001758804.1| Mg chelatase subunit ChlI [Shewanella woodyi ATCC 51908]
 gi|169810125|gb|ACA84709.1| Mg chelatase, subunit ChlI [Shewanella woodyi ATCC 51908]
          Length = 507

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I+ ++T A +G+    V V+V +S G     +VGLP+ +V E++ER++S  I+AG     
Sbjct: 3  IACVATRASKGVDAPSVTVEVHLSNGLPAFNLVGLPETSVKEAKERVRSAIINAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPMRRITVNLAPADL 74


>gi|120553462|ref|YP_957813.1| Fis family transcriptional regulator [Marinobacter aquaeolei VT8]
 gi|120323311|gb|ABM17626.1| transcriptional regulator, Fis family [Marinobacter aquaeolei
          VT8]
          Length = 510

 Score =  113 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ + + A  G+   PV V+V +S G   + IVGLP+  V ES++R++S  ++AG    
Sbjct: 1  MLAIVHSRASIGVSAPPVTVEVHLSGGLPALSIVGLPETGVRESKDRVRSALLNAGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P+  + +     DL
Sbjct: 58 --EFPARRITINLAPADL 73


>gi|238019257|ref|ZP_04599683.1| hypothetical protein VEIDISOL_01121 [Veillonella dispar ATCC
          17748]
 gi|237863956|gb|EEP65246.1| hypothetical protein VEIDISOL_01121 [Veillonella dispar ATCC
          17748]
          Length = 533

 Score =  113 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +++      GI G  + V+V +S G     IVGLP+++V E+RER+++   ++G  F 
Sbjct: 8  MYAKLYGATLHGIDGCIITVEVDISQGLPVFDIVGLPNQSVKEARERVRAAIKNSGYDF- 66

Query: 61 VNELPSIYLQLIYQKK 76
              P   + +     
Sbjct: 67 ----PMRRIVVNLAPA 78


>gi|88861035|ref|ZP_01135670.1| putative regulator [Pseudoalteromonas tunicata D2]
 gi|88816963|gb|EAR26783.1| putative regulator [Pseudoalteromonas tunicata D2]
          Length = 505

 Score =  113 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++RI + A  GI+   V V+V +  G     IVGLP+ +V E+++R++S  I++   F  
Sbjct: 3  LARIYSRAQVGIQAPQVIVEVHLGNGLPSFNIVGLPETSVKEAKDRVRSALINSQFAF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PDQRITVNLAPADL 74


>gi|269965309|ref|ZP_06179430.1| ComM-related protein [Vibrio alginolyticus 40B]
 gi|269830110|gb|EEZ84338.1| ComM-related protein [Vibrio alginolyticus 40B]
          Length = 507

 Score =  113 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V V+V +S G  G  +VGLP+  V ES++R++S  I++   F  
Sbjct: 3  LAIIHSRASVGVQAPSVSVEVHISNGMPGFTLVGLPETTVKESKDRVRSAIINSNFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|254788085|ref|YP_003075514.1| Mg chelatase [Teredinibacter turnerae T7901]
 gi|237684377|gb|ACR11641.1| putative Mg chelatase [Teredinibacter turnerae T7901]
          Length = 512

 Score =  113 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  GI+   V V+  +S G  G  IVGLP+ AV ES++R++S  +++      
Sbjct: 3  LAIVYTRAQLGIESPLVTVETHLSGGLPGFTIVGLPEAAVKESKDRVRSALLNSHF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPQQRITVNLAPADL 74


>gi|254502884|ref|ZP_05115035.1| Mg chelatase family protein [Labrenzia alexandrii DFL-11]
 gi|222438955|gb|EEE45634.1| Mg chelatase family protein [Labrenzia alexandrii DFL-11]
          Length = 508

 Score =  113 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 38/78 (48%), Positives = 52/78 (66%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+SR++T+AFQGI+ +PV+VQV V PG V   IVGLPDKAV ESRER+++    +GL   
Sbjct: 1  MVSRVTTVAFQGIEAVPVDVQVHVGPGMVAFTIVGLPDKAVAESRERVRAALSASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPAKRVTVNLAPADL 73


>gi|330812562|ref|YP_004357024.1| magnesium chelatase [Pseudomonas brassicacearum subsp.
          brassicacearum NFM421]
 gi|327380670|gb|AEA72020.1| putative magnesium chelatase [Pseudomonas brassicacearum subsp.
          brassicacearum NFM421]
          Length = 497

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+V ++ G   + +VGLP+ AV ES++R++S  I++GL F  
Sbjct: 3  LAIVHSRAQVGVEAPAVTVEVHLANGLPSLTMVGLPEAAVKESKDRVRSAIINSGLNF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|294341541|emb|CAZ89958.1| Competence protein comM [Thiomonas sp. 3As]
          Length = 508

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 46/77 (59%), Gaps = 4/77 (5%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++++++ A  G++  PV V+V +SPG  G  IVGLP+  V E+R+R++S  I++GL F  
Sbjct: 3  LAQVASRALLGMEAPPVTVEVHLSPGLPGFTIVGLPEAEVREARDRVRSALINSGLGFPS 62

Query: 62 NELPSIYLQLIYQKKDL 78
          N      + +     DL
Sbjct: 63 N----KRIVVNLAPADL 75


>gi|45442900|ref|NP_994439.1| putative magnesium chelatase family protein [Yersinia pestis
          biovar Microtus str. 91001]
 gi|108806118|ref|YP_650034.1| putative magnesium chelatase family protein [Yersinia pestis
          Antiqua]
 gi|145600761|ref|YP_001164837.1| magnesium chelatase family protein [Yersinia pestis Pestoides F]
 gi|153997048|ref|ZP_02022181.1| putative magnesium chelatase family protein [Yersinia pestis
          CA88-4125]
 gi|162421164|ref|YP_001605078.1| Mg chelatase-like protein [Yersinia pestis Angola]
 gi|165926272|ref|ZP_02222104.1| Mg chelatase homolog [Yersinia pestis biovar Orientalis str.
          F1991016]
 gi|165939708|ref|ZP_02228251.1| Mg chelatase homolog [Yersinia pestis biovar Orientalis str.
          IP275]
 gi|166009462|ref|ZP_02230360.1| Mg chelatase homolog [Yersinia pestis biovar Antiqua str.
          E1979001]
 gi|166213528|ref|ZP_02239563.1| Mg chelatase homolog [Yersinia pestis biovar Antiqua str.
          B42003004]
 gi|167402044|ref|ZP_02307523.1| Mg chelatase homolog [Yersinia pestis biovar Antiqua str.
          UG05-0454]
 gi|167421017|ref|ZP_02312770.1| Mg chelatase homolog [Yersinia pestis biovar Orientalis str.
          MG05-1020]
 gi|167425930|ref|ZP_02317683.1| Mg chelatase homolog [Yersinia pestis biovar Mediaevalis str.
          K1973002]
 gi|167470073|ref|ZP_02334777.1| two-component regulator [Yersinia pestis FV-1]
 gi|218930902|ref|YP_002348777.1| putative magnesium chelatase family protein [Yersinia pestis
          CO92]
 gi|229837232|ref|ZP_04457397.1| putative magnesium chelatase family protein [Yersinia pestis
          Pestoides A]
 gi|229839596|ref|ZP_04459755.1| putative magnesium chelatase family protein [Yersinia pestis
          biovar Orientalis str. PEXU2]
 gi|229900158|ref|ZP_04515295.1| putative magnesium chelatase family protein [Yersinia pestis
          biovar Orientalis str. India 195]
 gi|270488747|ref|ZP_06205821.1| Mg chelatase-like protein [Yersinia pestis KIM D27]
 gi|294505552|ref|YP_003569614.1| putative magnesium chelatase family protein [Yersinia pestis
          Z176003]
 gi|45437767|gb|AAS63316.1| putative magnesium chelatase family protein [Yersinia pestis
          biovar Microtus str. 91001]
 gi|108778031|gb|ABG12089.1| putative magnesium chelatase family protein [Yersinia pestis
          Antiqua]
 gi|115349513|emb|CAL22487.1| putative magnesium chelatase family protein [Yersinia pestis
          CO92]
 gi|145212457|gb|ABP41864.1| magnesium chelatase family protein [Yersinia pestis Pestoides F]
 gi|149289354|gb|EDM39432.1| putative magnesium chelatase family protein [Yersinia pestis
          CA88-4125]
 gi|162353979|gb|ABX87927.1| Mg chelatase homolog [Yersinia pestis Angola]
 gi|165912398|gb|EDR31032.1| Mg chelatase homolog [Yersinia pestis biovar Orientalis str.
          IP275]
 gi|165921796|gb|EDR38993.1| Mg chelatase homolog [Yersinia pestis biovar Orientalis str.
          F1991016]
 gi|165991384|gb|EDR43685.1| Mg chelatase homolog [Yersinia pestis biovar Antiqua str.
          E1979001]
 gi|166205201|gb|EDR49681.1| Mg chelatase homolog [Yersinia pestis biovar Antiqua str.
          B42003004]
 gi|166961146|gb|EDR57167.1| Mg chelatase homolog [Yersinia pestis biovar Orientalis str.
          MG05-1020]
 gi|167048518|gb|EDR59926.1| Mg chelatase homolog [Yersinia pestis biovar Antiqua str.
          UG05-0454]
 gi|167055078|gb|EDR64877.1| Mg chelatase homolog [Yersinia pestis biovar Mediaevalis str.
          K1973002]
 gi|229686938|gb|EEO79017.1| putative magnesium chelatase family protein [Yersinia pestis
          biovar Orientalis str. India 195]
 gi|229695962|gb|EEO86009.1| putative magnesium chelatase family protein [Yersinia pestis
          biovar Orientalis str. PEXU2]
 gi|229706175|gb|EEO92184.1| putative magnesium chelatase family protein [Yersinia pestis
          Pestoides A]
 gi|262363619|gb|ACY60340.1| putative magnesium chelatase family protein [Yersinia pestis
          D106004]
 gi|262367549|gb|ACY64106.1| putative magnesium chelatase family protein [Yersinia pestis
          D182038]
 gi|270337251|gb|EFA48028.1| Mg chelatase-like protein [Yersinia pestis KIM D27]
 gi|294356011|gb|ADE66352.1| putative magnesium chelatase family protein [Yersinia pestis
          Z176003]
 gi|320013500|gb|ADV97071.1| putative magnesium chelatase family protein [Yersinia pestis
          biovar Medievalis str. Harbin 35]
          Length = 507

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  GI+  PV V+V +S G  G+ +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 3  LATIHTRATLGIQAPPVAVEVHISNGLPGLILVGLPETTVKEARDRVRSALINSGFNF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVSLAPADL 74


>gi|325981874|ref|YP_004294276.1| Mg chelatase, subunit ChlI [Nitrosomonas sp. AL212]
 gi|325531393|gb|ADZ26114.1| Mg chelatase, subunit ChlI [Nitrosomonas sp. AL212]
          Length = 501

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  GI+   V V+  ++ G     IVGLPD  V ES++R+++   +A      
Sbjct: 3  LAVLYSRALSGIQAPLVTVETHIANGLPSFTIVGLPDTEVKESKDRVRAALQNAQFK--- 59

Query: 62 NELPSIYLQLIYQKKDL 78
            +P+  + +     DL
Sbjct: 60 --IPAQRITINLAPADL 74


>gi|186893484|ref|YP_001870596.1| Mg chelatase subunit ChlI [Yersinia pseudotuberculosis PB1/+]
 gi|186696510|gb|ACC87139.1| Mg chelatase, subunit ChlI [Yersinia pseudotuberculosis PB1/+]
          Length = 507

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  GI+  PV V+V +S G  G+ +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 3  LATIHTRATLGIQAPPVAVEVHISNGLPGLILVGLPETTVKEARDRVRSALINSGFNF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVSLAPADL 74


>gi|22124251|ref|NP_667674.1| two-component regulator [Yersinia pestis KIM 10]
 gi|21957017|gb|AAM83925.1|AE013633_7 putative 2-component regulator [Yersinia pestis KIM 10]
          Length = 514

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  GI+  PV V+V +S G  G+ +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 10 LATIHTRATLGIQAPPVAVEVHISNGLPGLILVGLPETTVKEARDRVRSALINSGFNF-- 67

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 68 ---PAKRITVSLAPADL 81


>gi|51594491|ref|YP_068682.1| magnesium chelatase family protein [Yersinia pseudotuberculosis
          IP 32953]
 gi|170026272|ref|YP_001722777.1| Mg chelatase subunit ChlI [Yersinia pseudotuberculosis YPIII]
 gi|51587773|emb|CAH19373.1| putative magnesium chelatase family protein [Yersinia
          pseudotuberculosis IP 32953]
 gi|169752806|gb|ACA70324.1| Mg chelatase, subunit ChlI [Yersinia pseudotuberculosis YPIII]
          Length = 507

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  GI+  PV V+V +S G  G+ +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 3  LATIHTRATLGIQAPPVAVEVHISNGLPGLILVGLPETTVKEARDRVRSALINSGFNF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVSLAPADL 74


>gi|153950154|ref|YP_001399150.1| Mg chelatase-like protein [Yersinia pseudotuberculosis IP 31758]
 gi|152961649|gb|ABS49110.1| Mg chelatase-like protein [Yersinia pseudotuberculosis IP 31758]
          Length = 507

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  GI+  PV V+V +S G  G+ +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 3  LATIHTRATLGIQAPPVAVEVHISNGLPGLILVGLPETTVKEARDRVRSALINSGFNF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVSLAPADL 74


>gi|330861629|emb|CBX71811.1| uncharacterized protein yifB [Yersinia enterocolitica W22703]
          Length = 418

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  GI+   V V+V +S G  G+ +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 3  LATIYTRATLGIQAPSVTVEVHISNGLPGLVLVGLPETTVKEARDRVRSALINSGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVSLAPADL 74


>gi|254229986|ref|ZP_04923387.1| putative Mg chelatase homolog [Vibrio sp. Ex25]
 gi|262392816|ref|YP_003284670.1| Mg(2+) chelatase family protein/ComM-like protein [Vibrio sp.
          Ex25]
 gi|151937488|gb|EDN56345.1| putative Mg chelatase homolog [Vibrio sp. Ex25]
 gi|262336410|gb|ACY50205.1| Mg(2+) chelatase family protein/ComM-related protein [Vibrio sp.
          Ex25]
          Length = 507

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V V+V +S G  G  +VGLP+  V ES++R++S  I++   F  
Sbjct: 3  LAIIHSRASVGVQAPSVSVEVHISNGMPGFTLVGLPETTVKESKDRVRSAIINSNFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|311693168|gb|ADP96041.1| Mg-chelatase subunits D/I family, ComM subfamily protein [marine
          bacterium HP15]
          Length = 524

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ + + A  G+    V V+V +S G   + IVGLP+  V ES+ER++S  ++AG    
Sbjct: 15 MLAIVHSRAAIGVSAPAVTVEVHLSGGLPALSIVGLPETGVRESKERVRSALLNAGF--- 71

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P+  + +     DL
Sbjct: 72 --EFPARRITINLAPADL 87


>gi|294142720|ref|YP_003558698.1| magnesium chelatase family protein [Shewanella violacea DSS12]
 gi|293329189|dbj|BAJ03920.1| magnesium chelatase family protein [Shewanella violacea DSS12]
          Length = 507

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I+ ++T A +G+    V V+V +S G     +VGLP+ +V E++ER++S  I+AG     
Sbjct: 3  IACVATRANKGVDAPAVTVEVHLSNGLPAFNLVGLPETSVKEAKERVRSAIINAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPMRRITVNLAPADL 74


>gi|28899831|ref|NP_799436.1| ComM-like protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|260362003|ref|ZP_05775008.1| Mg chelatase-like protein [Vibrio parahaemolyticus K5030]
 gi|260876510|ref|ZP_05888865.1| Mg chelatase-like protein [Vibrio parahaemolyticus AN-5034]
 gi|260897433|ref|ZP_05905929.1| Mg chelatase-like protein [Vibrio parahaemolyticus Peru-466]
 gi|28808083|dbj|BAC61320.1| ComM-related protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|308087934|gb|EFO37629.1| Mg chelatase-like protein [Vibrio parahaemolyticus Peru-466]
 gi|308090364|gb|EFO40059.1| Mg chelatase-like protein [Vibrio parahaemolyticus AN-5034]
 gi|308114163|gb|EFO51703.1| Mg chelatase-like protein [Vibrio parahaemolyticus K5030]
          Length = 507

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V V+V +S G  G  +VGLP+  V ES++R++S  I++   F  
Sbjct: 3  LAIIHSRASVGVQAPSVSVEVHISNGMPGFTLVGLPETTVKESKDRVRSAIINSNFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|260595997|ref|YP_003208568.1| hypothetical protein CTU_02050 [Cronobacter turicensis z3032]
 gi|260215174|emb|CBA26993.1| Uncharacterized protein yifB [Cronobacter turicensis z3032]
          Length = 506

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S I T A  G+K   V V+V +S G  G+ IVGLP+  V E+R+R++S  I++G  F  
Sbjct: 3  LSIIHTRAALGVKAPLVTVEVHISAGLPGLTIVGLPETTVKEARDRVRSALINSGYDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKKITINLAPADL 74


>gi|328471183|gb|EGF42085.1| ComM-like protein [Vibrio parahaemolyticus 10329]
          Length = 507

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V V+V +S G  G  +VGLP+  V ES++R++S  I++   F  
Sbjct: 3  LAIIHSRASVGVQAPSVSVEVHISNGMPGFTLVGLPETTVKESKDRVRSAIINSNFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|17545057|ref|NP_518459.1| Mg(2+) chelatase family protein [Ralstonia solanacearum GMI1000]
 gi|17427347|emb|CAD13866.1| conserved hypothetical protein [Ralstonia solanacearum GMI1000]
          Length = 510

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  GI    V V+V ++ G     IVGLPD  V ES++R+++   ++      
Sbjct: 3  LAVLRSRALAGIDAPAVSVEVHLANGLPSFTIVGLPDTEVKESKDRVRAAIQNSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITVNLAPADL 74


>gi|332975206|gb|EGK12106.1| competence protein ComM [Kingella kingae ATCC 23330]
          Length = 500

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           + +++ A  G+    VEV+V ++ G     IVGLPD  V ESR+R+++  + +G     
Sbjct: 3  FAVVNSRALNGMNAPLVEVEVHLANGLPQCNIVGLPDTEVKESRDRVRAAILQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPMQKITVNLAPADL 74


>gi|182416695|ref|ZP_02948096.1| putative Mg chelatase [Clostridium butyricum 5521]
 gi|237668859|ref|ZP_04528843.1| putative Mg chelatase family protein [Clostridium butyricum E4
          str. BoNT E BL5262]
 gi|182379457|gb|EDT76950.1| putative Mg chelatase [Clostridium butyricum 5521]
 gi|237657207|gb|EEP54763.1| putative Mg chelatase family protein [Clostridium butyricum E4
          str. BoNT E BL5262]
          Length = 508

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  +I +  +  ++GI + V+V +S G     IVGLPD +V E++ER+++  I+ G    
Sbjct: 1  MAIKIISATYNNLEGILIHVEVDISKGLPQFSIVGLPDASVKEAKERVRAAIINCGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     D+
Sbjct: 58 --EFPLGRITINLAPADV 73


>gi|87125304|ref|ZP_01081150.1| Mg(2+) chelatase family protein [Synechococcus sp. RS9917]
 gi|86167073|gb|EAQ68334.1| Mg(2+) chelatase family protein [Synechococcus sp. RS9917]
          Length = 511

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R  + +  G+   PV V+V ++PG  G+Q+VGLPD A+ ESRER+++   ++G    
Sbjct: 1  MLARCLSASIVGLDARPVTVEVDLAPGLPGLQLVGLPDAAIQESRERVRAALRNSGFRG- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P + + +     DL
Sbjct: 60 ----PLVRVVVNLAPADL 73


>gi|296137242|ref|YP_003644484.1| Mg chelatase, subunit ChlI [Thiomonas intermedia K12]
 gi|295797364|gb|ADG32154.1| Mg chelatase, subunit ChlI [Thiomonas intermedia K12]
          Length = 508

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 46/77 (59%), Gaps = 4/77 (5%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++++++ A  G++  PV V+V +SPG  G  IVGLP+  V E+R+R++S  I++GL F  
Sbjct: 3  LAQVASRALLGMEAPPVTVEVHLSPGLPGFTIVGLPEAEVREARDRVRSALINSGLGFPS 62

Query: 62 NELPSIYLQLIYQKKDL 78
          N      + +     DL
Sbjct: 63 N----KRIVVNLAPADL 75


>gi|300088109|ref|YP_003758631.1| Mg chelatase subunit ChlI [Dehalogenimonas lykanthroporepellens
          BL-DC-9]
 gi|299527842|gb|ADJ26310.1| Mg chelatase, subunit ChlI [Dehalogenimonas lykanthroporepellens
          BL-DC-9]
          Length = 505

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+++ +T A  G+ G  VEV+V ++PG     +VGLPD A+ ESRER+++   ++G  F 
Sbjct: 1  MLAKTTTCALLGLDGTIVEVEVDIAPGLPSFTVVGLPDAAIQESRERVRAAVRNSGFYF- 59

Query: 61 VNELPSIYLQLIYQKKD 77
              P   +       D
Sbjct: 60 ----PMKRVVAGLAPAD 72


>gi|255655284|ref|ZP_05400693.1| putative competence protein (putative magnesium chelatase)
          [Clostridium difficile QCD-23m63]
 gi|296451268|ref|ZP_06893008.1| Mg chelatase-like protein [Clostridium difficile NAP08]
 gi|296880380|ref|ZP_06904343.1| Mg chelatase-like protein [Clostridium difficile NAP07]
 gi|296259874|gb|EFH06729.1| Mg chelatase-like protein [Clostridium difficile NAP08]
 gi|296428621|gb|EFH14505.1| Mg chelatase-like protein [Clostridium difficile NAP07]
          Length = 533

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S I++    GI    V+V+V +S G     IVGLP K + E+RER++S  +++G  F 
Sbjct: 1  MLSIINSSNLVGIDSFLVKVEVDISNGIPSFNIVGLPGKEIKEARERVKSAILNSGYKF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              PS  + +     D+
Sbjct: 60 ----PSTRIVVNLSPADI 73


>gi|220906543|ref|YP_002481854.1| Mg chelatase subunit ChlI [Cyanothece sp. PCC 7425]
 gi|219863154|gb|ACL43493.1| Mg chelatase, subunit ChlI [Cyanothece sp. PCC 7425]
          Length = 509

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + +  GI+ + V V+V +S G  G+ +VGLPD AV ESRER+++   ++G  F 
Sbjct: 1  MLARVWSASLIGIEAVRVGVEVDISGGLPGIVVVGLPDVAVQESRERVKAALRNSGYAF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PMRRIVINLTPADL 73


>gi|153831190|ref|ZP_01983857.1| Mg chelatase-related protein [Vibrio cholerae 623-39]
 gi|148873323|gb|EDL71458.1| Mg chelatase-related protein [Vibrio cholerae 623-39]
          Length = 150

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++  PV V+V +S G  G  +VGLP+  V ESR+R++S  I++      
Sbjct: 3  LAIIHSRASIGVQAPPVTVEVHISNGMPGFTLVGLPETTVKESRDRVRSAIINSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKRITVNLAPADL 74


>gi|34499455|ref|NP_903670.1| competence protein ComM [Chromobacterium violaceum ATCC 12472]
 gi|34105307|gb|AAQ61662.1| probable competence protein ComM [Chromobacterium violaceum ATCC
          12472]
          Length = 500

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ +++ A  G+    V V+V ++ G     IVGLPD  V ESR+R+++  + +G     
Sbjct: 3  LAVVASRALSGLDAPEVAVEVHLANGLPAFNIVGLPDTEVKESRDRVRAAILTSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARKITVNLAPADL 74


>gi|254447679|ref|ZP_05061145.1| Mg chelatase family protein [gamma proteobacterium HTCC5015]
 gi|198263022|gb|EDY87301.1| Mg chelatase family protein [gamma proteobacterium HTCC5015]
          Length = 495

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S   T A QGI    V V+  +S G     IVGLP+ AV ESR+R+++  I +     
Sbjct: 1  MLSTAYTRATQGIDAPLVSVETHLSNGLPAFHIVGLPEAAVRESRDRVRAAIISSQF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     DL
Sbjct: 58 --EFPMTRITVNLAPADL 73


>gi|157377303|ref|YP_001475903.1| Mg chelatase, subunit ChlI [Shewanella sediminis HAW-EB3]
 gi|157319677|gb|ABV38775.1| Mg chelatase, subunit ChlI [Shewanella sediminis HAW-EB3]
          Length = 507

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I+ ++T A +G++   V V+V +S G     +VGLP+ +V E++ER++S  I+AG     
Sbjct: 3  IACVATRASKGVEAPSVTVEVHLSNGLPAFNLVGLPETSVKEAKERVRSAIINAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPMRRITVNLAPADL 74


>gi|187927302|ref|YP_001897789.1| Mg chelatase subunit ChlI [Ralstonia pickettii 12J]
 gi|309779999|ref|ZP_07674752.1| Mg chelatase-like protein [Ralstonia sp. 5_7_47FAA]
 gi|187724192|gb|ACD25357.1| Mg chelatase, subunit ChlI [Ralstonia pickettii 12J]
 gi|308921169|gb|EFP66813.1| Mg chelatase-like protein [Ralstonia sp. 5_7_47FAA]
          Length = 510

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  GI    V V+V ++ G     IVGLPD  V ES++R+++   ++      
Sbjct: 3  LAVLRSRALSGIDAPAVSVEVHLANGLPSFTIVGLPDTEVKESKDRVRAAIQNSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITVNLAPADL 74


>gi|326796665|ref|YP_004314485.1| Mg chelatase, subunit ChlI [Marinomonas mediterranea MMB-1]
 gi|326547429|gb|ADZ92649.1| Mg chelatase, subunit ChlI [Marinomonas mediterranea MMB-1]
          Length = 505

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G+    V V+  +S G   + IVGLP+ AV E+++R++S   ++      
Sbjct: 3  LATIYSRARVGVDSPLVTVETHISNGLPALNIVGLPEAAVREAKDRVRSAIQNSHF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPTQRITINLAPADL 74


>gi|256821299|ref|YP_003145262.1| magnesium chelatase ChlI subunit [Kangiella koreensis DSM 16069]
 gi|256794838|gb|ACV25494.1| magnesium chelatase ChlI subunit [Kangiella koreensis DSM 16069]
          Length = 313

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  GI+   V V+V +S G   + IVGLP+ AV ES++R++S  I++      
Sbjct: 3  LAIVYSRAGVGIEAPLVTVEVHLSHGLPSLNIVGLPEAAVKESKDRVRSAIINSNF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITINLAPADL 74


>gi|77359102|ref|YP_338677.1| regulator [Pseudoalteromonas haloplanktis TAC125]
 gi|76874013|emb|CAI85234.1| putative regulator [Pseudoalteromonas haloplanktis TAC125]
          Length = 503

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++RI + A  GI    V V+V +  G     IVGLP+ +V ES++R++S   ++   F  
Sbjct: 3  LARIYSRAQVGINAPEVIVEVHLGNGLPAFHIVGLPEASVKESKDRVRSALENSKFGF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PDQRITVNLAPADL 74


>gi|114332334|ref|YP_748556.1| Mg chelatase, subunit ChlI [Nitrosomonas eutropha C91]
 gi|114309348|gb|ABI60591.1| Mg chelatase, subunit ChlI [Nitrosomonas eutropha C91]
          Length = 499

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V ++ G     IVGLP+  V ES++R+++   +    F  
Sbjct: 3  LAILYSRALCGVDAPLVTVEVHLANGLPKFTIVGLPETEVRESKDRVRAALQNGRFKF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PARRITVNLAPADL 74


>gi|270264576|ref|ZP_06192842.1| Mg chelatase, subunit ChlI [Serratia odorifera 4Rx13]
 gi|270041712|gb|EFA14810.1| Mg chelatase, subunit ChlI [Serratia odorifera 4Rx13]
          Length = 507

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  G++   V V+V +S G  G+ +VGLP+  V E+R+R++S  I+ G  F  
Sbjct: 3  LAVIYTRATMGVQAPSVTVEVHISNGLPGLTMVGLPETTVKEARDRVRSALINNGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PARRITVNLAPADL 74


>gi|238786172|ref|ZP_04630123.1| hypothetical protein yberc0001_39530 [Yersinia bercovieri ATCC
          43970]
 gi|238712913|gb|EEQ04974.1| hypothetical protein yberc0001_39530 [Yersinia bercovieri ATCC
          43970]
          Length = 507

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  GI+   V V+V +S G  G+ +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 3  LATIHTRATLGIQAPNVTVEVHISNGLPGLVLVGLPETTVKEARDRVRSALINSGFNF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVSLAPADL 74


>gi|157372994|ref|YP_001480983.1| Mg chelatase subunit ChlI [Serratia proteamaculans 568]
 gi|157324758|gb|ABV43855.1| Mg chelatase, subunit ChlI [Serratia proteamaculans 568]
          Length = 507

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  G++   V V+V +S G  G+ +VGLP+  V E+R+R++S  I+ G  F  
Sbjct: 3  LAVIYTRATLGVQAPSVTVEVHISNGLPGLTMVGLPETTVKEARDRVRSALINNGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PARRITVNLAPADL 74


>gi|149376954|ref|ZP_01894708.1| Mg chelatase-related protein [Marinobacter algicola DG893]
 gi|149358731|gb|EDM47201.1| Mg chelatase-related protein [Marinobacter algicola DG893]
          Length = 507

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M + + T A  G+    V V+V +S G   + IVGLP+  V ESRER++S  ++AG    
Sbjct: 1  MFAVVHTRASIGVSAPSVTVEVHLSGGLPALSIVGLPETGVRESRERVRSALMNAGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P+  + +     DL
Sbjct: 58 --EFPARRITINLAPADL 73


>gi|114045831|ref|YP_736381.1| Mg chelatase subunit ChlI [Shewanella sp. MR-7]
 gi|113887273|gb|ABI41324.1| Mg chelatase, subunit ChlI [Shewanella sp. MR-7]
          Length = 508

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I+ + T A  G++   V V+V +S G     +VGLP+ +V E+RER++S  I+AG     
Sbjct: 3  IACVHTRASCGVEAPEVIVEVHLSNGLPAFNLVGLPEASVKEARERVRSALINAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPMRRITVNLAPADL 74


>gi|261343034|ref|ZP_05970892.1| Mg chelatase-like protein [Enterobacter cancerogenus ATCC 35316]
 gi|288314596|gb|EFC53534.1| Mg chelatase-like protein [Enterobacter cancerogenus ATCC 35316]
          Length = 506

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+K   + V+V +S G  G+ +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 3  LSVVYTRAALGVKAPLISVEVHLSNGLPGLTLVGLPETTVKEARDRVRSAIINSGYNF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKKITINLAPADL 74


>gi|207727777|ref|YP_002256171.1| hypothetical protein RSMK04017 [Ralstonia solanacearum MolK2]
 gi|206591018|emb|CAQ56630.1| conserved hypothetical protein [Ralstonia solanacearum MolK2]
          Length = 510

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  GI    V V+V ++ G     IVGLPD  V ES++R+++   ++      
Sbjct: 3  LAVLRSRALAGIDAPAVSVEVHLANGLPSFTIVGLPDTEVKESKDRVRAAIQNSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPTRRITVNLAPADL 74


>gi|153837664|ref|ZP_01990331.1| putative Mg chelatase homolog [Vibrio parahaemolyticus AQ3810]
 gi|149748954|gb|EDM59781.1| putative Mg chelatase homolog [Vibrio parahaemolyticus AQ3810]
          Length = 315

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V V+V +S G  G  +VGLP+  V ES++R++S  I++   F  
Sbjct: 3  LAIIHSRASVGVQAPSVSVEVHISNGMPGFTLVGLPETTVKESKDRVRSAIINSNFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|83746883|ref|ZP_00943930.1| ATPase related to magnesium chelatase subunit ChlI [Ralstonia
          solanacearum UW551]
 gi|207742182|ref|YP_002258574.1| hypothetical protein RSIPO_00364 [Ralstonia solanacearum IPO1609]
 gi|83726468|gb|EAP73599.1| ATPase related to magnesium chelatase subunit ChlI [Ralstonia
          solanacearum UW551]
 gi|206593570|emb|CAQ60497.1| conserved hypothetical protein [Ralstonia solanacearum IPO1609]
          Length = 510

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  GI    V V+V ++ G     IVGLPD  V ES++R+++   ++      
Sbjct: 3  LAVLRSRALAGIDAPAVSVEVHLANGLPSFTIVGLPDTEVKESKDRVRAAIQNSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPTRRITVNLAPADL 74


>gi|218441221|ref|YP_002379550.1| Mg chelatase, subunit ChlI [Cyanothece sp. PCC 7424]
 gi|218173949|gb|ACK72682.1| Mg chelatase, subunit ChlI [Cyanothece sp. PCC 7424]
          Length = 509

 Score =  112 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ + + +  GI  + V V+V VS G   + IVGLPD A+ ESRER+++   +AG  F 
Sbjct: 1  MLATVWSASIIGIDAVKVAVEVDVSGGLPSITIVGLPDTAIQESRERVKASLKNAGFAF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 60 ----PVRKIVINLAPADI 73


>gi|254974817|ref|ZP_05271289.1| putative competence protein (putative magnesium chelatase)
          [Clostridium difficile QCD-66c26]
 gi|255092205|ref|ZP_05321683.1| putative competence protein (putative magnesium chelatase)
          [Clostridium difficile CIP 107932]
 gi|255313944|ref|ZP_05355527.1| putative competence protein (putative magnesium chelatase)
          [Clostridium difficile QCD-76w55]
 gi|255516624|ref|ZP_05384300.1| putative competence protein (putative magnesium chelatase)
          [Clostridium difficile QCD-97b34]
 gi|260682879|ref|YP_003214164.1| putative competence protein [Clostridium difficile CD196]
 gi|260686477|ref|YP_003217610.1| putative competence protein [Clostridium difficile R20291]
 gi|306519834|ref|ZP_07406181.1| putative competence protein (putative magnesium chelatase)
          [Clostridium difficile QCD-32g58]
 gi|260209042|emb|CBA62155.1| putative competence protein (putative magnesium chelatase)
          [Clostridium difficile CD196]
 gi|260212493|emb|CBE03415.1| putative competence protein (putative magnesium chelatase)
          [Clostridium difficile R20291]
          Length = 533

 Score =  112 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S I++    GI    V+V+V VS G     IVGLP K + E+RER++S  +++G  F 
Sbjct: 1  MLSIINSSNLVGIDSFLVKVEVDVSNGIPSFNIVGLPGKEIKEARERVKSAILNSGYKF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              PS  + +     D+
Sbjct: 60 ----PSTRIVVNLSPADI 73


>gi|226941850|ref|YP_002796924.1| Mg chelatase-related protein [Laribacter hongkongensis HLHK9]
 gi|226716777|gb|ACO75915.1| Mg chelatase-related protein [Laribacter hongkongensis HLHK9]
          Length = 501

 Score =  112 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G     V V+V ++ G     +VGLPD  V E+R+R+++  +H+G  F  
Sbjct: 3  LATVKSRALAGADAPEVTVEVHLANGLPAFTLVGLPDTEVREARDRVRAALLHSGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  L +     DL
Sbjct: 61 ---PAARLTVNLAPADL 74


>gi|126698869|ref|YP_001087766.1| putative magnesium chelatase [Clostridium difficile 630]
 gi|255306229|ref|ZP_05350401.1| putative competence protein (putative magnesium chelatase)
          [Clostridium difficile ATCC 43255]
 gi|115250306|emb|CAJ68128.1| putative magnesium chelatase [Clostridium difficile]
          Length = 533

 Score =  112 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S I++    GI    V+V+V VS G     IVGLP K + E+RER++S  +++G  F 
Sbjct: 1  MLSIINSSNLVGIDSFLVKVEVDVSNGIPSFNIVGLPGKEIKEARERVKSAILNSGYKF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              PS  + +     D+
Sbjct: 60 ----PSTRIVVNLSPADI 73


>gi|255649724|ref|ZP_05396626.1| putative competence protein (putative magnesium chelatase)
          [Clostridium difficile QCD-37x79]
          Length = 536

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S I++    GI    V+V+V VS G     IVGLP K + E+RER++S  +++G  F 
Sbjct: 1  MLSIINSSNLVGIDSFLVKVEVDVSNGIPSFNIVGLPGKEIKEARERVKSAILNSGYKF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              PS  + +     D+
Sbjct: 60 ----PSTRIVVNLSPADI 73


>gi|255100290|ref|ZP_05329267.1| putative competence protein (putative magnesium chelatase)
          [Clostridium difficile QCD-63q42]
          Length = 533

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S I++    GI    V+V+V VS G     IVGLP K + E+RER++S  +++G  F 
Sbjct: 1  MLSIINSSNLVGIDSFLVKVEVDVSNGIPSFNIVGLPGKEIKEARERVKSAILNSGYKF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              PS  + +     D+
Sbjct: 60 ----PSTRIVVNLSPADI 73


>gi|88706248|ref|ZP_01103955.1| conserved hypothetical protein [Congregibacter litoralis KT71]
 gi|88699642|gb|EAQ96754.1| conserved hypothetical protein [Congregibacter litoralis KT71]
          Length = 497

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           + + + A QG+    V V+V +S G     +VG+P+ AV ES++R++S  +++      
Sbjct: 3  YAVVLSRANQGLDAPLVRVEVHLSNGLPAFTVVGMPETAVRESKDRVRSALLNSHF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPDRRITVNLAPADL 74


>gi|167625864|ref|YP_001676158.1| Mg chelatase subunit ChlI [Shewanella halifaxensis HAW-EB4]
 gi|167355886|gb|ABZ78499.1| Mg chelatase, subunit ChlI [Shewanella halifaxensis HAW-EB4]
          Length = 506

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I+ ++T A  G++   V+V+V +S G     +VGLP+ +V E++ER++S  I+AG     
Sbjct: 3  IACVATRASHGVQAPAVQVEVHLSNGLPAFSLVGLPEASVKEAKERVRSALINAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPMRRITVNLAPADL 74


>gi|288819072|ref|YP_003433420.1| Mg chelatase subunit ChlI [Hydrogenobacter thermophilus TK-6]
 gi|288788472|dbj|BAI70219.1| Mg chelatase subunit ChlI [Hydrogenobacter thermophilus TK-6]
 gi|308752655|gb|ADO46138.1| Mg chelatase, subunit ChlI [Hydrogenobacter thermophilus TK-6]
          Length = 505

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 25/76 (32%), Positives = 41/76 (53%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  R+ +    GI G  V+V+V VSPG     IVGLPDKA+ E+++R++S   ++G    
Sbjct: 1  MFCRVKSGGVLGIDGFEVDVEVDVSPGLPVFNIVGLPDKAINEAKDRVKSALKNSGF--- 57

Query: 61 VNELPSIYLQLIYQKK 76
             +P+  + +     
Sbjct: 58 --SIPTKKITVNLSPS 71


>gi|117922252|ref|YP_871444.1| Mg chelatase subunit ChlI [Shewanella sp. ANA-3]
 gi|117614584|gb|ABK50038.1| Mg chelatase, subunit ChlI [Shewanella sp. ANA-3]
          Length = 508

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I+ + T A  G++   V V+V +S G     +VGLP+ +V E+RER++S  I+AG     
Sbjct: 3  IACVHTRASCGVEAPEVIVEVHLSNGLPAFNLVGLPEASVKEARERVRSALINAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPMRRITVNLAPADL 74


>gi|257455133|ref|ZP_05620371.1| Mg chelatase homolog [Enhydrobacter aerosaccus SK60]
 gi|257447466|gb|EEV22471.1| Mg chelatase homolog [Enhydrobacter aerosaccus SK60]
          Length = 497

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           +++ T +  G+    V V+V +S G   V +VGLP+ AV ES++R++S  I++G  F  
Sbjct: 3  FAQVYTRSVVGLNAPSVMVEVHLSQGLPAVTMVGLPEAAVRESKDRVRSAIINSGFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  L +     DL
Sbjct: 61 ---PNRRLTINLAPADL 74


>gi|238799169|ref|ZP_04642621.1| hypothetical protein ymoll0001_38170 [Yersinia mollaretii ATCC
          43969]
 gi|238716980|gb|EEQ08844.1| hypothetical protein ymoll0001_38170 [Yersinia mollaretii ATCC
          43969]
          Length = 510

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  GI+   V V+V +S G  G+ +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 10 LATIHTRATLGIQAPNVTVEVHISNGLPGLVLVGLPETTVKEARDRVRSALINSGFSF-- 67

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 68 ---PAKRITVSLAPADL 81


>gi|134299869|ref|YP_001113365.1| Mg chelatase subunit ChlI [Desulfotomaculum reducens MI-1]
 gi|134052569|gb|ABO50540.1| Mg chelatase, subunit ChlI [Desulfotomaculum reducens MI-1]
          Length = 509

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ I ++A  G+ G  V V+V VS G   + IVGLPD AV E+++R++S   ++G+ + 
Sbjct: 1  MLAIIDSVALLGLDGQRVRVEVDVSNGLPCLDIVGLPDAAVREAKDRVRSAIKNSGMDY- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PIQRITVNLAPADL 73


>gi|66043467|ref|YP_233308.1| Mg chelatase-related protein [Pseudomonas syringae pv. syringae
          B728a]
 gi|63254174|gb|AAY35270.1| Mg chelatase-related protein [Pseudomonas syringae pv. syringae
          B728a]
          Length = 497

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  +++GL F  
Sbjct: 3  LAIVHSRAQVGVEAPAVTVEAHLANGLPALTLVGLPEGAVKESKDRVRSAILNSGLDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|253573507|ref|ZP_04850850.1| magnesium-chelatase [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251847035|gb|EES75040.1| magnesium-chelatase [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 539

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  ++ +    GI G+ +EV+V +S G     IVGLPD AV E+ +R+++   + G  F 
Sbjct: 1  MYGKLHSACLYGIDGVIIEVEVDLSSGIPQTSIVGLPDSAVREAIDRVRAAIKNCGYRF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PLQRVTINLAPADL 73


>gi|237747066|ref|ZP_04577546.1| competence protein comM [Oxalobacter formigenes HOxBLS]
 gi|229378417|gb|EEO28508.1| competence protein comM [Oxalobacter formigenes HOxBLS]
          Length = 505

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+V ++ G     IVGLP+  V E+++R+++   +A      
Sbjct: 3  LAILKSRALSGMEAPEVTVEVHLANGLPAFTIVGLPETEVKEAKDRVRAAIQNARF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITVNLAPADL 74


>gi|163782487|ref|ZP_02177484.1| hypothetical protein HG1285_16425 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882060|gb|EDP75567.1| hypothetical protein HG1285_16425 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 508

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
            ++ +    GI G  V+V+V +SPG     IVGLPD A+ ES+ER++S   + G  F  
Sbjct: 3  FVKVKSGGIWGIDGYEVDVEVDISPGIPSFNIVGLPDSAIKESKERVRSAIKNVGFSF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     ++
Sbjct: 61 ---PQKRITVNLSPSNV 74


>gi|213970711|ref|ZP_03398836.1| Mg chelatase-related protein [Pseudomonas syringae pv. tomato T1]
 gi|301382598|ref|ZP_07231016.1| Mg chelatase-related protein [Pseudomonas syringae pv. tomato
          Max13]
 gi|302059225|ref|ZP_07250766.1| Mg chelatase-related protein [Pseudomonas syringae pv. tomato
          K40]
 gi|302133617|ref|ZP_07259607.1| Mg chelatase-related protein [Pseudomonas syringae pv. tomato
          NCPPB 1108]
 gi|213924545|gb|EEB58115.1| Mg chelatase-related protein [Pseudomonas syringae pv. tomato T1]
          Length = 497

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  +++GL F  
Sbjct: 3  LAIVHSRAQVGVEAPAVTVEAHLTNGLPALTLVGLPEGAVKESKDRVRSAILNSGLDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|154244292|ref|YP_001415250.1| Mg chelatase, subunit ChlI [Xanthobacter autotrophicus Py2]
 gi|154158377|gb|ABS65593.1| Mg chelatase, subunit ChlI [Xanthobacter autotrophicus Py2]
          Length = 510

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 49/78 (62%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI R++T+AF+G+   PV+VQV V+ G     IVGLPDKAV E+RER+++  I +GL   
Sbjct: 1  MIQRVATVAFEGVDARPVDVQVHVAAGLPAFTIVGLPDKAVSEARERVRAALIASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPARRITVNLAPADL 73


>gi|75674317|ref|YP_316738.1| Mg chelatase-related protein [Nitrobacter winogradskyi Nb-255]
 gi|74419187|gb|ABA03386.1| Mg chelatase-related protein [Nitrobacter winogradskyi Nb-255]
          Length = 512

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 50/78 (64%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ R+ST+AF+GI+   V+VQV V+PG     IVGLPDKAV E+RER+++  I +GL   
Sbjct: 1  MVQRVSTVAFEGIEARAVDVQVQVAPGLPAFNIVGLPDKAVSEARERVRAALIASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPARRITVNLAPADL 73


>gi|317131423|ref|YP_004090737.1| Mg chelatase, subunit ChlI [Ethanoligenens harbinense YUAN-3]
 gi|315469402|gb|ADU26006.1| Mg chelatase, subunit ChlI [Ethanoligenens harbinense YUAN-3]
          Length = 506

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +++ ++   G+    V+V+  +S G     IVGLPD AV E+RER++S   ++G  F 
Sbjct: 1  MFAQLKSLGLYGMDAFVVDVEADISQGLPAFDIVGLPDAAVREARERVRSSMKNSGYSF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 60 ----PVSRITVNLAPADI 73


>gi|315648153|ref|ZP_07901254.1| Sigma 54 interacting domain protein [Paenibacillus vortex V453]
 gi|315276799|gb|EFU40142.1| Sigma 54 interacting domain protein [Paenibacillus vortex V453]
          Length = 532

 Score =  111 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 22/85 (25%), Positives = 42/85 (49%), Gaps = 5/85 (5%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  ++ +    GI G+ ++V+V ++ G     I+GLPD ++ ES ER+++   + G  + 
Sbjct: 1  MYGKLHSACLHGIDGVVIQVEVDLANGLPQTAIIGLPDSSIRESVERVRAAIKNCGFTY- 59

Query: 61 VNELPSIYLQLIYQKKDLIMIYLSF 85
              P   + +     DL  +  SF
Sbjct: 60 ----PLKRVTINLAPADLRKVGSSF 80


>gi|300692688|ref|YP_003753683.1| ATPase, Mg chelatase-related protein [Ralstonia solanacearum
          PSI07]
 gi|299079748|emb|CBJ52424.1| putative ATPase, Mg chelatase-related protein [Ralstonia
          solanacearum PSI07]
          Length = 510

 Score =  111 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  GI    V V+V ++ G     IVGLPD  V ES++R+++   ++      
Sbjct: 3  LAVLRSRALAGIDAPAVSVEVHLANGLPTFTIVGLPDTEVKESKDRVRAAIQNSRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPTRRITVNLAPADL 74


>gi|165918282|ref|ZP_02218368.1| Mg chelatase homolog [Coxiella burnetii RSA 334]
 gi|165918142|gb|EDR36746.1| Mg chelatase homolog [Coxiella burnetii RSA 334]
          Length = 500

 Score =  111 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + +    GI   PV V+V +S G     IVGLP+ AV ESR R++S  I++ L    
Sbjct: 3  LAIVHSRGSAGIDAPPVTVEVHISNGMPVFSIVGLPETAVKESRHRVRSAIINSQL---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|145297224|ref|YP_001140065.1| ComM-related protein [Aeromonas salmonicida subsp. salmonicida
          A449]
 gi|142849996|gb|ABO88317.1| ComM-related protein [Aeromonas salmonicida subsp. salmonicida
          A449]
          Length = 504

 Score =  111 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  GI    V V+V +S G     +VGLP+ +V ESR+R++S  ++       
Sbjct: 3  LAVVYSRASLGIAAPQVTVEVHLSNGLPAFNMVGLPETSVKESRDRVRSALLNGNF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E PS ++ +     DL
Sbjct: 59 -EFPSKHITVNLAPADL 74


>gi|146313648|ref|YP_001178722.1| putative ATP-dependent protease [Enterobacter sp. 638]
 gi|145320524|gb|ABP62671.1| Mg chelatase, subunit ChlI [Enterobacter sp. 638]
          Length = 506

 Score =  111 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G++   + V+V +S G  G+ +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 3  LSVVYTRAALGVQAPLISVEVHLSNGLPGLTLVGLPETTVKEARDRVRSAIINSGYTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKKITVNLAPADL 74


>gi|78183991|ref|YP_376426.1| Mg chelatase-related protein [Synechococcus sp. CC9902]
 gi|78168285|gb|ABB25382.1| Mg chelatase-related protein [Synechococcus sp. CC9902]
          Length = 523

 Score =  111 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 45/77 (58%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R  + +  G++  PV V+V ++PG  G+Q+VGL DKA+ ESRER++S   ++G    
Sbjct: 1  MLARCLSASLHGLEAKPVTVEVDLAPGLPGIQLVGLADKAIQESRERVRSALRNSGFRG- 59

Query: 61 VNELPSIYLQLIYQKKD 77
              P + + +     D
Sbjct: 60 ----PLVRVVINLAPAD 72


>gi|124265363|ref|YP_001019367.1| putative Mg(2+) chelatase family protein [Methylibium
           petroleiphilum PM1]
 gi|124258138|gb|ABM93132.1| putative MG(2+) chelatase family protein [Methylibium
           petroleiphilum PM1]
          Length = 534

 Score =  111 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 4/77 (5%)

Query: 2   ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           ++ + + A  G+    V V+V ++ G     +VGL D  V E+RER+++  +++GL F  
Sbjct: 32  LAVVHSRALDGLDAPEVTVEVHLANGLPSFTLVGLADTEVKEARERVRAALLNSGLAFPH 91

Query: 62  NELPSIYLQLIYQKKDL 78
           N+     + +     DL
Sbjct: 92  NQ----RITVNLAPADL 104


>gi|26250505|ref|NP_756545.1| hypothetical protein c4688 [Escherichia coli CFT073]
 gi|26110935|gb|AAN83119.1|AE016769_234 Hypothetical protein c4688 [Escherichia coli CFT073]
          Length = 109

 Score =  111 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 13 LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 68

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 69 -EYPAKKITINLAPADL 84


>gi|292493271|ref|YP_003528710.1| Mg chelatase, subunit ChlI [Nitrosococcus halophilus Nc4]
 gi|291581866|gb|ADE16323.1| Mg chelatase, subunit ChlI [Nitrosococcus halophilus Nc4]
          Length = 505

 Score =  111 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++   + A  G+    V V+V +S G     IVGLP+ AV ESR+R++   ++       
Sbjct: 3  LAIAYSRAQAGVDAPLVTVEVHLSNGLPAFSIVGLPETAVKESRDRVRGALLNCHF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITVNLAPADL 74


>gi|187732126|ref|YP_001882407.1| putative ATP-dependent protease [Shigella boydii CDC 3083-94]
 gi|187429118|gb|ACD08392.1| ATPase, AAA family [Shigella boydii CDC 3083-94]
          Length = 506

 Score =  111 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+  VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTKVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|331018579|gb|EGH98635.1| Mg chelatase-related protein [Pseudomonas syringae pv. lachrymans
          str. M302278PT]
          Length = 497

 Score =  111 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  +++GL F  
Sbjct: 3  LAIVHSRAQVGVEAPAVTVEAHLTNGLPALTLVGLPEGAVKESKDRVRSAILNSGLDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|296105340|ref|YP_003615486.1| putative ATP-dependent protease [Enterobacter cloacae subsp.
          cloacae ATCC 13047]
 gi|295059799|gb|ADF64537.1| putative ATP-dependent protease [Enterobacter cloacae subsp.
          cloacae ATCC 13047]
          Length = 506

 Score =  111 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+K   + V+V +S G  G+ +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 3  LSVVYTRAAIGVKAPLISVEVHLSNGLPGLTLVGLPETTVKEARDRVRSAIINSGYTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKKITINLAPADL 74


>gi|320331920|gb|EFW87858.1| Mg chelatase-related protein [Pseudomonas syringae pv. glycinea
          str. race 4]
          Length = 497

 Score =  111 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  +++GL F  
Sbjct: 3  LAIVHSRAQVGVEAPAVTVEAHLANGLPALTLVGLPEGAVKESKDRVRSAILNSGLDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|300714771|ref|YP_003739574.1| magnesium-chelatase [Erwinia billingiae Eb661]
 gi|299060607|emb|CAX57714.1| Probable magnesium-chelatase [Erwinia billingiae Eb661]
          Length = 506

 Score =  111 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S   T A  GI+   V V+V +S G   + +VGLP+  V E+R+R++S  I+ G  F  
Sbjct: 3  LSLAYTRAAIGIEAPLVLVEVHLSNGLPALSLVGLPETTVKEARDRVRSAIINCGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|293393489|ref|ZP_06637800.1| competence protein ComM [Serratia odorifera DSM 4582]
 gi|291424090|gb|EFE97308.1| competence protein ComM [Serratia odorifera DSM 4582]
          Length = 514

 Score =  111 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  G++   V V+V +S G   + +VGLP+  V E+R+R++S  ++ G  F  
Sbjct: 11 LAVVYTRALYGVQAPSVTVEVHISNGLPALALVGLPETTVKEARDRVRSALLNNGFTF-- 68

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 69 ---PAKRITVNLAPADL 82


>gi|332531875|ref|ZP_08407760.1| Mg(2+) chelatase family protein / ComM-like protein
          [Pseudoalteromonas haloplanktis ANT/505]
 gi|332038851|gb|EGI75293.1| Mg(2+) chelatase family protein / ComM-like protein
          [Pseudoalteromonas haloplanktis ANT/505]
          Length = 503

 Score =  111 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++RI + A  GI    V V+V +  G     IVGLP+ +V ES++R++S   ++   F  
Sbjct: 3  LARIFSRAQVGINAPEVIVEVHLGNGLPAFHIVGLPEASVKESKDRVRSALENSQFGF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PDQRITVNLAPADL 74


>gi|227486429|ref|ZP_03916745.1| ATPase [Anaerococcus lactolyticus ATCC 51172]
 gi|227235610|gb|EEI85625.1| ATPase [Anaerococcus lactolyticus ATCC 51172]
          Length = 509

 Score =  111 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S+ +T +  G++G  VEV+  ++ G     IVGLPD ++ ES++R++   +++   F 
Sbjct: 1  MYSKTNTTSLIGLEGKLVEVESDITSGIPAFNIVGLPDSSIKESKDRVRVALVNSSYKF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     DL
Sbjct: 60 ----PAGRITINLSPADL 73


>gi|114775405|ref|ZP_01450973.1| competence protein ComM [Mariprofundus ferrooxydans PV-1]
 gi|114553516|gb|EAU55897.1| competence protein ComM [Mariprofundus ferrooxydans PV-1]
          Length = 520

 Score =  111 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + + +G+    V+V+V +S G     +VGL + AV E+R+R+++  +++G    
Sbjct: 1  MLARLHSASLRGLDAEHVDVEVDLSRGLPCWTLVGLGEAAVREARDRVRAAVVNSGF--- 57

Query: 61 VNELPSIYLQLIYQKKD 77
            E P   + +     D
Sbjct: 58 --EFPLRRITVNLSPAD 72


>gi|325267571|ref|ZP_08134223.1| competence protein ComM [Kingella denitrificans ATCC 33394]
 gi|324980921|gb|EGC16581.1| competence protein ComM [Kingella denitrificans ATCC 33394]
          Length = 499

 Score =  111 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           + +++ A  G+    VEV+V ++ G     +VGLPD  V ESR+R+++  + +G     
Sbjct: 3  FAVVNSRALCGMNAPLVEVEVHLANGLPQCNLVGLPDTEVKESRDRVRAAILQSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPMQKITVNLAPADL 74


>gi|22298137|ref|NP_681384.1| competence protein ComM [Thermosynechococcus elongatus BP-1]
 gi|22294316|dbj|BAC08146.1| tlr0594 [Thermosynechococcus elongatus BP-1]
          Length = 509

 Score =  111 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + A  GI  IPV V+V VS G     +VGLPD  V E+RER+++   +AG  F 
Sbjct: 1  MLARVWSAAVVGIDAIPVGVEVDVSGGLPRTVVVGLPDAGVQEARERVRAAIRNAGFSF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PMGQILVNLTPADL 73


>gi|330952144|gb|EGH52404.1| Mg chelatase-related protein [Pseudomonas syringae Cit 7]
          Length = 497

 Score =  111 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  +++GL F  
Sbjct: 3  LAIVHSRAQVGVEAPAVTVEAHLANGLPALTLVGLPEGAVKESKDRVRSAILNSGLDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|254000287|ref|YP_003052350.1| Mg chelatase subunit ChlI [Methylovorus sp. SIP3-4]
 gi|253986966|gb|ACT51823.1| Mg chelatase, subunit ChlI [Methylovorus sp. SIP3-4]
          Length = 496

 Score =  111 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G+   PV+V+V ++ G     IVGLP+  V ES++R+++    A      
Sbjct: 3  LAVIKSRALCGMDAPPVDVEVHLANGLPSFTIVGLPEAEVKESKDRVRAALQTAQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITVNLAPADL 74


>gi|254430161|ref|ZP_05043864.1| Mg chelatase family protein [Cyanobium sp. PCC 7001]
 gi|197624614|gb|EDY37173.1| Mg chelatase family protein [Cyanobium sp. PCC 7001]
          Length = 513

 Score =  111 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R S+ A +G+    V V+V + PG   +Q+VGL D AV ESRER++S   H+G    
Sbjct: 1  MLARCSSAALRGLDAHQVTVEVDIGPGLPALQMVGLADAAVQESRERVRSALRHSGFR-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     DL
Sbjct: 59 ---VPLSRVVVNLAPADL 73


>gi|332089072|gb|EGI94183.1| competence protein comM [Shigella boydii 3594-74]
          Length = 460

 Score =  111 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+  VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTKVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|311281556|ref|YP_003943787.1| Sigma 54 interacting domain-containing protein [Enterobacter
          cloacae SCF1]
 gi|308750751|gb|ADO50503.1| Sigma 54 interacting domain protein [Enterobacter cloacae SCF1]
          Length = 506

 Score =  111 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  G+    + V+V +S G  G+ +VGLP+  V E+R+R++S  + +G     
Sbjct: 3  LAIVYTRAALGVHAPLITVEVHISNGLPGLTMVGLPETTVKEARDRVRSAILTSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKKITINLAPADL 74


>gi|307133022|ref|YP_003885038.1| MG(2+) chelatase family protein/ComM-related protein [Dickeya
          dadantii 3937]
 gi|306530551|gb|ADN00482.1| MG(2+) chelatase family protein / ComM-related protein [Dickeya
          dadantii 3937]
          Length = 508

 Score =  111 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++   T A  G++   V ++V +S G   + +VGLP+  V E+R+R++S  I+ G  F  
Sbjct: 3  LAVTYTRATIGMQAPEVSIEVHISNGLPALTLVGLPETTVKEARDRVRSALINCGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|315125243|ref|YP_004067246.1| regulator [Pseudoalteromonas sp. SM9913]
 gi|315013756|gb|ADT67094.1| regulator [Pseudoalteromonas sp. SM9913]
          Length = 503

 Score =  111 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++RI + A  GI    V V+V +  G     IVGLP+ +V E+++R++S   ++   F  
Sbjct: 3  LARIFSRAQVGINAPEVMVEVHLGNGLPAFHIVGLPEASVKEAKDRVRSALENSQFGF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PDQRITVNLAPADL 74


>gi|320322272|gb|EFW78368.1| Mg chelatase-related protein [Pseudomonas syringae pv. glycinea
          str. B076]
          Length = 497

 Score =  111 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  +++GL F  
Sbjct: 3  LAIVHSRAQVGVEAPAVTVEAHLANGLPALTLVGLPEGAVKESKDRVRSAILNSGLDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|330890908|gb|EGH23569.1| Mg chelatase-related protein [Pseudomonas syringae pv. mori str.
          301020]
          Length = 497

 Score =  111 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  +++GL F  
Sbjct: 3  LAIVHSRAQVGVEAPAVTVEAHLANGLPALTLVGLPEGAVKESKDRVRSAILNSGLDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|330831542|ref|YP_004394494.1| putative Mg chelatase [Aeromonas veronii B565]
 gi|328806678|gb|AEB51877.1| Putative Mg chelatase [Aeromonas veronii B565]
          Length = 504

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  GI    V V+V +S G     +VGLP+ +V ESR+R++S  ++       
Sbjct: 3  LAVVYSRASLGIAAPQVTVEVHLSNGLPAFNMVGLPETSVKESRDRVRSALLNGNF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E PS ++ +     DL
Sbjct: 59 -EFPSKHITVNLAPADL 74


>gi|320185428|gb|EFW60197.1| MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein [Shigella
          flexneri CDC 796-83]
          Length = 460

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+  VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTKVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|290477151|ref|YP_003470066.1| hypothetical protein XBJ1_4196 [Xenorhabdus bovienii SS-2004]
 gi|289176499|emb|CBJ83308.1| putative enzyme (N-terminal); transcriptional regulator with
          P-loop containing NTP hydrolase domain (C-terminal)
          [Xenorhabdus bovienii SS-2004]
          Length = 508

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  G+    V ++  +S G  G+ +VGLP+  V E+R+R++S  +++G  +  
Sbjct: 3  LAVIYTRATIGVDSPIVTIEAHISNGLPGLTLVGLPETTVKEARDRVRSALLNSGFTY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PPKRITVNLAPADL 74


>gi|51246120|ref|YP_066004.1| competence protein ComM [Desulfotalea psychrophila LSv54]
 gi|50877157|emb|CAG36997.1| probable competence protein ComM [Desulfotalea psychrophila
          LSv54]
          Length = 501

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 25/76 (32%), Positives = 41/76 (53%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +++ + A  GI G+P+EV+V ++ G     IVGLPD AV ESR+R++    + G  F 
Sbjct: 1  MHAKVLSCAVVGIDGLPIEVEVDIAKGIPQFFIVGLPDNAVRESRDRVKPAIKNCGYYF- 59

Query: 61 VNELPSIYLQLIYQKK 76
              P+  + +     
Sbjct: 60 ----PNRRITVNLAPA 71


>gi|119468294|ref|ZP_01611420.1| putative regulator [Alteromonadales bacterium TW-7]
 gi|119448287|gb|EAW29551.1| putative regulator [Alteromonadales bacterium TW-7]
          Length = 502

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++RI + A  GI    V V+V +  G     IVGLP+ +V ES++R++S   ++   F  
Sbjct: 3  LARIYSRAQVGINAPEVIVEVHLGTGLPAFHIVGLPEASVKESKDRVRSALENSQFGF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PDQRITVNLAPADL 74


>gi|152981227|ref|YP_001351854.1| Mg(2+) chelatase family protein [Janthinobacterium sp. Marseille]
 gi|151281304|gb|ABR89714.1| MG(2+) chelatase family protein [Janthinobacterium sp. Marseille]
          Length = 507

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ +++    G++   V V+V ++ G     IVGLP+  V ES++R+++   +AG     
Sbjct: 3  LAVLTSRGLSGMQAPEVTVEVHLANGLPSFTIVGLPETEVKESKDRVRAALQNAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITVNLAPADL 74


>gi|289646389|ref|ZP_06477732.1| Mg chelatase-related protein [Pseudomonas syringae pv. aesculi
          str. 2250]
          Length = 497

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  +++GL F  
Sbjct: 3  LAIVHSRAQVGVEAPAVTVEAHLANGLPALTLVGLPEGAVKESKDRVRSAILNSGLDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|320178058|gb|EFW53038.1| MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein [Shigella
          boydii ATCC 9905]
          Length = 142

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPTDL 74


>gi|158320505|ref|YP_001513012.1| Mg chelatase, subunit ChlI [Alkaliphilus oremlandii OhILAs]
 gi|158140704|gb|ABW19016.1| Mg chelatase, subunit ChlI [Alkaliphilus oremlandii OhILAs]
          Length = 507

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S+I T +  G+    +EV+V +S G   V +VGLPD A+ ES+ER+++   ++ L F 
Sbjct: 1  MLSKIKTCSIHGLSVTMIEVEVDISNGLPNVNVVGLPDVAIKESKERVRAAIKNSDLGF- 59

Query: 61 VNELPSIYLQLIYQKKD 77
              P   + +     D
Sbjct: 60 ----PLKRITINLSPAD 72


>gi|113971952|ref|YP_735745.1| Mg chelatase subunit ChlI [Shewanella sp. MR-4]
 gi|113886636|gb|ABI40688.1| Mg chelatase, subunit ChlI [Shewanella sp. MR-4]
          Length = 508

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I+ + T A  G++   V V+V +S G     +VGLP+ +V E+RER++S  I+AG     
Sbjct: 3  IACVQTRASCGVEAPEVIVEVHLSNGLPAFNLVGLPEASVKEARERVRSALINAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPMRRITVNLAPADL 74


>gi|82546121|ref|YP_410068.1| 2-component regulator [Shigella boydii Sb227]
 gi|81247532|gb|ABB68240.1| putative 2-component regulator [Shigella boydii Sb227]
          Length = 470

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+  VGLP+  V E+R+R++S  I++G     
Sbjct: 13 LSIVHTRAALGVNAPPITVEVHISKGLPGLTKVGLPETTVKEARDRVRSAIINSGY---- 68

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 69 -EYPAKKITINLAPADL 84


>gi|212633237|ref|YP_002309762.1| Mg chelatase-like protein [Shewanella piezotolerans WP3]
 gi|212554721|gb|ACJ27175.1| Mg chelatase-like protein [Shewanella piezotolerans WP3]
          Length = 508

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ ++T A  G+    V V+V +S G     +VGLP+ +V E++ER++S  I+AG     
Sbjct: 3  LACVATRASSGVDAPAVTVEVHLSNGLPAFSLVGLPEASVKEAKERVRSALINAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPMRRITVNLAPADL 74


>gi|310779324|ref|YP_003967657.1| Mg chelatase, subunit ChlI [Ilyobacter polytropus DSM 2926]
 gi|309748647|gb|ADO83309.1| Mg chelatase, subunit ChlI [Ilyobacter polytropus DSM 2926]
          Length = 501

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ +  F GI    VEV+V +S G     IVGL D A+ ESRER+++   + G    
Sbjct: 1  MLAKVLSSGFLGIDPYQVEVEVDISNGLPVFNIVGLADAAISESRERVKAAIKNCGFSMN 60

Query: 61 VNELPSIYLQLIYQKK 76
                  + +     
Sbjct: 61 -----PKRILVNLSPA 71


>gi|251787787|ref|YP_003002508.1| Mg chelatase subunit ChlI [Dickeya zeae Ech1591]
 gi|247536408|gb|ACT05029.1| Mg chelatase, subunit ChlI [Dickeya zeae Ech1591]
          Length = 508

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++   T A  G++   V ++V +S G   + +VGLP+  V E+R+R++S  I+ G  F  
Sbjct: 3  LAVTYTRATIGMQAPEVSIEVHISNGLPALTLVGLPETTVKEARDRVRSALINCGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|242241172|ref|YP_002989353.1| Mg chelatase, subunit ChlI [Dickeya dadantii Ech703]
 gi|242133229|gb|ACS87531.1| Mg chelatase, subunit ChlI [Dickeya dadantii Ech703]
          Length = 508

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++   T A  G++   V ++V +S G   + +VGLP+  V E+R+R++S  I+ G  F  
Sbjct: 3  LAVTYTRATLGMQAPEVSIEVHISNGLPALTLVGLPETTVKEARDRVRSALINCGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|330012138|ref|ZP_08307299.1| hypothetical protein HMPREF9538_05008 [Klebsiella sp. MS 92-3]
 gi|328533930|gb|EGF60590.1| hypothetical protein HMPREF9538_05008 [Klebsiella sp. MS 92-3]
          Length = 133

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  GI+   + V+V +S G  G+ +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 3  LAIVYTRAALGIEAPLITVEVHLSNGLPGLTMVGLPETTVKEARDRVRSALINSGYAF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKKITINLAPADL 74


>gi|170076988|ref|YP_001733626.1| AAA ATPase family protein [Synechococcus sp. PCC 7002]
 gi|169884657|gb|ACA98370.1| AAA ATPase family protein; Magnesium chelatase-related protein
          (ChlI-related) [Synechococcus sp. PCC 7002]
          Length = 509

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+++I +    G+  + V V+V +S G   + +VGLPD AV ESRER+++   ++G  F 
Sbjct: 1  MLAKIWSATIVGVDALRVGVEVDISGGLPKMMVVGLPDTAVQESRERVKAALKNSGFGF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PVRKILVNLTPADL 73


>gi|117619376|ref|YP_858629.1| putative Mg chelatase-like protein [Aeromonas hydrophila subsp.
          hydrophila ATCC 7966]
 gi|117560783|gb|ABK37731.1| putative Mg chelatase homolog [Aeromonas hydrophila subsp.
          hydrophila ATCC 7966]
          Length = 504

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V +S G     +VGLP+ +V ESR+R++S  ++       
Sbjct: 3  LAVVYSRASLGVAAPQVTVEVHLSNGLPAFNMVGLPETSVKESRDRVRSALLNGNF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E PS ++ +     DL
Sbjct: 59 -EFPSKHITVNLAPADL 74


>gi|271502430|ref|YP_003335456.1| Mg chelatase subunit ChlI [Dickeya dadantii Ech586]
 gi|270345985|gb|ACZ78750.1| Mg chelatase, subunit ChlI [Dickeya dadantii Ech586]
          Length = 508

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++   T A  G++   V ++V +S G   + +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 3  LAVTYTRATIGMQAPEVSIEVHISNGLPALTLVGLPETTVKEARDRVRSALINSGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|332084969|gb|EGI90151.1| competence protein comM [Shigella dysenteriae 155-74]
          Length = 506

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++      
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINS-----R 57

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 58 YEYPAKKITINLAPADL 74


>gi|56459326|ref|YP_154607.1| competence related ATPase with chaperone activity [Idiomarina
          loihiensis L2TR]
 gi|56178336|gb|AAV81058.1| Competence related ATPase with chaperone activity [Idiomarina
          loihiensis L2TR]
          Length = 515

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 41/77 (53%), Gaps = 4/77 (5%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++R+ T A  GI    + V+V ++ G  G  +VG+P   V E+R+R+++  ++AG  +  
Sbjct: 3  LARVYTRALIGIHAPEIRVEVDLARGMPGFTMVGMPATTVKEARDRVKTALMNAGFEYP- 61

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     D+
Sbjct: 62 ---PATRITVNLAPADI 75


>gi|194434613|ref|ZP_03066869.1| ATPase, AAA family [Shigella dysenteriae 1012]
 gi|194417132|gb|EDX33245.1| ATPase, AAA family [Shigella dysenteriae 1012]
          Length = 506

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++      
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINS-----R 57

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 58 YEYPAKKITINLAPADL 74


>gi|332975979|gb|EGK12852.1| competence protein ComM [Psychrobacter sp. 1501(2011)]
          Length = 525

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           +++ T +  G+    V V+V +S G   + IVGLP+ AV ES++R++S  I++   F  
Sbjct: 3  FAQVHTRSVVGLHAPKVMVEVHLSQGLPALTIVGLPEAAVRESKDRVRSALINSNFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  L +     DL
Sbjct: 61 ---PNRRLTINLAPADL 74


>gi|261250619|ref|ZP_05943194.1| ComM-related protein [Vibrio orientalis CIP 102891]
 gi|260939188|gb|EEX95175.1| ComM-related protein [Vibrio orientalis CIP 102891]
          Length = 507

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V V+V +S G  G  +VGLP+  V ESR+R++S  I+       
Sbjct: 3  LAVIHSRACVGVEAPAVTVEVHISNGMPGFALVGLPETTVKESRDRVRSAIINTRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAKRITVNLAPADL 74


>gi|297587982|ref|ZP_06946626.1| Mg chelatase-like protein [Finegoldia magna ATCC 53516]
 gi|297574671|gb|EFH93391.1| Mg chelatase-like protein [Finegoldia magna ATCC 53516]
          Length = 506

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S+++T   +G+ G  VE +  ++ G     IVGLPD ++ ES+ER++S   + G+ F 
Sbjct: 1  MYSKVNTCCLEGLNGYVVECECDLANGLRSFNIVGLPDTSIKESKERVRSAIENTGIRF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     +L
Sbjct: 60 ----PVKRITINLAPANL 73


>gi|261407999|ref|YP_003244240.1| Sigma 54 interacting domain-containing protein [Paenibacillus sp.
          Y412MC10]
 gi|261284462|gb|ACX66433.1| Sigma 54 interacting domain protein [Paenibacillus sp. Y412MC10]
          Length = 536

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  ++ +    GI G+ ++V+V ++ G     I+GLPD ++ ES ER+++   + G  + 
Sbjct: 1  MYGKLHSACLHGIDGVIIQVEVDLANGLPQTAIIGLPDSSIRESVERVRAAIKNCGFTY- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PLKRVTVNLAPADL 73


>gi|308051356|ref|YP_003914922.1| Mg chelatase, subunit ChlI [Ferrimonas balearica DSM 9799]
 gi|307633546|gb|ADN77848.1| Mg chelatase, subunit ChlI [Ferrimonas balearica DSM 9799]
          Length = 505

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +SR+ +    GI+   V V+V +  G     IVGLP+ +V ESRER+++    AG     
Sbjct: 3  LSRVLSRGQLGIEAPRVTVEVHLGGGLPSFTIVGLPEASVRESRERVRAALQMAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITVNLAPADL 74


>gi|302380310|ref|ZP_07268781.1| Mg chelatase-like protein [Finegoldia magna ACS-171-V-Col3]
 gi|302311915|gb|EFK93925.1| Mg chelatase-like protein [Finegoldia magna ACS-171-V-Col3]
          Length = 506

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S++ T   +G+ G  VE +  ++ G     IVGLPD ++ ES+ER++S   + G+ F 
Sbjct: 1  MYSKVKTCCLEGLNGYVVECECDLANGLRSFNIVGLPDTSIKESKERVRSAIENTGIRF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     +L
Sbjct: 60 ----PVKRITINLAPANL 73


>gi|269103793|ref|ZP_06156490.1| Mg(2+) chelatase family protein/ComM-related protein
          [Photobacterium damselae subsp. damselae CIP 102761]
 gi|268163691|gb|EEZ42187.1| Mg(2+) chelatase family protein/ComM-related protein
          [Photobacterium damselae subsp. damselae CIP 102761]
          Length = 331

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+V +S G     +VGLP+  V E+++R++S   +A      
Sbjct: 3  LAIVHSRACVGVQAPAVTVEVHLSNGMPSFTLVGLPETTVKEAKDRVRSAIFNANF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E PS  + +     DL
Sbjct: 59 -EFPSRRITVNLAPADL 74


>gi|284047856|ref|YP_003398195.1| Mg chelatase, subunit ChlI [Acidaminococcus fermentans DSM 20731]
 gi|283952077|gb|ADB46880.1| Mg chelatase, subunit ChlI [Acidaminococcus fermentans DSM 20731]
          Length = 507

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +R      +GI G  V V+V V+ G    ++VGLPD AV E+RER+++   ++G  F 
Sbjct: 1  MYARTWGETTRGINGEMVTVEVDVTNGMPAFEMVGLPDTAVKEARERVKAAVKNSGFRF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P  ++ +     DL
Sbjct: 60 ----PDTHITVNLAPADL 73


>gi|94309182|ref|YP_582392.1| Mg chelatase-related protein [Cupriavidus metallidurans CH34]
 gi|93353034|gb|ABF07123.1| Probable Mg chelatase-related protein [Cupriavidus metallidurans
          CH34]
          Length = 512

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  GI+  PV V++ ++ G     IVGL D  V ESRER+++  +++      
Sbjct: 3  LAVLRSRALTGIEAPPVSVEIHLANGLPAFNIVGLADTEVRESRERVRAALLNSEF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPNRRITVNLAPADL 74


>gi|254511020|ref|ZP_05123087.1| putative Mg chelatase [Rhodobacteraceae bacterium KLH11]
 gi|221534731|gb|EEE37719.1| putative Mg chelatase [Rhodobacteraceae bacterium KLH11]
          Length = 504

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R  T+AFQG+   PVEVQ  VSPG     IVGLPDKAV E+R+R++S         +
Sbjct: 1  MVARAHTVAFQGVDARPVEVQCAVSPGLPAFSIVGLPDKAVSEARDRVRSALSS-----M 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 56 AIALPSKRITINLAPADL 73


>gi|329929313|ref|ZP_08283066.1| Mg chelatase-like protein [Paenibacillus sp. HGF5]
 gi|328936682|gb|EGG33125.1| Mg chelatase-like protein [Paenibacillus sp. HGF5]
          Length = 537

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  ++ +    GI G+ ++V+V ++ G     I+GLPD ++ ES ER+++   + G  + 
Sbjct: 1  MYGKLHSACLHGIDGVIIQVEVDLANGLPQTAIIGLPDSSIRESVERVRAAIKNCGFTY- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PLKRVTVNLAPADL 73


>gi|237749219|ref|ZP_04579699.1| competence protein comM [Oxalobacter formigenes OXCC13]
 gi|229380581|gb|EEO30672.1| competence protein comM [Oxalobacter formigenes OXCC13]
          Length = 506

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 18/77 (23%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V ++ G     IVGL +  V E+++R+++   +A      
Sbjct: 3  LAILKSRALAGMDAPEVTVEVHLANGLPSFTIVGLAETEVKEAKDRVRAAIQNARF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITVNLAPADL 74


>gi|119776420|ref|YP_929160.1| magnesium chelatase family protein [Shewanella amazonensis SB2B]
 gi|119768920|gb|ABM01491.1| magnesium chelatase family protein [Shewanella amazonensis SB2B]
          Length = 508

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I+ ++T A  G++   V V+V ++ G     +VGLP+ +V E+RER++S  ++AG     
Sbjct: 3  IACVATRASLGVEAPAVTVEVHLANGLPAFNLVGLPEASVKEARERVRSALVNAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPMRRITVNLAPADL 74


>gi|297617123|ref|YP_003702282.1| Mg chelatase, subunit ChlI [Syntrophothermus lipocalidus DSM
          12680]
 gi|297144960|gb|ADI01717.1| Mg chelatase, subunit ChlI [Syntrophothermus lipocalidus DSM
          12680]
          Length = 513

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ ++++  QGI+   VEV+V +  G     IVGL  ++V E++ER++S   +AGL F 
Sbjct: 1  MLAVVNSLVLQGIEARTVEVEVDIHSGLPSFDIVGLASQSVREAKERVRSAIKNAGLKF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 60 ----PLERITVNLAPADI 73


>gi|127511217|ref|YP_001092414.1| Mg chelatase, subunit ChlI [Shewanella loihica PV-4]
 gi|126636512|gb|ABO22155.1| Mg chelatase, subunit ChlI [Shewanella loihica PV-4]
          Length = 506

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I+ ++T A  G+    V V+V +S G     +VGLP+ +V E++ER++S  I+AG     
Sbjct: 3  IACVTTRASLGVAAPEVTVEVHLSNGLPAFSLVGLPETSVKEAKERVRSALINAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPQRRITVNLAPADL 74


>gi|307690743|ref|ZP_07633189.1| Mg chelatase, subunit ChlI [Clostridium cellulovorans 743B]
          Length = 503

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 40/74 (54%), Gaps = 5/74 (6%)

Query: 5  ISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNEL 64
          +++  F GI G+ V+V+V +S G     IVGL   AV E++ER++S  +++G      E 
Sbjct: 3  LNSATFNGIDGVIVQVEVDISRGLPSFTIVGLATTAVKEAKERVRSAIVNSGF-----EF 57

Query: 65 PSIYLQLIYQKKDL 78
          P   + +     D+
Sbjct: 58 PMGRIVINLSPADI 71


>gi|169823765|ref|YP_001691376.1| putative ATPase ComM [Finegoldia magna ATCC 29328]
 gi|167830570|dbj|BAG07486.1| putative ATPase ComM with chaperone activity [Finegoldia magna
          ATCC 29328]
          Length = 506

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S++ T   +G+ G  VE +  ++ G     IVGLPD ++ ES+ER++S   + G+ F 
Sbjct: 1  MYSKVKTCCLEGLNGYVVECECDLANGLRSFNIVGLPDTSIKESKERVRSAIENTGIRF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     +L
Sbjct: 60 ----PVKRITINLAPANL 73


>gi|241667730|ref|ZP_04755308.1| magnesium chelatase [Francisella philomiragia subsp. philomiragia
          ATCC 25015]
          Length = 502

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  GI+   V ++V +S G  G+ IVGLP+ AV ES++R++S  I++G  F  
Sbjct: 3  LAILKSRAQLGIEAPLVSIEVHLSNGLPGLSIVGLPEAAVKESKDRVRSAIINSGFNF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PNKRITINLALADL 74


>gi|82701259|ref|YP_410825.1| Mg(2+) chelatase family protein [Nitrosospira multiformis ATCC
          25196]
 gi|82409324|gb|ABB73433.1| probable Mg(2+) chelatase family protein [Nitrosospira
          multiformis ATCC 25196]
          Length = 229

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+V ++ G  G  IVGLP+  V ES++R+++   +       
Sbjct: 3  LAVLYSRAIAGMEAPLVTVEVHIANGLPGFTIVGLPEAEVKESKDRVRAALQNTRF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPPRRITVNLAPADL 74


>gi|328951764|ref|YP_004369098.1| Mg chelatase, subunit ChlI [Desulfobacca acetoxidans DSM 11109]
 gi|328452088|gb|AEB07917.1| Mg chelatase, subunit ChlI [Desulfobacca acetoxidans DSM 11109]
          Length = 509

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI+++ + + +G+ G  VEV+V ++ G      VGL + AV ES++R+++   ++G  F 
Sbjct: 1  MIAKVKSGSLRGVDGFLVEVEVDIAFGMPAFTTVGLAEIAVKESKDRVKAAIKNSGYQF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              PS  + +     D+
Sbjct: 60 ----PSTRVTINLAPADV 73


>gi|77165470|ref|YP_343995.1| Mg chelatase-related protein [Nitrosococcus oceani ATCC 19707]
 gi|254433670|ref|ZP_05047178.1| Mg chelatase family protein [Nitrosococcus oceani AFC27]
 gi|76883784|gb|ABA58465.1| Mg chelatase-related protein [Nitrosococcus oceani ATCC 19707]
 gi|207090003|gb|EDZ67274.1| Mg chelatase family protein [Nitrosococcus oceani AFC27]
          Length = 505

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++   + A  G+    V V+  +S G     IVGLP+ AV ESRER++   ++       
Sbjct: 3  LAIAYSRAQAGLDAPLVTVEAHLSNGLPAFSIVGLPETAVKESRERVRGALLNCHF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITVNLAPADL 74


>gi|303235386|ref|ZP_07322003.1| Mg chelatase-like protein [Finegoldia magna BVS033A4]
 gi|302493507|gb|EFL53296.1| Mg chelatase-like protein [Finegoldia magna BVS033A4]
          Length = 506

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S++ T   +G+ G  VE +  ++ G     IVGLPD ++ ES+ER++S   + G+ F 
Sbjct: 1  MYSKVKTCCLEGLNGYVVECECDLANGLRSFNIVGLPDASIKESKERVRSAIENTGIRF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     +L
Sbjct: 60 ----PVKRITINLAPANL 73


>gi|320176011|gb|EFW51080.1| MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein [Shigella
          dysenteriae CDC 74-1112]
          Length = 386

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+  VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTKVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|295098737|emb|CBK87827.1| Predicted ATPase with chaperone activity [Enterobacter cloacae
          subsp. cloacae NCTC 9394]
          Length = 506

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+K   + V+V +S G  G+ +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 3  LSVVYTRAAIGVKAPLISVEVHLSNGLPGLTLVGLPETTVKEARDRVRSAIINSGYAF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKKITINLAPADL 74


>gi|146280895|ref|YP_001171048.1| magnesium chelatase subunit D/I family protein [Pseudomonas
          stutzeri A1501]
 gi|145569100|gb|ABP78206.1| magnesium chelatase, subunit D/I family [Pseudomonas stutzeri
          A1501]
          Length = 498

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  + +G  F  
Sbjct: 3  LAIVHSRAQIGVEAPAVTVEAHLANGLPALTLVGLPETAVKESKDRVRSAILTSGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|327479164|gb|AEA82474.1| magnesium chelatase subunit D/I family protein [Pseudomonas
          stutzeri DSM 4166]
          Length = 498

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  + +G  F  
Sbjct: 3  LAIVHSRAQIGVEAPAVTVEAHLANGLPALTLVGLPETAVKESKDRVRSAILTSGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|254428168|ref|ZP_05041875.1| Mg chelatase family protein [Alcanivorax sp. DG881]
 gi|196194337|gb|EDX89296.1| Mg chelatase family protein [Alcanivorax sp. DG881]
          Length = 497

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 5/76 (6%)

Query: 3  SRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVN 62
          + + + A  GI+   V V+  ++PG     IVGL D AV ESR+R++S  +++G  F   
Sbjct: 4  ALLYSRAPIGIEARTVRVETHLAPGLPAFTIVGLGDTAVRESRDRVRSALVNSGFDF--- 60

Query: 63 ELPSIYLQLIYQKKDL 78
            P   + +     DL
Sbjct: 61 --PQRRITVSLAPADL 74


>gi|134093428|ref|YP_001098503.1| competence protein comM [Herminiimonas arsenicoxydans]
 gi|133737331|emb|CAL60374.1| Competence protein ComM [Herminiimonas arsenicoxydans]
          Length = 507

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V ++ G     IVGLP+  V ES++R+++   +AG     
Sbjct: 3  LAVLKSRALAGMLAPEVTVEVHLANGLPQFTIVGLPETEVKESKDRVRAALQNAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITVNLAPADL 74


>gi|254515512|ref|ZP_05127572.1| putative Mg chelatase [gamma proteobacterium NOR5-3]
 gi|219675234|gb|EED31600.1| putative Mg chelatase [gamma proteobacterium NOR5-3]
          Length = 496

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 5/76 (6%)

Query: 3  SRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVN 62
          + + + A QG+    V V+V +S G     +VG+P+ AV ES++R++S  I++       
Sbjct: 4  AVVLSRANQGLNAPLVRVEVHLSNGLPAFTVVGMPETAVRESKDRVRSALINSHF----- 58

Query: 63 ELPSIYLQLIYQKKDL 78
          E P   + +     DL
Sbjct: 59 EFPDRRITVNLAPADL 74


>gi|126666576|ref|ZP_01737554.1| putative competence related protein [Marinobacter sp. ELB17]
 gi|126628964|gb|EAZ99583.1| putative competence related protein [Marinobacter sp. ELB17]
          Length = 511

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ + T A  G+   PV V+V +S G   + IVGLP+  V ES+ER++S  I+AG  F 
Sbjct: 1  MLAIVQTRACVGVSAPPVSVEVHLSGGLPALSIVGLPETGVRESKERVRSALINAGFDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     DL
Sbjct: 60 ----PARRITINLAPADL 73


>gi|302386226|ref|YP_003822048.1| Mg chelatase, subunit ChlI [Clostridium saccharolyticum WM1]
 gi|302196854|gb|ADL04425.1| Mg chelatase, subunit ChlI [Clostridium saccharolyticum WM1]
          Length = 515

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S++ ++  +G++G+P+ V+  VS G  G  +VG     V E+++R+++   ++G    
Sbjct: 1  MYSKVHSVGIKGVEGVPILVEADVSEGLPGFSMVGYLSSEVKEAQDRVRTALKNSGFR-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     D+
Sbjct: 59 ---LPARKITINLSPADI 73


>gi|291612534|ref|YP_003522691.1| Mg chelatase, subunit ChlI [Sideroxydans lithotrophicus ES-1]
 gi|291582646|gb|ADE10304.1| Mg chelatase, subunit ChlI [Sideroxydans lithotrophicus ES-1]
          Length = 496

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + +    G+    V V+V ++ G     IVGLP+  V ES++R+++   +       
Sbjct: 3  LAVLYSRGLAGMDAALVTVEVHLANGLPNFTIVGLPEAEVKESKDRVRAALQNCQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E PS  + +     DL
Sbjct: 59 -EFPSRRITVNLAPADL 74


>gi|86610144|ref|YP_478906.1| Mg chelatase-like protein [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86558686|gb|ABD03643.1| Mg chelatase-like protein [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 516

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M ++++  A  G++ + V V+V V  G   + +VGLPD AV E++ER+++   ++G    
Sbjct: 1  MFAQVTAAALLGLRAVQVTVEVDVGGGLPQITLVGLPDTAVQEAKERVRAAIKNSGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 58 --ALPQRRIIVNLAPADL 73


>gi|300721409|ref|YP_003710680.1| hypothetical protein XNC1_0366 [Xenorhabdus nematophila ATCC
          19061]
 gi|297627897|emb|CBJ88443.1| putative enzyme (N-terminal); transcriptional regulator with
          P-loop containing NTP hydrolase domain (C-terminal)
          [Xenorhabdus nematophila ATCC 19061]
          Length = 508

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S I T A  GI    V ++  +S G  G+ +VGLP+  V E+R+R++S  +++G  +  
Sbjct: 3  LSVIRTRATIGIDSPLVTIEAHISNGLPGLTLVGLPETTVKEARDRVRSALLNSGFTY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PPKRITVNLAPADL 74


>gi|227325847|ref|ZP_03829871.1| magnesium-chelatase [Pectobacterium carotovorum subsp.
          carotovorum WPP14]
          Length = 507

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++   T A  G++   V ++V +S G   + +VGLP+  V E+R+R++S  I+ G  F  
Sbjct: 3  LAVTYTRAMIGVQAPDVYIEVHISSGLPALTLVGLPETTVKEARDRVRSALINCGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|195953207|ref|YP_002121497.1| Mg chelatase, subunit ChlI [Hydrogenobaculum sp. Y04AAS1]
 gi|195932819|gb|ACG57519.1| Mg chelatase, subunit ChlI [Hydrogenobaculum sp. Y04AAS1]
          Length = 504

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M   I +    GI+GI V V++ VS G     IVGLPD A+ ES+ER++S  I+ G  F 
Sbjct: 1  MFFEIISGGLLGIEGIKVTVEIDVSNGLPSFNIVGLPDVAIKESKERVRSSLINKGFGF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     +L
Sbjct: 60 ----PPKRITINLSPSNL 73


>gi|320161169|ref|YP_004174393.1| Mg chelatase-related protein [Anaerolinea thermophila UNI-1]
 gi|319995022|dbj|BAJ63793.1| Mg chelatase-related protein [Anaerolinea thermophila UNI-1]
          Length = 507

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 44/76 (57%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + A  G+ G+ VEV+V   PG  G+ IVGLPD AV ESRER+QS   + GLLF 
Sbjct: 1  MLARVYSCAVIGLDGVLVEVEVDTGPGLPGMVIVGLPDTAVQESRERVQSAIKNTGLLF- 59

Query: 61 VNELPSIYLQLIYQKK 76
              P   + +     
Sbjct: 60 ----PRKRVTVNLAPA 71


>gi|322834963|ref|YP_004214990.1| Mg chelatase, subunit ChlI [Rahnella sp. Y9602]
 gi|321170164|gb|ADW75863.1| Mg chelatase, subunit ChlI [Rahnella sp. Y9602]
          Length = 511

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  G++   V ++V +S G   + +VGLP+  V E+R+R++S  I+ G  F  
Sbjct: 3  LAVVYTRASLGVQAPGVSIEVHISNGLPALTLVGLPETTVKEARDRVRSAIINCGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|253579632|ref|ZP_04856901.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251849133|gb|EES77094.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 510

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M + + + A  G++  PV+V+  VS G     +VG P   V E++ER+++   + G  F 
Sbjct: 1  MFASVLSAAIFGVEVCPVQVEADVSNGLPSFIMVGFPSAQVKEAQERVRTALKNNGYQF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + + +   D+
Sbjct: 60 ----PPKRITVNFAPADM 73


>gi|260431480|ref|ZP_05785451.1| putative Mg chelatase family protein [Silicibacter
          lacuscaerulensis ITI-1157]
 gi|260415308|gb|EEX08567.1| putative Mg chelatase family protein [Silicibacter
          lacuscaerulensis ITI-1157]
          Length = 504

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 46/78 (58%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R  T+AFQG++  PVEVQ  VSPG     IVGLPDKAV E+RER++S         +
Sbjct: 1  MVARAHTVAFQGVEARPVEVQCAVSPGLPAFSIVGLPDKAVSEARERVRSALSA-----M 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 56 AIALPSKRITINLSPADL 73


>gi|254519204|ref|ZP_05131260.1| Mg chelatase [Clostridium sp. 7_2_43FAA]
 gi|226912953|gb|EEH98154.1| Mg chelatase [Clostridium sp. 7_2_43FAA]
          Length = 507

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M   I +    G+ GI + V+V ++ G     IVGLPD ++ ES+ER++S  +++G    
Sbjct: 1  MSIEIISATHNGLDGILINVEVDINKGMPSFTIVGLPDASIKESKERVRSAIVNSGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     D+
Sbjct: 58 --EFPLGRITINLAPADI 73


>gi|70733306|ref|YP_263080.1| Mg-chelatase subunits D/I family, ComM subfamily protein
          [Pseudomonas fluorescens Pf-5]
 gi|68347605|gb|AAY95211.1| Mg-chelatase subunits D/I family, ComM subfamily protein
          [Pseudomonas fluorescens Pf-5]
          Length = 497

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V V+V ++ G   + +VGLP+ AV ES++R++S  ++AG  F  
Sbjct: 3  LAIIHSRAQVGVQAPAVSVEVHLANGLPSLTLVGLPEAAVKESKDRVRSAILNAGFNF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|313679101|ref|YP_004056840.1| mg chelatase, subunit chli [Oceanithermus profundus DSM 14977]
 gi|313151816|gb|ADR35667.1| Mg chelatase, subunit ChlI [Oceanithermus profundus DSM 14977]
          Length = 497

 Score =  110 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R  +    G+  +PV V+  VSPG  G  +VGLPD AV ESR+R+++   ++G  + 
Sbjct: 1  MLARARSFTLHGLDALPVVVEADVSPGFPGFTVVGLPDAAVNESRDRVRAALKNSGFPY- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P + + +     +L
Sbjct: 60 ----PQMRIVVNLAPAEL 73


>gi|307943372|ref|ZP_07658716.1| putative Mg chelatase family protein [Roseibium sp. TrichSKD4]
 gi|307773002|gb|EFO32219.1| putative Mg chelatase family protein [Roseibium sp. TrichSKD4]
          Length = 508

 Score =  110 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 38/78 (48%), Positives = 51/78 (65%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+SR++T+AFQGI+ +PV+VQV V PG V   IVGLPDKAV ESRER++     +GL   
Sbjct: 1  MVSRVTTVAFQGIEAVPVDVQVQVGPGMVAFTIVGLPDKAVGESRERVRGALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPAKRVTVNLAPADL 73


>gi|227357198|ref|ZP_03841566.1| ATPase [Proteus mirabilis ATCC 29906]
 gi|227162639|gb|EEI47609.1| ATPase [Proteus mirabilis ATCC 29906]
          Length = 515

 Score =  110 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  GI    + ++  +S G  G+ +VGLP+  V E+++R++S  I++G  +  
Sbjct: 8  LAVIYTRASLGISAPLITIEAHISQGLPGLTLVGLPETVVKEAKDRVRSALINSGYSY-- 65

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 66 ---PAKRITINLSPADL 79


>gi|124022024|ref|YP_001016331.1| hypothetical protein P9303_03131 [Prochlorococcus marinus str.
          MIT 9303]
 gi|123962310|gb|ABM77066.1| Hypothetical protein P9303_03131 [Prochlorococcus marinus str.
          MIT 9303]
          Length = 528

 Score =  110 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R  + +  GI+ + V V+V + PG  G+Q+VGLPD A+ ESRER++S   ++G    
Sbjct: 1  MLARCLSGSLHGIEALAVTVEVDLVPGLPGLQLVGLPDAAIQESRERVRSALRNSGFRG- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P + + +     DL
Sbjct: 60 ----PLVRVVVNLAPADL 73


>gi|315924787|ref|ZP_07921004.1| competence protein ComM [Pseudoramibacter alactolyticus ATCC
          23263]
 gi|315621686|gb|EFV01650.1| competence protein ComM [Pseudoramibacter alactolyticus ATCC
          23263]
          Length = 504

 Score =  110 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+++I +    G++GI V V+V ++ G  G  +VGLPD  + ES+ER+ S   ++GL + 
Sbjct: 1  MLAQIKSCGLLGVEGILVTVEVDINNGLPGYAVVGLPDAGIKESKERVFSALKNSGLRY- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PLKRITVNLAPADL 73


>gi|289625463|ref|ZP_06458417.1| Mg chelatase-related protein [Pseudomonas syringae pv. aesculi
          str. NCPPB3681]
 gi|330866510|gb|EGH01219.1| Mg chelatase-related protein [Pseudomonas syringae pv. aesculi
          str. 0893_23]
          Length = 497

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  +++GL F  
Sbjct: 3  LAIVHSRAQVGVEAPAVNVEAHLANGLPALTLVGLPEGAVKESKDRVRSAILNSGLDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|85714072|ref|ZP_01045061.1| Mg chelatase-related protein [Nitrobacter sp. Nb-311A]
 gi|85699198|gb|EAQ37066.1| Mg chelatase-related protein [Nitrobacter sp. Nb-311A]
          Length = 518

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 50/78 (64%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ R+ST+AF+GI+   V+VQV V+PG     IVGLPDKAV E+RER+++  I +GL   
Sbjct: 7  MVQRVSTVAFEGIEARAVDVQVQVAPGLPAFSIVGLPDKAVSEARERVRAALIASGL--- 63

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 64 --ALPARRITVNLAPADL 79


>gi|148654156|ref|YP_001281249.1| Mg chelatase subunit ChlI [Psychrobacter sp. PRwf-1]
 gi|148573240|gb|ABQ95299.1| Mg chelatase, subunit ChlI [Psychrobacter sp. PRwf-1]
          Length = 530

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           +++ T +  G+    V V+V +S G   + IVGLP+ AV ES++R++S  I++   F  
Sbjct: 18 FAQVHTRSVVGLHAPKVRVEVHLSQGLPALTIVGLPEAAVRESKDRVRSALINSDFQF-- 75

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  L +     DL
Sbjct: 76 ---PNRRLTINLAPADL 89


>gi|238918056|ref|YP_002931570.1| hypothetical protein NT01EI_0075 [Edwardsiella ictaluri 93-146]
 gi|238867624|gb|ACR67335.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 506

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  GI+   V ++  +  G  G  +VGLP+ AV E+++R++   +++G  F  
Sbjct: 3  LATVYTRAALGIQAPEVRIEAHIGNGLPGFTLVGLPETAVREAKDRVRCAMLNSGFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + L     DL
Sbjct: 61 ---PPKRITLNLAPADL 74


>gi|269137444|ref|YP_003294144.1| putative ATPase with chaperone activity [Edwardsiella tarda
          EIB202]
 gi|267983104|gb|ACY82933.1| putative ATPase with chaperone activity [Edwardsiella tarda
          EIB202]
 gi|304557518|gb|ADM40182.1| Mg(2+) Chelatase family protein [Edwardsiella tarda FL6-60]
          Length = 506

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  GI+   V ++  +  G  G  +VGLP+ AV E+++R++   +++G  F  
Sbjct: 3  LATVYTRAALGIQAPEVRIEAHIGNGLPGFTLVGLPETAVREAKDRVRCAMLNSGFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + L     DL
Sbjct: 61 ---PPKRITLNLAPADL 74


>gi|197287110|ref|YP_002152982.1| magnesium-chelatase [Proteus mirabilis HI4320]
 gi|194684597|emb|CAR46466.1| putative magnesium-chelatase [Proteus mirabilis HI4320]
          Length = 510

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  GI    + ++  +S G  G+ +VGLP+  V E+++R++S  I++G  +  
Sbjct: 3  LAVIYTRASLGISAPLITIEAHISQGLPGLTLVGLPETVVKEAKDRVRSALINSGYSY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITINLSPADL 74


>gi|73667120|ref|YP_303136.1| Mg chelatase-related protein [Ehrlichia canis str. Jake]
 gi|72394261|gb|AAZ68538.1| Mg chelatase-related protein [Ehrlichia canis str. Jake]
          Length = 506

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI+++ ++AF GI  I VEVQ+ ++ G     IVGLPDKA+ ESRERI++      L   
Sbjct: 1  MIAQVKSVAFYGINTINVEVQIHIAKGIPAFNIVGLPDKAIAESRERIRAALNSINL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 58 --SLPSQRITINLSPADL 73


>gi|166364485|ref|YP_001656758.1| competence protein ComM-like protein [Microcystis aeruginosa
          NIES-843]
 gi|166086858|dbj|BAG01566.1| competence protein ComM homolog [Microcystis aeruginosa NIES-843]
          Length = 508

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + A  GI  I + V+V VS G  G+ +VGLPD AV ES+ER+++   +AG  F 
Sbjct: 1  MLARVWSAAIIGIDAIKIGVEVDVSGGLPGIAVVGLPDTAVQESKERVKASLKNAGFAF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 60 ----PIRKIVINLSPADI 73


>gi|50123150|ref|YP_052317.1| magnesium-chelatase [Pectobacterium atrosepticum SCRI1043]
 gi|49613676|emb|CAG77127.1| probable magnesium-chelatase [Pectobacterium atrosepticum
          SCRI1043]
          Length = 508

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++   T A  G++   V ++V +S G   + +VGLP+  V E+R+R++S  I+ G  F  
Sbjct: 3  LAVTYTRAMIGVQAPDVYIEVHISSGLPALTLVGLPETTVKEARDRVRSALINCGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|171060613|ref|YP_001792962.1| Mg chelatase subunit ChlI [Leptothrix cholodnii SP-6]
 gi|170778058|gb|ACB36197.1| Mg chelatase, subunit ChlI [Leptothrix cholodnii SP-6]
          Length = 504

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 4/77 (5%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+V ++ G     +VGL D  V E+RER+++   ++GL F  
Sbjct: 3  LAVVHSRALIGLQAPDVTVEVHLANGLPSFTLVGLADTEVKEARERVRAALQNSGLEFPH 62

Query: 62 NELPSIYLQLIYQKKDL 78
          N      + +     DL
Sbjct: 63 N----KRITVNLAPADL 75


>gi|158425966|ref|YP_001527258.1| Mg chelatase-related protein [Azorhizobium caulinodans ORS 571]
 gi|158332855|dbj|BAF90340.1| Mg chelatase-related protein [Azorhizobium caulinodans ORS 571]
          Length = 510

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 50/78 (64%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI R++T+AF+G++  PV+VQV V+ G     IVGLPDKAV E++ER+++  I +GL   
Sbjct: 1  MIQRVATVAFEGVEARPVDVQVHVAAGLPAFTIVGLPDKAVTEAKERVRAALIASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPARRITVNLAPADL 73


>gi|116750063|ref|YP_846750.1| Mg chelatase subunit ChlI [Syntrophobacter fumaroxidans MPOB]
 gi|116699127|gb|ABK18315.1| Mg chelatase, subunit ChlI [Syntrophobacter fumaroxidans MPOB]
          Length = 508

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI++  T +  GI  I VEV+V +S G      VGLPD  V ES++R+++   ++G  F 
Sbjct: 1  MIAKTYTCSLLGIDAILVEVEVDLSSGLPCFSTVGLPDNIVRESKDRVKTALQNSGYSF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +      L
Sbjct: 60 ----PRERITVNLAPAHL 73


>gi|86606663|ref|YP_475426.1| Mg chelatase-like protein [Synechococcus sp. JA-3-3Ab]
 gi|86555205|gb|ABD00163.1| Mg chelatase-like protein [Synechococcus sp. JA-3-3Ab]
          Length = 516

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M ++++  A  G+K + V V+V V  G   + +VGLPD AV E++ER+++   ++G    
Sbjct: 1  MFAQVTAAALVGLKAVGVTVEVDVGGGLPQITLVGLPDTAVQEAKERVRAAIKNSGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 58 --ALPQRRIIVNLAPADL 73


>gi|218296072|ref|ZP_03496841.1| Mg chelatase, subunit ChlI [Thermus aquaticus Y51MC23]
 gi|218243449|gb|EED09978.1| Mg chelatase, subunit ChlI [Thermus aquaticus Y51MC23]
          Length = 494

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ + A  G+  +PV V+V VSPG     +VGLPDKAV ESRER+++   +AG  + 
Sbjct: 1  MLAQVRSYALYGLDAVPVTVEVDVSPGLPSYALVGLPDKAVEESRERVRAALKNAGFPY- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     +L
Sbjct: 60 ----PQARVVVNLAPAEL 73


>gi|159028304|emb|CAO87202.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 508

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + A  GI  I + V+V VS G  G+ +VGLPD AV ES+ER+++   +AG  F 
Sbjct: 1  MLARVWSAAIIGIDAIKIGVEVDVSGGLPGIAVVGLPDTAVQESKERVKASLKNAGFAF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 60 ----PIRKIVINLSPADI 73


>gi|15895042|ref|NP_348391.1| ATPase, competence protein ComM [Clostridium acetobutylicum ATCC
          824]
 gi|15024735|gb|AAK79731.1|AE007685_7 ATPase, possible competence protein ComM [Clostridium
          acetobutylicum ATCC 824]
 gi|325509179|gb|ADZ20815.1| ATPase, possible competence protein ComM [Clostridium
          acetobutylicum EA 2018]
          Length = 506

 Score =  110 bits (276), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 25/74 (33%), Positives = 37/74 (50%), Gaps = 5/74 (6%)

Query: 5  ISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNEL 64
          + + +  GI G  V V++ VS G     IVGL D AV ESRER+++  I++G  F     
Sbjct: 6  LKSASLTGINGFMVSVEIDVSKGLPAFNIVGLADAAVRESRERVRAAIINSGFKF----- 60

Query: 65 PSIYLQLIYQKKDL 78
          P   + +      L
Sbjct: 61 PVCRITINLAPASL 74


>gi|224823833|ref|ZP_03696942.1| Mg chelatase, subunit ChlI [Lutiella nitroferrum 2002]
 gi|224604288|gb|EEG10462.1| Mg chelatase, subunit ChlI [Lutiella nitroferrum 2002]
          Length = 500

 Score =  110 bits (276), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+V ++ G     IVGLPD  V ESR+R+++  + +G  F  
Sbjct: 3  LAIVHSRALSGMEASEVSVEVHMANGLPAFAIVGLPDTEVKESRDRVRAAILTSGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PARKITVNLAPADL 74


>gi|121603036|ref|YP_980365.1| Mg chelatase subunit ChlI [Polaromonas naphthalenivorans CJ2]
 gi|120592005|gb|ABM35444.1| Mg chelatase, subunit ChlI [Polaromonas naphthalenivorans CJ2]
          Length = 515

 Score =  110 bits (276), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 4/77 (5%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + + A  G++  PV V+V ++ G     +VGL D  V E+RER++S   +AGL F  
Sbjct: 3  LSLVHSRALLGLQAHPVCVEVHLANGLPSFTLVGLADTEVKEARERVRSAIQNAGLEFPG 62

Query: 62 NELPSIYLQLIYQKKDL 78
          N      + +     DL
Sbjct: 63 N----KRITVNLAPADL 75


>gi|83649032|ref|YP_437467.1| chaperone activity ATPase [Hahella chejuensis KCTC 2396]
 gi|83637075|gb|ABC33042.1| predicted ATPase with chaperone activity [Hahella chejuensis KCTC
          2396]
          Length = 348

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ ++T A  G++   V+V+  +S G   + IVGLP+ AV ES++R++S  +++G     
Sbjct: 3  LAIVNTRAKLGVEAPLVKVEAHLSNGLPALSIVGLPEAAVKESKDRVRSALLNSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITINLAPADL 74


>gi|261381353|ref|ZP_05985926.1| Mg chelatase-like protein [Neisseria subflava NJ9703]
 gi|284795667|gb|EFC51014.1| Mg chelatase-like protein [Neisseria subflava NJ9703]
          Length = 498

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+ +++  I +G  F  
Sbjct: 3  LALVYSRALSGMNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDCVRAAIIQSGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKKITVNLAPADL 74


>gi|225180954|ref|ZP_03734402.1| Mg chelatase, subunit ChlI [Dethiobacter alkaliphilus AHT 1]
 gi|225168435|gb|EEG77238.1| Mg chelatase, subunit ChlI [Dethiobacter alkaliphilus AHT 1]
          Length = 510

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ ++     GI+G  V+V+V +S       IVGLPD AV E+R+R+++   ++G  F 
Sbjct: 1  MLATVTGCTVVGIEGRLVDVEVYLSAQLPSFDIVGLPDTAVREARDRVRAAVKNSGFSF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PQQRIIVNLAPADL 73


>gi|30248217|ref|NP_840287.1| Mg(2+) chelatase family protein [Nitrosomonas europaea ATCC
          19718]
 gi|30180102|emb|CAD84104.1| probable Mg(2+) chelatase family protein [Nitrosomonas europaea
          ATCC 19718]
          Length = 500

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V +S G     IVGLP+  V ES++R+ +  ++    F  
Sbjct: 3  LAILYSRALCGMDAPLVTVEVHLSNGLPKFTIVGLPETEVRESKDRVHAAILNGRFKF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PARRITVNLAPADL 74


>gi|221635423|ref|YP_002523299.1| putative Mg chelatase homolog [Thermomicrobium roseum DSM 5159]
 gi|221158023|gb|ACM07141.1| putative Mg chelatase homolog [Thermomicrobium roseum DSM 5159]
          Length = 505

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 47/78 (60%), Gaps = 4/78 (5%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ + + A  G++G+ VEV+V + PG  G+ IVGLPD AV E+RER+++   ++G  F 
Sbjct: 1  MLACVHSSAVVGLEGVLVEVEVDIGPGNPGLTIVGLPDAAVQEARERVRAAIRNSGARFP 60

Query: 61 VNELPSIYLQLIYQKKDL 78
          +    S  + +     D+
Sbjct: 61 L----SGRITVNLAPADI 74


>gi|300309427|ref|YP_003773519.1| Mg(2+) chelatase family protein [Herbaspirillum seropedicae SmR1]
 gi|300072212|gb|ADJ61611.1| Mg(2+) chelatase family protein [Herbaspirillum seropedicae SmR1]
          Length = 507

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+   PV V+V ++ G     IVGLP+  V E+R+R+++   +A      
Sbjct: 3  LAVLRSRALAGMNAPPVTVEVHLANGLPSFAIVGLPEAEVKEARDRVRAALQNARF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITVNLAPADL 74


>gi|330501228|ref|YP_004378097.1| Mg chelatase subunit ChlI [Pseudomonas mendocina NK-01]
 gi|328915514|gb|AEB56345.1| Mg chelatase, subunit ChlI [Pseudomonas mendocina NK-01]
          Length = 497

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  ++A      
Sbjct: 3  LAIVHSRAQVGVEAPAVTVEAHLANGLPSLTLVGLPETAVKESKDRVRSAILNAAF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E PS  + L     DL
Sbjct: 59 -EFPSKRITLNLAPADL 74


>gi|296113739|ref|YP_003627677.1| competence protein comM [Moraxella catarrhalis RH4]
 gi|295921433|gb|ADG61784.1| competence protein comM [Moraxella catarrhalis RH4]
 gi|326562089|gb|EGE12417.1| competence protein comM [Moraxella catarrhalis 7169]
 gi|326563344|gb|EGE13610.1| competence protein comM [Moraxella catarrhalis 103P14B1]
 gi|326564619|gb|EGE14839.1| competence protein comM [Moraxella catarrhalis 12P80B1]
 gi|326566976|gb|EGE17108.1| competence protein comM [Moraxella catarrhalis BC1]
 gi|326571995|gb|EGE21998.1| competence protein comM [Moraxella catarrhalis BC7]
 gi|326572214|gb|EGE22209.1| competence protein comM [Moraxella catarrhalis BC8]
 gi|326573761|gb|EGE23718.1| competence protein comM [Moraxella catarrhalis 101P30B1]
 gi|326574556|gb|EGE24496.1| competence protein comM [Moraxella catarrhalis O35E]
          Length = 504

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           +++ T +  G++   V V+V +S G   + IVGLP+ +V ES++R++S  I++G     
Sbjct: 3  FAKVFTRSVVGLQAPQVFVEVHLSQGLPALTIVGLPEASVRESKDRVRSALINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  L +     DL
Sbjct: 59 -EFPNRRLTINLAPADL 74


>gi|261823448|ref|YP_003261554.1| Mg chelatase, subunit ChlI [Pectobacterium wasabiae WPP163]
 gi|261607461|gb|ACX89947.1| Mg chelatase, subunit ChlI [Pectobacterium wasabiae WPP163]
          Length = 508

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++   T A  G++   V ++V +S G   + +VGLP+  V E+R+R++S  I+ G  F  
Sbjct: 3  LAVTYTRAMIGVQAPDVYIEVHISSGLPALTLVGLPETTVKEARDRVRSALINCGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|227114369|ref|ZP_03828025.1| magnesium-chelatase [Pectobacterium carotovorum subsp.
          brasiliensis PBR1692]
          Length = 508

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++   T A  G++   V ++V +S G   + +VGLP+  V E+R+R++S  I+ G  F  
Sbjct: 3  LAVTYTRAMIGVQAPDVYIEVHISSGLPALTLVGLPETTVKEARDRVRSALINCGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|326572948|gb|EGE22927.1| competence protein comM [Moraxella catarrhalis CO72]
          Length = 504

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           +++ T +  G++   V V+V +S G   + IVGLP+ +V ES++R++S  I++G     
Sbjct: 3  FAKVFTRSVVGLQAPQVFVEVHLSQGLPALTIVGLPEASVRESKDRVRSALINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  L +     DL
Sbjct: 59 -EFPNRRLTINLAPADL 74


>gi|260072700|gb|ACX30597.1| predicted ATPase [uncultured SUP05 cluster bacterium]
          Length = 501

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +++I T A  G+    V ++V +S G     IVGLP+ AV ES++R++S  +++   F  
Sbjct: 4  LAKIFTRASTGMDAPLVTIEVHISGGLPSFTIVGLPEGAVKESKDRVRSALMNSNFKF-- 61

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     +L
Sbjct: 62 ---PKGRITVSLAPANL 75


>gi|326561702|gb|EGE12038.1| competence protein comM [Moraxella catarrhalis 46P47B1]
          Length = 504

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           +++ T +  G++   V V+V +S G   + IVGLP+ +V ES++R++S  I++G     
Sbjct: 3  FAKVFTRSVVGLQAPQVFVEVHLSQGLPALTIVGLPEASVRESKDRVRSALINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  L +     DL
Sbjct: 59 -EFPNRRLTINLAPADL 74


>gi|311105456|ref|YP_003978309.1| magnesium chelatase subunit ChlI family protein 2 [Achromobacter
          xylosoxidans A8]
 gi|310760145|gb|ADP15594.1| magnesium chelatase, subunit ChlI family protein 2 [Achromobacter
          xylosoxidans A8]
          Length = 509

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ +++ A  G+    V V+  + PG     +VGLPD  V ESRER+++  +++G     
Sbjct: 3  LAVLASRALCGLDAHAVRVETHLGPGLPSFNVVGLPDTEVRESRERVRAAILNSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     D+
Sbjct: 59 -EFPPGRITVNLSPADI 74


>gi|218894393|ref|YP_002443263.1| putative magnesium chelatase [Pseudomonas aeruginosa LESB58]
 gi|296392149|ref|ZP_06881624.1| putative magnesium chelatase [Pseudomonas aeruginosa PAb1]
 gi|218774622|emb|CAW30439.1| putative magnesium chelatase [Pseudomonas aeruginosa LESB58]
          Length = 497

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  ++AG  F  
Sbjct: 3  LAIVHSRAQVGVEAPCVSVEAHLANGLPSLTLVGLPETAVRESKDRVRSALLNAGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|90421841|ref|YP_530211.1| Mg chelatase-related protein [Rhodopseudomonas palustris BisB18]
 gi|90103855|gb|ABD85892.1| Mg chelatase-related protein [Rhodopseudomonas palustris BisB18]
          Length = 512

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 50/78 (64%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ R++T+AF+GI+   V+VQV V+PG     +VGLPDKAV E+RER++S  I +GL   
Sbjct: 1  MVQRVTTVAFEGIEARAVDVQVQVAPGLPAFYLVGLPDKAVSEARERVRSALIASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPARRITVNLAPADL 73


>gi|107104391|ref|ZP_01368309.1| hypothetical protein PaerPA_01005467 [Pseudomonas aeruginosa
          PACS2]
          Length = 497

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  ++AG  F  
Sbjct: 3  LAIVHSRAQVGVEAPCVSVEAHLANGLPSLTLVGLPETAVRESKDRVRSALLNAGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|313895668|ref|ZP_07829224.1| magnesium chelatase, subunit ChlI [Selenomonas sp. oral taxon 137
          str. F0430]
 gi|312975794|gb|EFR41253.1| magnesium chelatase, subunit ChlI [Selenomonas sp. oral taxon 137
          str. F0430]
          Length = 509

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M ++       GI G  ++V+V VSPG  G ++VGLPD +V ES+ER+++   ++G+   
Sbjct: 1  MFAKTYGATTLGIDGRIIDVEVDVSPGLPGFELVGLPDTSVKESKERVRTAIRNSGM--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            +L    + +     D+
Sbjct: 58 --QLRQERVTVNLAPADV 73


>gi|153810946|ref|ZP_01963614.1| hypothetical protein RUMOBE_01336 [Ruminococcus obeum ATCC 29174]
 gi|149832834|gb|EDM87917.1| hypothetical protein RUMOBE_01336 [Ruminococcus obeum ATCC 29174]
          Length = 513

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M + + + A  G+   P++V+  VS G     +VG P   V E+++R+++   + G    
Sbjct: 8  MFASVLSAAILGMDVHPIQVEADVSDGLPTFTMVGFPSAQVKEAQDRVRTALKNNG---- 63

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + + +   D+
Sbjct: 64 -IALPPKRITVNFAPADI 80


>gi|85858679|ref|YP_460881.1| ATPase related to magnesium chelatase subunit [Syntrophus
          aciditrophicus SB]
 gi|85721770|gb|ABC76713.1| ATPase related to magnesium chelatase subunit [Syntrophus
          aciditrophicus SB]
          Length = 509

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ ++S+    GI   PV V+V V+ G      VGLPD AV ES++RI++   ++G  F 
Sbjct: 1  MMVKVSSATLIGIDSYPVVVEVDVASGLPQFSTVGLPDTAVRESKDRIRAAIRNSGYSF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P  ++ +     D+
Sbjct: 60 ----PRNHVTVNLAPADI 73


>gi|116053438|ref|YP_793764.1| putative magnesium chelatase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115588659|gb|ABJ14674.1| putative magnesium chelatase [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 497

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  ++AG  F  
Sbjct: 3  LAIVHSRAQVGVEAPCVSVEAHLANGLPSLTLVGLPETAVRESKDRVRSALLNAGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|163846939|ref|YP_001634983.1| Mg chelatase subunit ChlI [Chloroflexus aurantiacus J-10-fl]
 gi|222524763|ref|YP_002569234.1| Mg chelatase subunit ChlI [Chloroflexus sp. Y-400-fl]
 gi|163668228|gb|ABY34594.1| Mg chelatase, subunit ChlI [Chloroflexus aurantiacus J-10-fl]
 gi|222448642|gb|ACM52908.1| Mg chelatase, subunit ChlI [Chloroflexus sp. Y-400-fl]
          Length = 505

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ + A  G+ G+ V V+V V  G     +VGL D AV ESRER++S   ++G+ F 
Sbjct: 1  MLAKVLSCAVIGLDGVLVAVEVDVLSGLPAFSVVGLGDAAVHESRERVRSAVRNSGMSF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   +       DL
Sbjct: 60 ----PMRRITANLAPADL 73


>gi|220936249|ref|YP_002515148.1| Mg chelatase-related protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997559|gb|ACL74161.1| Mg chelatase-related protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 525

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ +   A  GI   PV+++V ++ G     IVGLP+ AV ESRER+++  I +G     
Sbjct: 7  LATLYARALDGIHAPPVQIEVHLANGLPACAIVGLPEAAVRESRERVRAALITSGF---- 62

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 63 -EFPARRITVNLAPADL 78


>gi|17231580|ref|NP_488128.1| competence protein [Nostoc sp. PCC 7120]
 gi|17133223|dbj|BAB75787.1| competence protein [Nostoc sp. PCC 7120]
          Length = 509

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + +  GI  + V V+V +S G  G+ ++GLPD AV ES+ER+++   +AG  F 
Sbjct: 1  MLARVWSASIVGIDAVKVGVEVDISGGLPGIVVLGLPDSAVQESKERVKATLKNAGFAF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PMRKIVINLTPADL 73


>gi|254243823|ref|ZP_04937145.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|126197201|gb|EAZ61264.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
          Length = 497

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  ++AG  F  
Sbjct: 3  LAIVHSRAQVGVEAPCVSVEAHLANGLPSLTLVGLPETAVRESKDRVRSALLNAGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|15600483|ref|NP_253977.1| hypothetical protein PA5290 [Pseudomonas aeruginosa PAO1]
 gi|9951604|gb|AAG08675.1|AE004941_8 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
          Length = 497

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  ++AG  F  
Sbjct: 3  LAIVHSRAQVGVEAPCVSVEAHLANGLPSLTLVGLPETAVRESKDRVRSALLNAGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|312135871|ref|YP_004003209.1| Mg chelatase subunit ChlI [Caldicellulosiruptor owensensis OL]
 gi|311775922|gb|ADQ05409.1| Mg chelatase, subunit ChlI [Caldicellulosiruptor owensensis OL]
          Length = 510

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ T ++ GIKG  V V+  +S G     IVGLPD  + E++ERI+    ++G  F 
Sbjct: 1  MLAKVLTSSYLGIKGYIVTVETDISNGLPSFDIVGLPDVTIKEAKERIRVAIKNSGFDF- 59

Query: 61 VNELPSIYLQLIYQKK 76
              P+  + +     
Sbjct: 60 ----PTRKIVVNLAPA 71


>gi|300854484|ref|YP_003779468.1| putative ATPase [Clostridium ljungdahlii DSM 13528]
 gi|300434599|gb|ADK14366.1| putative ATPase with chaperone activity [Clostridium ljungdahlii
          DSM 13528]
          Length = 505

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  +++T +F G++G  V V+V +  G     IVGL D +V ES+ER+++  I++G    
Sbjct: 1  MAVKLNTASFLGVEGNIVSVEVDIERGLPCFNIVGLADTSVKESKERVKASIINSGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     D+
Sbjct: 58 --EFPVKKIIVNLAPADM 73


>gi|153206962|ref|ZP_01945780.1| Mg chelatase homolog [Coxiella burnetii 'MSU Goat Q177']
 gi|212219530|ref|YP_002306317.1| magnesium chelatase subunit-like ATPase [Coxiella burnetii
          CbuK_Q154]
 gi|120577035|gb|EAX33659.1| Mg chelatase homolog [Coxiella burnetii 'MSU Goat Q177']
 gi|212013792|gb|ACJ21172.1| magnesium chelatase subunit-like ATPase [Coxiella burnetii
          CbuK_Q154]
          Length = 500

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + +    GI   PV V+V +S G     IVGLP+ AV ESR R++S  I++ L    
Sbjct: 3  LAIVHSRGSAGIDAPPVTVEVHISNGMPVFSIVGLPETAVKESRHRVRSAIINSQL---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRIAVNLAPADL 74


>gi|308068639|ref|YP_003870244.1| Competence protein comM [Paenibacillus polymyxa E681]
 gi|305857918|gb|ADM69706.1| Competence protein comM [Paenibacillus polymyxa E681]
          Length = 539

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  ++      GI G+ +EV+  +S G     I+GLPD A+ E+ ER+++   + G  + 
Sbjct: 1  MYGKLHGACLYGIDGVLIEVETDLSNGLPQTAIIGLPDSAIREAVERVRAAIKNCGFKY- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              PS  + +     DL
Sbjct: 60 ----PSQRVTINLAPADL 73


>gi|110835393|ref|YP_694252.1| magnesium chelatase-like protein [Alcanivorax borkumensis SK2]
 gi|110648504|emb|CAL17980.1| magnesium chelatase-related protein, putative [Alcanivorax
          borkumensis SK2]
          Length = 498

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 5/76 (6%)

Query: 3  SRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVN 62
          + + + A  GI+   V V+  ++PG     IVGL D AV ESR+R++S  +++G  F   
Sbjct: 4  ALLYSRAPVGIEARTVRVETHLAPGLPAFTIVGLGDTAVRESRDRVRSALVNSGFDF--- 60

Query: 63 ELPSIYLQLIYQKKDL 78
            P   + +     DL
Sbjct: 61 --PQRRITVSLAPADL 74


>gi|92115776|ref|YP_575505.1| Mg chelatase-related protein [Nitrobacter hamburgensis X14]
 gi|91798670|gb|ABE61045.1| Mg chelatase-related protein [Nitrobacter hamburgensis X14]
          Length = 215

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 51/78 (65%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ R+ST+AF+GI+G  V+VQV V+PG     IVGLPDKAV E+RER+++  I +GL   
Sbjct: 1  MVQRVSTVAFEGIEGRVVDVQVQVAPGLPAFNIVGLPDKAVSEARERVRAALIASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPARRITVNLAPADL 73


>gi|226946787|ref|YP_002801860.1| Mg chelatase-like protein [Azotobacter vinelandii DJ]
 gi|226721714|gb|ACO80885.1| Mg chelatase-related protein [Azotobacter vinelandii DJ]
          Length = 498

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  + +G  F  
Sbjct: 3  LAIVHSRAQVGVEAPAVTVEAHLANGLPALTLVGLPETAVRESKDRVRSAILTSGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|75907039|ref|YP_321335.1| Mg chelatase-like protein [Anabaena variabilis ATCC 29413]
 gi|75700764|gb|ABA20440.1| Mg chelatase-related protein [Anabaena variabilis ATCC 29413]
          Length = 509

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + +  GI  + V V+V +S G  G+ ++GLPD AV ES+ER+++   +AG  F 
Sbjct: 1  MLARVWSASIVGIDAVKVGVEVDISGGLPGIVVLGLPDSAVQESKERVKATLKNAGFAF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PMRKIVINLTPADL 73


>gi|225023483|ref|ZP_03712675.1| hypothetical protein EIKCOROL_00341 [Eikenella corrodens ATCC
          23834]
 gi|224943723|gb|EEG24932.1| hypothetical protein EIKCOROL_00341 [Eikenella corrodens ATCC
          23834]
          Length = 181

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G  F  
Sbjct: 3  LAVVYSRALSGMAAPLVEVEAHLANGLPVFNIVGLPDTEVKESRDRVRAAIIQSGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKKITVNLAPADL 74


>gi|253690394|ref|YP_003019584.1| Mg chelatase, subunit ChlI [Pectobacterium carotovorum subsp.
          carotovorum PC1]
 gi|251756972|gb|ACT15048.1| Mg chelatase, subunit ChlI [Pectobacterium carotovorum subsp.
          carotovorum PC1]
          Length = 508

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++   T A  G++   V ++V +S G   + +VGLP+  V E+R+R++S  I+ G  F  
Sbjct: 3  LAVTYTRAMIGVQAPDVYIEVHISSGLPALTLVGLPETTVKEARDRVRSALINCGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|71734072|ref|YP_272484.1| Mg-chelatase subunits D/I family, ComM subfamily protein
          [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|71554625|gb|AAZ33836.1| Mg-chelatase subunits D/I family, ComM subfamily protein
          [Pseudomonas syringae pv. phaseolicola 1448A]
          Length = 287

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  +++GL F  
Sbjct: 3  LAIVHSRAQVGVEAPAVTVEAHLANGLPALTLVGLPEGAVKESKDRVRSAILNSGLDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|146337388|ref|YP_001202436.1| transcriptional regulator [Bradyrhizobium sp. ORS278]
 gi|146190194|emb|CAL74186.1| putative enzyme (N-terminal); transcriptional regulator with
          P-loop containing NTP hydrolase domain
          (C-terminal)(yifB) [Bradyrhizobium sp. ORS278]
          Length = 512

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 50/78 (64%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ R+ST+AF+GI+   V+VQV V+PG     IVGLPDKAV E+RER++S  I +GL   
Sbjct: 1  MVQRVSTVAFEGIEARAVDVQVQVAPGLPAFAIVGLPDKAVSEARERVRSALIASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     D+
Sbjct: 58 --ALPARRITVNLAPADV 73


>gi|163785799|ref|ZP_02180288.1| predicted ATPase with chaperone activity [Hydrogenivirga sp.
          128-5-R1-1]
 gi|159878932|gb|EDP72947.1| predicted ATPase with chaperone activity [Hydrogenivirga sp.
          128-5-R1-1]
          Length = 354

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S I +    GI G  V+V+V VS G      VGLPD AV ES+ER++S  + +G  F 
Sbjct: 1  MLSVIKSSGVLGIDGYIVDVEVNVSKGLPQFITVGLPDTAVKESKERVKSAVVSSGFNF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              PS  + +     ++
Sbjct: 60 ----PSKKIVVNLAPANV 73


>gi|329895334|ref|ZP_08270959.1| MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein [gamma
          proteobacterium IMCC3088]
 gi|328922347|gb|EGG29691.1| MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein [gamma
          proteobacterium IMCC3088]
          Length = 499

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S I   A  GI    V V+  +S G  G  +VG+P+  V ES++R++S  I++   F  
Sbjct: 3  LSVIKARALVGIDAPLVRVETHLSSGLPGFNLVGMPETTVRESKDRVRSAIINSHFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PDAKITVNLAPADL 74


>gi|74316255|ref|YP_313995.1| Mg chelatase-like protein [Thiobacillus denitrificans ATCC 25259]
 gi|74055750|gb|AAZ96190.1| Mg chelatase-related protein [Thiobacillus denitrificans ATCC
          25259]
          Length = 495

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+  ++ G     +VGLP+  V E+R+R+++   +AG     
Sbjct: 3  VAVVKSRALAGMNAPEVVVEAHLANGLPAFTLVGLPETEVKEARDRVRAAIQNAGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITVNLAPADL 74


>gi|254781028|ref|YP_003065441.1| putative Mg2+ chelatase family protein [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040705|gb|ACT57501.1| putative Mg2+ chelatase family protein [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 87

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 87/87 (100%), Positives = 87/87 (100%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL
Sbjct: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60

Query: 61 VNELPSIYLQLIYQKKDLIMIYLSFLH 87
          VNELPSIYLQLIYQKKDLIMIYLSFLH
Sbjct: 61 VNELPSIYLQLIYQKKDLIMIYLSFLH 87


>gi|294637915|ref|ZP_06716184.1| Mg chelatase-like protein [Edwardsiella tarda ATCC 23685]
 gi|291088941|gb|EFE21502.1| Mg chelatase-like protein [Edwardsiella tarda ATCC 23685]
          Length = 515

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  G++   V ++  +  G  G  +VGLP+ AV E+++R++   +++G  F  
Sbjct: 12 LASVYTRAALGMQAPEVRIEAHIGNGLPGFTLVGLPETAVREAKDRVRCAILNSGFQF-- 69

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 70 ---PAKRITLNLAPADL 83


>gi|71066679|ref|YP_265406.1| magnesium chelatase-related protein [Psychrobacter arcticus
          273-4]
 gi|71039664|gb|AAZ19972.1| probable magnesium chelatase-related protein [Psychrobacter
          arcticus 273-4]
          Length = 516

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           +++ T +  G+    V ++V +S G   + IVGLP+ AV ES++R++S  +++G  F  
Sbjct: 3  FAQVYTRSVVGLHAPKVIIEVHLSQGLPALTIVGLPEAAVRESKDRVRSAILNSGFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  L +     DL
Sbjct: 61 ---PNRRLTINLAPADL 74


>gi|310828092|ref|YP_003960449.1| hypothetical protein ELI_2504 [Eubacterium limosum KIST612]
 gi|308739826|gb|ADO37486.1| hypothetical protein ELI_2504 [Eubacterium limosum KIST612]
          Length = 510

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S+I + +  GI+G  V V++ V  G     +VGLPD  V ES+ER+ S   ++G  + 
Sbjct: 1  MLSQIHSCSLLGIEGQIVTVEIDVLNGLPSYVLVGLPDTGVKESKERVYSALKNSGYSY- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PMKKITINLAPADL 73


>gi|310641530|ref|YP_003946288.1| mg chelatase, subunit chli [Paenibacillus polymyxa SC2]
 gi|309246480|gb|ADO56047.1| Mg chelatase, subunit ChlI [Paenibacillus polymyxa SC2]
          Length = 539

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  ++      GI G+ +EV+  +S G     I+GLPD A+ E+ ER+++   + G  + 
Sbjct: 1  MYGKLHGACLYGIDGVLIEVETDLSNGLPQTAIIGLPDSAIREAVERVRAAIKNCGFKY- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              PS  + +     DL
Sbjct: 60 ----PSQRVTINLAPADL 73


>gi|148251755|ref|YP_001236340.1| putative enzyme [Bradyrhizobium sp. BTAi1]
 gi|146403928|gb|ABQ32434.1| putative enzyme [Bradyrhizobium sp. BTAi1]
          Length = 512

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 50/78 (64%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ R+ST+AF+GI+   V+VQV V+PG     IVGLPDKAV E+RER++S  I +GL   
Sbjct: 1  MVQRVSTVAFEGIEARAVDVQVQVAPGLPAFAIVGLPDKAVSEARERVRSALIASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     D+
Sbjct: 58 --ALPARRITVNLAPADV 73


>gi|93007271|ref|YP_581708.1| Mg chelatase-related protein [Psychrobacter cryohalolentis K5]
 gi|92394949|gb|ABE76224.1| Mg chelatase-related protein [Psychrobacter cryohalolentis K5]
          Length = 516

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           +++ T +  G+    V ++V +S G   + IVGLP+ AV ES++R++S  +++G  F  
Sbjct: 3  FAQVYTRSVVGLHAPEVIIEVHLSQGLPALTIVGLPEAAVRESKDRVRSAILNSGFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  L +     DL
Sbjct: 61 ---PNRRLTINLAPADL 74


>gi|304309864|ref|YP_003809462.1| Mg2+ chelatase family protein [gamma proteobacterium HdN1]
 gi|301795597|emb|CBL43796.1| Mg2+ chelatase family protein [gamma proteobacterium HdN1]
          Length = 499

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           + + T A  G+    V V+V +S G     +VGLPD AV ES+ER++S  ++AGL    
Sbjct: 3  FAVVQTRARLGMHAPSVLVEVHISNGLPAFNLVGLPDTAVRESKERVRSAILNAGL---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPQRRITVNLAPADL 74


>gi|295107975|emb|CBL21928.1| Mg chelatase-related protein [Ruminococcus obeum A2-162]
          Length = 506

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M + + + A  G++   ++V+  VS G     +VGLP   V E+++R+++   + G    
Sbjct: 1  MFASVFSAAISGMEVHLIKVEADVSDGLPSFTMVGLPSLQVKEAQDRVRTALKNNG---- 56

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     D+
Sbjct: 57 -IALPPKRITVNLAPADI 73


>gi|307824973|ref|ZP_07655195.1| Sigma 54 interacting domain protein [Methylobacter tundripaludum
          SV96]
 gi|307734020|gb|EFO04875.1| Sigma 54 interacting domain protein [Methylobacter tundripaludum
          SV96]
          Length = 503

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + +    GI+   V V+V +S G   + IVGLP+ AV ES++R++   +++      
Sbjct: 4  LAVVYSRGRSGIEAPLVTVEVHISNGLPALNIVGLPETAVKESKDRVRGAILNSKF---- 59

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 60 -EFPMQRITVNLAPADL 75


>gi|119475299|ref|ZP_01615652.1| Mg chelatase-related protein [marine gamma proteobacterium
          HTCC2143]
 gi|119451502|gb|EAW32735.1| Mg chelatase-related protein [marine gamma proteobacterium
          HTCC2143]
          Length = 501

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  GI    V V+V +S G   + IVG+   AV ES++R++S  +++      
Sbjct: 3  LATVYTRASCGIDSPLVRVEVHLSNGLPALSIVGMAKTAVKESKDRVRSAILNSYF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E PS  + +     DL
Sbjct: 59 -EFPSRRITINLAPADL 74


>gi|332998289|gb|EGK17891.1| competence protein comM [Shigella flexneri K-272]
 gi|333013828|gb|EGK33191.1| competence protein comM [Shigella flexneri K-227]
          Length = 506

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A   +   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALEVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|149926026|ref|ZP_01914289.1| putative chelatase [Limnobacter sp. MED105]
 gi|149825314|gb|EDM84525.1| putative chelatase [Limnobacter sp. MED105]
          Length = 520

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + ++ F G++ + V+++V +S G     +VGLPD  + ES+ER++S  +++G     
Sbjct: 3  LATLHSLTFVGVRPVAVQIEVHLSAGLPSFALVGLPDTEIRESKERVRSALLNSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E PS  + +     DL
Sbjct: 59 -EFPSQRITVNLAPADL 74


>gi|113866347|ref|YP_724836.1| ATPase with chaperone activity/magnesium chelatase, subunit ChlI
          [Ralstonia eutropha H16]
 gi|113525123|emb|CAJ91468.1| Predicted ATPase with chaperone activity/Magnesium chelatase,
          subunit ChlI [Ralstonia eutropha H16]
          Length = 514

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  GI   PV V+  ++ G     IVGL D  V ESRER+++  +++G     
Sbjct: 3  LAVLRSRALTGIAAPPVRVETHLANGLPAFTIVGLADTGVRESRERVRAAILNSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPNRRITVNLAPADL 74


>gi|254488032|ref|ZP_05101237.1| putative Mg chelatase [Roseobacter sp. GAI101]
 gi|214044901|gb|EEB85539.1| putative Mg chelatase [Roseobacter sp. GAI101]
          Length = 504

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+SR  T+AFQG++   VEVQ  VS G     IVGLPDKAV E+R+R+++         +
Sbjct: 1  MVSRAYTVAFQGVEARIVEVQCAVSAGLPAFSIVGLPDKAVSEARDRVRAALTS-----M 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 56 AIALPSKRITINLSPADL 73


>gi|332084717|gb|EGI89905.1| competence protein comM domain protein [Shigella boydii 5216-82]
          Length = 101

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALGVNTPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|329911005|ref|ZP_08275434.1| MG(2+) chelatase family protein / ComM-like protein
          [Oxalobacteraceae bacterium IMCC9480]
 gi|327546021|gb|EGF31099.1| MG(2+) chelatase family protein / ComM-like protein
          [Oxalobacteraceae bacterium IMCC9480]
          Length = 507

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+V ++ G     IVGLP+  V ESR+R+++   +A      
Sbjct: 3  LAVLKSRALAGMQAPQVTVEVHLANGLPSFMIVGLPETEVKESRDRVRAALQNARF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITVNLAPADL 74


>gi|87301349|ref|ZP_01084190.1| Mg(2+) chelatase family protein [Synechococcus sp. WH 5701]
 gi|87284317|gb|EAQ76270.1| Mg(2+) chelatase family protein [Synechococcus sp. WH 5701]
          Length = 519

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 46/78 (58%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R S+ A QG++   V V+V ++PG  G+QIVGL + AV ESRER+++   ++G    
Sbjct: 1  MLARCSSAALQGLEAREVAVEVDIAPGLPGLQIVGLAEAAVRESRERVRAALRNSGFR-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     DL
Sbjct: 59 ---MPLTRVIVSLAPADL 73


>gi|56695317|ref|YP_165665.1| competence protein ComM [Ruegeria pomeroyi DSS-3]
 gi|56677054|gb|AAV93720.1| competence protein ComM [Ruegeria pomeroyi DSS-3]
          Length = 504

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 48/78 (61%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R  T+AFQG++  PVEVQ  V+PG     IVGLPDKAV E+R+R++S    +G   +
Sbjct: 1  MVARAHTVAFQGVEARPVEVQCAVTPGLPAFSIVGLPDKAVSEARDRVRSAL--SG---M 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 56 AIALPSKRITINLSPADL 73


>gi|84499729|ref|ZP_00998017.1| competence protein ComM [Oceanicola batsensis HTCC2597]
 gi|84392873|gb|EAQ05084.1| competence protein ComM [Oceanicola batsensis HTCC2597]
          Length = 508

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 46/78 (58%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI++  T+AF+G++  PVEVQ  V+PG     IVGLPDKAV E+R+R+++         +
Sbjct: 1  MIAKAYTVAFEGVEARPVEVQCAVTPGLPAFSIVGLPDKAVSEARDRVRTALTS-----M 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 56 HIALPSKRITVNLSPADL 73


>gi|150390498|ref|YP_001320547.1| Mg chelatase, subunit ChlI [Alkaliphilus metalliredigens QYMF]
 gi|149950360|gb|ABR48888.1| Mg chelatase, subunit ChlI [Alkaliphilus metalliredigens QYMF]
          Length = 511

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+++I T    G+    +E +V +S G   + IVGL D A+ ES+ER+++   ++G    
Sbjct: 1  MLAKIKTCGVYGLHVSEIEAEVDISNGLPAINIVGLGDMAIRESKERVRAAIKNSG---- 56

Query: 61 VNELPSIYLQLIYQKKD 77
              P   + +     D
Sbjct: 57 -ASFPMKRITINLAPAD 72


>gi|328541657|ref|YP_004301766.1| enzyme (N-terminal); transcriptional regulator with P-loop
          containing NTP hydrolase domain (C-terminal)(YifB)
          [polymorphum gilvum SL003B-26A1]
 gi|326411409|gb|ADZ68472.1| Putative enzyme (N-terminal); transcriptional regulator with
          P-loop containing NTP hydrolase domain
          (C-terminal)(YifB) [Polymorphum gilvum SL003B-26A1]
          Length = 508

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 52/78 (66%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+SR++T+AFQGI+ +PV+VQV V PG V   +VGLPDKAV ESRER+++    +GL   
Sbjct: 1  MVSRVTTVAFQGIEALPVDVQVQVGPGMVAFTVVGLPDKAVAESRERVRAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPAKRVTVNLAPADL 73


>gi|119510783|ref|ZP_01629909.1| competence protein [Nodularia spumigena CCY9414]
 gi|119464546|gb|EAW45457.1| competence protein [Nodularia spumigena CCY9414]
          Length = 510

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + +  GI  + V V+V VS G  G+ I+GLPD A+ ES+ER+++   +AG  F 
Sbjct: 1  MLARVWSASIVGIDAVKVGVEVDVSGGLPGIVILGLPDSAIQESKERVKATLKNAGFAF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PMRKIVINLTPADL 73


>gi|160945526|ref|ZP_02092752.1| hypothetical protein FAEPRAM212_03055 [Faecalibacterium
          prausnitzii M21/2]
 gi|158443257|gb|EDP20262.1| hypothetical protein FAEPRAM212_03055 [Faecalibacterium
          prausnitzii M21/2]
          Length = 520

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S  ++    G++G  V V+  VS G     IVGLPD AV ES +R+++   + G  F 
Sbjct: 9  MYSVTNSFGLNGLRGFAVAVEADVSGGLPAFSIVGLPDSAVRESADRVRAAIKNLGFRF- 67

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 68 ----PDRRITINLAPADV 81


>gi|119356394|ref|YP_911038.1| Mg chelatase, subunit ChlI [Chlorobium phaeobacteroides DSM 266]
 gi|119353743|gb|ABL64614.1| Mg chelatase, subunit ChlI [Chlorobium phaeobacteroides DSM 266]
          Length = 518

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S +   +  GI  + V+V++ V+ G     +VGLPD A+ ESRERI +   ++G    
Sbjct: 1  MLSTLYAASLYGIDAVKVDVEINVTGGIPSFTVVGLPDNAIRESRERILTAVRNSGFD-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 59 ---LPPKKITVNLAPADL 73


>gi|152997654|ref|YP_001342489.1| Mg chelatase subunit ChlI [Marinomonas sp. MWYL1]
 gi|150838578|gb|ABR72554.1| Mg chelatase, subunit ChlI [Marinomonas sp. MWYL1]
          Length = 503

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G+    V V+  +S G   + IVGLP+ AV E+++R++S  I++      
Sbjct: 3  LATIYSRARVGVSSPLVTVETHISNGLPSLNIVGLPEAAVREAKDRVRSAIINSHF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPTRRVTINLAPADL 74


>gi|186682819|ref|YP_001866015.1| Mg chelatase, subunit ChlI [Nostoc punctiforme PCC 73102]
 gi|186465271|gb|ACC81072.1| Mg chelatase, subunit ChlI [Nostoc punctiforme PCC 73102]
          Length = 509

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + +  GI  + V V+V VS G  G+ ++GLPD A+ ESRER+++   +AG  F 
Sbjct: 1  MLARVWSASIVGIDAVKVGVEVDVSGGLPGIVVLGLPDSAIQESRERVKATLKNAGFAF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PMRKIVINLTPADL 73


>gi|295105328|emb|CBL02872.1| Mg chelatase-related protein [Faecalibacterium prausnitzii SL3/3]
          Length = 512

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S  ++    G++G  V V+  VS G     IVGLPD AV ES +R+++   + G  F 
Sbjct: 1  MYSVTNSFGLNGLRGFAVAVEADVSGGLPAFSIVGLPDSAVRESADRVRAAIKNLGFRF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 60 ----PDRRITINLAPADV 73


>gi|5932360|gb|AAD56913.1|AF180145_5 hypothetical protein; zm12orf3 [Zymomonas mobilis subsp. mobilis
          ZM4]
          Length = 503

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 46/78 (58%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ ++++AF G++  P+EVQV +S G     +VGLPDKAV ESRER+++     GL   
Sbjct: 1  MVTCVASLAFLGMEARPIEVQVQLSSGVPAFTVVGLPDKAVSESRERVRAALSAIGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 58 --ALPPKRITVNLSPADL 73


>gi|194335794|ref|YP_002017588.1| Mg chelatase, subunit ChlI [Pelodictyon phaeoclathratiforme BU-1]
 gi|194308271|gb|ACF42971.1| Mg chelatase, subunit ChlI [Pelodictyon phaeoclathratiforme BU-1]
          Length = 518

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S ++  A  GI  I V V+  V+ G     +VGLPD AV ESRERI +   ++G    
Sbjct: 1  MLSTLNAAALIGIDAIKVTVEANVAGGIPSFTVVGLPDNAVRESRERILTAIRNSGFT-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     D+
Sbjct: 59 ---IPPKKITVNLAPADI 73


>gi|317967977|ref|ZP_07969367.1| Mg chelatase-like protein [Synechococcus sp. CB0205]
          Length = 509

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 45/77 (58%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R ST A  GI+  PV+V+V ++PG   + IVGL D AV ESRER++S   ++GL   
Sbjct: 1  MLARSSTAALAGIEAYPVQVEVDLAPGLPALVIVGLADAAVQESRERVRSALRNSGLR-- 58

Query: 61 VNELPSIYLQLIYQKKD 77
             LP   + +     D
Sbjct: 59 ---LPLSRVIVSLAPAD 72


>gi|91786092|ref|YP_547044.1| Mg chelatase-like protein [Polaromonas sp. JS666]
 gi|91695317|gb|ABE42146.1| Mg chelatase-related protein [Polaromonas sp. JS666]
          Length = 523

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 4/77 (5%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + + A  G++  PV V+V ++ G     +VGL +  V E+RER++S   + GL F  
Sbjct: 3  LSLVHSRALLGLEARPVCVEVHLANGLPSFTLVGLAETEVKEARERVRSAIQNTGLEFPA 62

Query: 62 NELPSIYLQLIYQKKDL 78
          N      + +     DL
Sbjct: 63 N----KRITVNLAPADL 75


>gi|46200087|ref|YP_005754.1| Mg(2+) chelatase family protein [Thermus thermophilus HB27]
 gi|55980170|ref|YP_143467.1| Mg(2+) chelatase family protein [Thermus thermophilus HB8]
 gi|46197715|gb|AAS82127.1| Mg(2+) chelatase family protein [Thermus thermophilus HB27]
 gi|55771583|dbj|BAD70024.1| Mg(2+) chelatase family protein [Thermus thermophilus HB8]
          Length = 494

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ + A  G+  +PV V+V VSPG     +VGLPDKAV ESRER+++   +AG  + 
Sbjct: 1  MLAQVRSYALFGLDAVPVTVEVDVSPGLPSYALVGLPDKAVEESRERVRAALKNAGFPY- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     +L
Sbjct: 60 ----PQARVVVNLAPAEL 73


>gi|56552520|ref|YP_163359.1| Mg chelatase subunit ChlI [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241762240|ref|ZP_04760322.1| Mg chelatase, subunit ChlI [Zymomonas mobilis subsp. mobilis ATCC
          10988]
 gi|56544094|gb|AAV90248.1| Mg chelatase, subunit ChlI [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241373287|gb|EER62906.1| Mg chelatase, subunit ChlI [Zymomonas mobilis subsp. mobilis ATCC
          10988]
          Length = 504

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 46/78 (58%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ ++++AF G++  P+EVQV +S G     +VGLPDKAV ESRER+++     GL   
Sbjct: 1  MVTCVASLAFLGMEARPIEVQVQLSSGVPAFTVVGLPDKAVSESRERVRAALSAIGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 58 --ALPPKRITVNLSPADL 73


>gi|331009362|gb|EGH89418.1| Mg-chelatase subunits D/I family, ComM subfamily protein
          [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 268

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  +++GL F  
Sbjct: 3  LAIVHSRAQVGVEAPAVTVEAHLANGLPALTLVGLPEGAVKESKDRVRSAILNSGLDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|188591048|ref|YP_001795648.1| atpase, mg chelatase-related protein [Cupriavidus taiwanensis LMG
          19424]
 gi|170937942|emb|CAP62926.1| putative ATPase, Mg chelatase-related protein [Cupriavidus
          taiwanensis LMG 19424]
          Length = 513

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  GI   PV V+  ++ G     IVGL D  V ESRER+++  +++G     
Sbjct: 3  LAVLRSRALTGIAAPPVRVETHLANGLPAFTIVGLADTGVRESRERVRAAILNSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPNRRITVNLAPADL 74


>gi|319790510|ref|YP_004152143.1| Mg chelatase, subunit ChlI [Thermovibrio ammonificans HB-1]
 gi|317115012|gb|ADU97502.1| Mg chelatase, subunit ChlI [Thermovibrio ammonificans HB-1]
          Length = 499

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 25/76 (32%), Positives = 40/76 (52%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S++ + +  G+  I + V+V  S G  G+ IVGLPD AV ES+ER++S   ++G  F 
Sbjct: 1  MVSKVKSFSTYGVDAIEITVEVDSSKGLPGIIIVGLPDSAVKESKERVRSAITNSGFRF- 59

Query: 61 VNELPSIYLQLIYQKK 76
              P     +     
Sbjct: 60 ----PGKKFTVNLAPA 71


>gi|317494792|ref|ZP_07953203.1| magnesium chelatase [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917117|gb|EFV38465.1| magnesium chelatase [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 504

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 5/74 (6%)

Query: 5  ISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNEL 64
          I+T A  G++   V V+  +S G  G  +VGLP+  V E+++R++S  I+ G  F     
Sbjct: 2  INTRAAIGVQAPAVSVEAHISTGLPGFTLVGLPEATVKEAKDRVRSAIINCGFTF----- 56

Query: 65 PSIYLQLIYQKKDL 78
          P+  + +     DL
Sbjct: 57 PAKRITVNLAPADL 70


>gi|115372383|ref|ZP_01459692.1| putative Mg chelatase homolog [Stigmatella aurantiaca DW4/3-1]
 gi|310819519|ref|YP_003951877.1| Mg-chelatase [Stigmatella aurantiaca DW4/3-1]
 gi|115370596|gb|EAU69522.1| putative Mg chelatase homolog [Stigmatella aurantiaca DW4/3-1]
 gi|309392591|gb|ADO70050.1| Mg-chelatase [Stigmatella aurantiaca DW4/3-1]
          Length = 533

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + A  GI  + VE +V ++ G     +VGLPD AV ES+ R+ S   + G    
Sbjct: 1  MLARVRSGALMGIDAVVVECEVDMALGLPYFNVVGLPDGAVRESKVRVVSALKNTGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            ELP   + +     D+
Sbjct: 58 --ELPQKRITVNLAPADI 73


>gi|116071391|ref|ZP_01468660.1| Mg chelatase-related protein [Synechococcus sp. BL107]
 gi|116066796|gb|EAU72553.1| Mg chelatase-related protein [Synechococcus sp. BL107]
          Length = 126

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 45/77 (58%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R  + +  G++  PV V+V ++PG  G+Q+VGL D+A+ ESRER++S   ++G    
Sbjct: 1  MLARCLSASLHGLEAKPVTVEVDLAPGLPGIQLVGLADRAIQESRERVRSALRNSGFRG- 59

Query: 61 VNELPSIYLQLIYQKKD 77
              P + + +     D
Sbjct: 60 ----PLVRVVINLAPAD 72


>gi|300114406|ref|YP_003760981.1| Mg chelatase subunit ChlI [Nitrosococcus watsonii C-113]
 gi|299540343|gb|ADJ28660.1| Mg chelatase, subunit ChlI [Nitrosococcus watsonii C-113]
          Length = 505

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++   + A   +    V V+V +S G     IVGLP+ AV ESRER++   ++       
Sbjct: 3  LAIAYSRAQASLDAPLVTVEVHLSNGLPAFSIVGLPETAVKESRERVRGALLNCHF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITVNLAPADL 74


>gi|217969032|ref|YP_002354266.1| Mg chelatase, subunit ChlI [Thauera sp. MZ1T]
 gi|217506359|gb|ACK53370.1| Mg chelatase, subunit ChlI [Thauera sp. MZ1T]
          Length = 529

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 5/77 (6%)

Query: 2   ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           ++ +   A  GI+  PV V+V +  G     +VGL D  V E+R+R+++    A      
Sbjct: 32  LALVHARALDGIEAPPVTVEVHLGNGLPQFHLVGLADTEVREARDRVRAAIQSAQF---- 87

Query: 62  NELPSIYLQLIYQKKDL 78
            E P   + +     DL
Sbjct: 88  -EFPQRRITVNLAPADL 103


>gi|226326745|ref|ZP_03802263.1| hypothetical protein PROPEN_00603 [Proteus penneri ATCC 35198]
 gi|225204966|gb|EEG87320.1| hypothetical protein PROPEN_00603 [Proteus penneri ATCC 35198]
          Length = 334

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  GI    + ++  +S G  G+ +VGLP+  V E+++R++S  I++G  +  
Sbjct: 3  LAIIYTRASLGISAPLITIEAHISQGLPGLTLVGLPETVVKEAKDRVRSALINSGYTY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITINLSPADL 74


>gi|254475931|ref|ZP_05089317.1| putative Mg chelatase [Ruegeria sp. R11]
 gi|214030174|gb|EEB71009.1| putative Mg chelatase [Ruegeria sp. R11]
          Length = 500

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 46/78 (58%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MISR  T+AFQG++  PVEVQ  V+PG     IVGLPDKAV E+RER+++         L
Sbjct: 1  MISRAYTVAFQGVEARPVEVQCAVAPGLPAFSIVGLPDKAVSEARERVRAA-----FAAL 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 56 SIALPARRITVNLSPADL 73


>gi|89899283|ref|YP_521754.1| Mg chelatase-like protein [Rhodoferax ferrireducens T118]
 gi|89344020|gb|ABD68223.1| Mg chelatase-related protein [Rhodoferax ferrireducens T118]
          Length = 510

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 4/77 (5%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + + A  G+    V V+V ++ G     +VGL D  V E+RER++S   ++GL F  
Sbjct: 3  LSLVQSRALLGLDASAVTVEVHLANGLPSFTLVGLADVEVKEARERVRSAIQNSGLEFPH 62

Query: 62 NELPSIYLQLIYQKKDL 78
          N      + +     DL
Sbjct: 63 N----KRITVNLAPADL 75


>gi|187250576|ref|YP_001875058.1| putative ATPase with chaperone activity [Elusimicrobium minutum
          Pei191]
 gi|186970736|gb|ACC97721.1| putative ATPase with chaperone activity [Elusimicrobium minutum
          Pei191]
          Length = 508

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MIS++ T   +G+ G  +EV+  ++ G   + +VGLPD  V E+++R+ +   ++G  F 
Sbjct: 1  MISKVLTAGVRGVDGFAIEVEADIAAGMPTMAVVGLPDTEVKEAKDRVVAALRNSGFDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              PS  + +     ++
Sbjct: 60 ----PSKRITVNLSPAEV 73


>gi|299533798|ref|ZP_07047169.1| Mg chelatase, subunit ChlI [Comamonas testosteroni S44]
 gi|298718214|gb|EFI59200.1| Mg chelatase, subunit ChlI [Comamonas testosteroni S44]
          Length = 512

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 4/77 (5%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+V ++ G     +VGL D  V E+RER+++  ++AGL F  
Sbjct: 3  LALVQSRALLGLQAPAVTVEVHLANGLPSFTLVGLADVEVKEARERVRAAIVNAGLEFPN 62

Query: 62 NELPSIYLQLIYQKKDL 78
          N+     + +     DL
Sbjct: 63 NQ----RITVNLAPADL 75


>gi|319945091|ref|ZP_08019353.1| Mg-chelatase D/I family [Lautropia mirabilis ATCC 51599]
 gi|319741661|gb|EFV94086.1| Mg-chelatase D/I family [Lautropia mirabilis ATCC 51599]
          Length = 513

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ +   A  G+   PV V+V ++ G     IVGLP+ +V ESRER+++  + +G     
Sbjct: 4  LAVVHARALLGLSAPPVSVEVHLANGLPAFSIVGLPETSVRESRERVRAALLQSG----- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 IEFPNRRITVNLAPADL 75


>gi|259906850|ref|YP_002647206.1| Probable magnesium-chelatase [Erwinia pyrifoliae Ep1/96]
 gi|224962472|emb|CAX53927.1| Probable magnesium-chelatase [Erwinia pyrifoliae Ep1/96]
 gi|283476642|emb|CAY72470.1| Uncharacterized protein yifB [Erwinia pyrifoliae DSM 12163]
          Length = 506

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S   T A  GI+   V V+V +S G   + +VGLP+  V E+RER++S  +++G  F  
Sbjct: 3  LSVAYTRAAIGIQAPLVSVEVHLSNGLPALSLVGLPETTVKEARERVRSAILNSGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVSLAPADL 74


>gi|78189713|ref|YP_380051.1| Mg chelatase-related protein [Chlorobium chlorochromatii CaD3]
 gi|78171912|gb|ABB29008.1| Mg chelatase-related protein [Chlorobium chlorochromatii CaD3]
          Length = 518

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S ++  A  GI  + V V++ V+ G     +VGLPD A+ ESRER+ +   ++G    
Sbjct: 1  MLSILNAAALTGIDALKVTVEINVTSGLPAFTVVGLPDNAIRESRERVMTALRNSGFP-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     D+
Sbjct: 59 ---IPPKKITVNLAPADI 73


>gi|21674459|ref|NP_662524.1| magnesium-chelatase subunit D/I family protein [Chlorobium
          tepidum TLS]
 gi|21647646|gb|AAM72866.1| magnesium-chelatase, subunit D/I family [Chlorobium tepidum TLS]
          Length = 518

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++   A  GI  + VE++  VS G     +VGLPD A+ ESRERI +   ++G    
Sbjct: 1  MLTKLCAAALLGIDALKVEIETNVSGGLPAFTVVGLPDSAIKESRERILTAIRNSGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            ELPS  + +     D+
Sbjct: 58 --ELPSKKITVNLAPADV 73


>gi|320449308|ref|YP_004201404.1| putative Mg chelatase-like protein [Thermus scotoductus SA-01]
 gi|320149477|gb|ADW20855.1| putative Mg chelatase-like protein [Thermus scotoductus SA-01]
          Length = 494

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ +    G+  +PV V+V VSPG     +VGLPDKAV ESRER+++   + G  + 
Sbjct: 1  MLAQVRSYTLFGLDAVPVTVEVDVSPGLPSYALVGLPDKAVEESRERVRAALKNTGFPY- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     +L
Sbjct: 60 ----PQARVVVNLAPAEL 73


>gi|264676345|ref|YP_003276251.1| Mg chelatase, subunit ChlI [Comamonas testosteroni CNB-2]
 gi|262206857|gb|ACY30955.1| Mg chelatase, subunit ChlI [Comamonas testosteroni CNB-2]
          Length = 512

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 4/77 (5%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+V ++ G     +VGL D  V E+RER+++  ++AGL F  
Sbjct: 3  LALVQSRALLGLQAPAVTVEVHLANGLPSFTLVGLADVEVKEARERVRAAIVNAGLEFPN 62

Query: 62 NELPSIYLQLIYQKKDL 78
          N+     + +     DL
Sbjct: 63 NQ----RITVNLAPADL 75


>gi|310766099|gb|ADP11049.1| Probable magnesium-chelatase [Erwinia sp. Ejp617]
          Length = 506

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S   T A  GI+   V V+V +S G   + +VGLP+  V E+RER++S  +++G  F  
Sbjct: 3  LSVAYTRAAIGIQAPLVSVEVHLSNGLPALSLVGLPETTVKEARERVRSAILNSGFTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVSLAPADL 74


>gi|257092381|ref|YP_003166022.1| Mg chelatase subunit ChlI [Candidatus Accumulibacter phosphatis
          clade IIA str. UW-1]
 gi|257044905|gb|ACV34093.1| Mg chelatase, subunit ChlI [Candidatus Accumulibacter phosphatis
          clade IIA str. UW-1]
          Length = 499

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + +    G+    V V+V ++ G   V +VGLPD  V E+R+R+++   ++G  F  
Sbjct: 3  LAIVHSRGLDGLFAPEVAVEVHLAGGLPSVTLVGLPDTEVKEARDRVRAALQNSGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             PS  + +     DL
Sbjct: 61 ---PSKRITVNLAPADL 74


>gi|163736879|ref|ZP_02144297.1| RNA polymerase sigma-32 factor [Phaeobacter gallaeciensis BS107]
 gi|161389483|gb|EDQ13834.1| RNA polymerase sigma-32 factor [Phaeobacter gallaeciensis BS107]
          Length = 500

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 46/78 (58%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MISR  T+AFQGI+  PVEVQ  V+PG     IVGLPDKAV E+RER++S         +
Sbjct: 1  MISRAYTVAFQGIEARPVEVQCAVAPGLPAFSIVGLPDKAVSEARERVRSALAT-----M 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 56 SIALPSRRITVNLSPADL 73


>gi|146305298|ref|YP_001185763.1| Mg chelatase, subunit ChlI [Pseudomonas mendocina ymp]
 gi|145573499|gb|ABP83031.1| Mg chelatase, subunit ChlI [Pseudomonas mendocina ymp]
          Length = 497

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  ++A      
Sbjct: 3  LAIVHSRAQVGVEAPAVTVEAHLANGLPALTLVGLPETAVKESKDRVRSAILNAAF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + L     DL
Sbjct: 59 -EFPNRRITLNLAPADL 74


>gi|313895543|ref|ZP_07829099.1| Mg chelatase-like protein [Selenomonas sp. oral taxon 137 str.
          F0430]
 gi|312975669|gb|EFR41128.1| Mg chelatase-like protein [Selenomonas sp. oral taxon 137 str.
          F0430]
          Length = 365

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M ++       GI G  ++V+V VSPG  G ++VGLPD +V ES+ER+++   ++G    
Sbjct: 1  MFAKTYGATTLGIDGRIIDVEVDVSPGLPGFELVGLPDTSVKESKERVRTAIRNSG---- 56

Query: 61 VNELPSIYLQLIYQKKDL 78
            +L    + +     D+
Sbjct: 57 -IQLRQERVTVNLAPADV 73


>gi|289672849|ref|ZP_06493739.1| Mg chelatase-related protein [Pseudomonas syringae pv. syringae
          FF5]
          Length = 230

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  +++GL F  
Sbjct: 3  LAIVHSRAQVGVEAPAVTVEAHLANGLPALTLVGLPEGAVKESKDRVRSAILNSGLDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|152988355|ref|YP_001351348.1| putative Mg chelatase-like protein [Pseudomonas aeruginosa PA7]
 gi|150963513|gb|ABR85538.1| putative Mg chelatase-like protein [Pseudomonas aeruginosa PA7]
          Length = 357

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  ++AG  F  
Sbjct: 3  LAIVHSRAQVGVEAPCVSVEAHLANGLPSLTLVGLPETAVRESKDRVRSALLNAGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|298293798|ref|YP_003695737.1| Mg chelatase, subunit ChlI [Starkeya novella DSM 506]
 gi|296930309|gb|ADH91118.1| Mg chelatase, subunit ChlI [Starkeya novella DSM 506]
          Length = 510

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 50/78 (64%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ R++T+AF+G++  PV+VQV VSPG     +VGL DKAV E++ER+++  I +GL   
Sbjct: 1  MVQRVATVAFEGVEARPVDVQVQVSPGLPAFNLVGLADKAVTEAKERVRAALIASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPARRITVNLAPADL 73


>gi|260219819|emb|CBA26735.1| Competence protein comM [Curvibacter putative symbiont of Hydra
          magnipapillata]
          Length = 407

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 4/77 (5%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + + A  G++ + V V+V ++ G     +VGL D  V E+RER++    ++GL F  
Sbjct: 26 LSLVQSRALLGLEAVQVTVEVHLANGLPSFTLVGLADVEVKEARERVRCAIQNSGLEFPN 85

Query: 62 NELPSIYLQLIYQKKDL 78
          N      + +     DL
Sbjct: 86 N----KRITVNLAPADL 98


>gi|238926996|ref|ZP_04658756.1| ATPase [Selenomonas flueggei ATCC 43531]
 gi|238885230|gb|EEQ48868.1| ATPase [Selenomonas flueggei ATCC 43531]
          Length = 509

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M ++       GI G  ++V+V VSPG    ++VGLPD +V ES+ER+++   ++G    
Sbjct: 1  MFAKTYGATTLGIDGRIIDVEVDVSPGLPSFELVGLPDTSVKESKERVRTAIRNSG---- 56

Query: 61 VNELPSIYLQLIYQKKDL 78
            +L    + +     D+
Sbjct: 57 -IQLRQERVTVNLAPADV 73


>gi|188586003|ref|YP_001917548.1| Mg chelatase, subunit ChlI [Natranaerobius thermophilus
          JW/NM-WN-LF]
 gi|179350690|gb|ACB84960.1| Mg chelatase, subunit ChlI [Natranaerobius thermophilus
          JW/NM-WN-LF]
          Length = 519

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +++++    GI+G  + V+V ++ G    +IVGL + AV E++ R++S   ++GL F 
Sbjct: 1  MYTKLTSCILHGIEGKLIGVEVDIANGIPNFEIVGLANTAVKEAKGRVRSAIKNSGLDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     +L
Sbjct: 60 ----PTKRITINLAPSNL 73


>gi|222530159|ref|YP_002574041.1| Mg chelatase subunit ChlI [Caldicellulosiruptor bescii DSM 6725]
 gi|222457006|gb|ACM61268.1| Mg chelatase, subunit ChlI [Caldicellulosiruptor bescii DSM 6725]
          Length = 510

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ T ++ GIKG  V V+  +S G     IVGLPD  + E++ERI+    ++G  F 
Sbjct: 1  MLAKVLTSSYLGIKGYIVTVETDMSNGLPSFDIVGLPDVTIKEAKERIRVAIKNSGFDF- 59

Query: 61 VNELPSIYLQLIYQKKD 77
              P+  + +     +
Sbjct: 60 ----PNRKIIVNLAPAN 72


>gi|258406370|ref|YP_003199112.1| Mg chelatase, subunit ChlI [Desulfohalobium retbaense DSM 5692]
 gi|257798597|gb|ACV69534.1| Mg chelatase, subunit ChlI [Desulfohalobium retbaense DSM 5692]
          Length = 511

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSP-GRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          MI++++T A  GI   PV+++  ++  G     +VGL + AV ES+ER+ +   + G   
Sbjct: 1  MIAKVTTAALLGIDAFPVDLEADLTRSGIPAFTMVGLAEGAVRESKERVLTALKNTGFR- 59

Query: 60 LVNELPSIYLQLIYQKKDL 78
              LP   + +     D+
Sbjct: 60 ----LPPARITINLAPADM 74


>gi|91794768|ref|YP_564419.1| Mg chelatase-related protein [Shewanella denitrificans OS217]
 gi|91716770|gb|ABE56696.1| Mg chelatase-related protein [Shewanella denitrificans OS217]
          Length = 506

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I+ + T A  G++   V V+V +S G  G  +VGLP+ +V E++ER++S  I+AG     
Sbjct: 3  IACVMTRASCGVQAPKVIVEVHLSNGLPGFSLVGLPEASVKEAKERVRSALINAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPMQRITVNLAPADL 74


>gi|56750173|ref|YP_170874.1| competence protein ComM-like protein [Synechococcus elongatus PCC
          6301]
 gi|81300200|ref|YP_400408.1| Mg chelatase-related protein [Synechococcus elongatus PCC 7942]
 gi|56685132|dbj|BAD78354.1| competence protein ComM homolog [Synechococcus elongatus PCC
          6301]
 gi|81169081|gb|ABB57421.1| Mg chelatase-related protein [Synechococcus elongatus PCC 7942]
          Length = 512

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +R  + A  G+  +PV V+  VS G   + +VGLPD A+ ES+ER+++   +AGL F 
Sbjct: 1  MHARTWSAALVGLDAVPVCVEADVSAGLPAMVLVGLPDAAIQESKERVRAAIRNAGLSF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PMQRVVVNLAPGDL 73


>gi|83944332|ref|ZP_00956787.1| competence protein ComM [Sulfitobacter sp. EE-36]
 gi|83844876|gb|EAP82758.1| competence protein ComM [Sulfitobacter sp. EE-36]
          Length = 504

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R  T+AFQGI    VEVQ  +S G     IVGLPDKAV E+RER+++         +
Sbjct: 1  MVARAYTVAFQGIDARIVEVQCALSAGMPAFSIVGLPDKAVSEARERVRAALGA-----M 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 56 AIALPSKRITINLSPADL 73


>gi|83953374|ref|ZP_00962096.1| competence protein ComM [Sulfitobacter sp. NAS-14.1]
 gi|83842342|gb|EAP81510.1| competence protein ComM [Sulfitobacter sp. NAS-14.1]
          Length = 504

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R  T+AFQGI    VEVQ  +S G     IVGLPDKAV E+RER+++         +
Sbjct: 1  MVARAYTVAFQGIDARIVEVQCALSAGMPAFSIVGLPDKAVSEARERVRAALGA-----M 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 56 AIALPSKRITINLSPADL 73


>gi|313113507|ref|ZP_07799096.1| Mg chelatase-like protein [Faecalibacterium cf. prausnitzii
          KLE1255]
 gi|310624234|gb|EFQ07600.1| Mg chelatase-like protein [Faecalibacterium cf. prausnitzii
          KLE1255]
          Length = 512

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 35/78 (44%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S   +    G+ G  V V+  +S G     IVGLPD AV ES +R+++   + G  F 
Sbjct: 1  MYSVTRSFGLNGLSGFAVAVEADISGGLPAFSIVGLPDSAVRESADRVRAAIKNLGFKF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 60 ----PDRRITINLAPADV 73


>gi|113478131|ref|YP_724192.1| Mg chelatase ChlI [Trichodesmium erythraeum IMS101]
 gi|110169179|gb|ABG53719.1| Mg chelatase, subunit ChlI [Trichodesmium erythraeum IMS101]
          Length = 509

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + +  GI+ I V V+V VS G   V +VGLPD AV ES+ER+++   + G  F 
Sbjct: 1  MLARVWSASIIGIEAIKVGVEVDVSGGLPKVVVVGLPDAAVQESKERVKATLKNCGYYF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PMRKILVNLTPADL 73


>gi|115522388|ref|YP_779299.1| Mg chelatase-related protein [Rhodopseudomonas palustris BisA53]
 gi|115516335|gb|ABJ04319.1| Mg chelatase, subunit ChlI [Rhodopseudomonas palustris BisA53]
          Length = 512

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 49/78 (62%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ R++T+AF+GI+   V+VQV V+PG     +VGL DKAV E+RER++S  I +GL   
Sbjct: 1  MVQRVATVAFEGIEARSVDVQVQVAPGLPAFSLVGLADKAVSEARERVRSALIASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPARRITVNLAPADL 73


>gi|310658873|ref|YP_003936594.1| hypothetical protein CLOST_1569 [Clostridium sticklandii DSM 519]
 gi|308825651|emb|CBH21689.1| conserved protein of unknown function [Clostridium sticklandii]
          Length = 354

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  +I +    GI+G  VEV+  ++ G  G  +VGLP+ AV ES+ERI+S   ++G  + 
Sbjct: 1  MFFKIISAGTSGIEGYIVEVEADMTKGLPGFSLVGLPNAAVKESKERIKSAVCNSGFRY- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     D+
Sbjct: 60 ----PNKKIIVNLSPADI 73


>gi|302343909|ref|YP_003808438.1| Mg chelatase, subunit ChlI [Desulfarculus baarsii DSM 2075]
 gi|301640522|gb|ADK85844.1| Mg chelatase, subunit ChlI [Desulfarculus baarsii DSM 2075]
          Length = 508

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+SR++++A  G+    V+V+V ++ G      VGLP+ AV ES+ER++S  +++G    
Sbjct: 1  MLSRVASLAVLGVGAYLVQVEVDLAQGLPTFTTVGLPEGAVRESKERVRSALVNSGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     D+
Sbjct: 58 --SMPVNRITVNLAPADV 73


>gi|163740699|ref|ZP_02148093.1| competence protein ComM [Phaeobacter gallaeciensis 2.10]
 gi|161386557|gb|EDQ10932.1| competence protein ComM [Phaeobacter gallaeciensis 2.10]
          Length = 500

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 46/78 (58%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MISR  T+AFQGI+  PVEVQ  V+PG     IVGLPDKAV E+RER++S         +
Sbjct: 1  MISRAYTVAFQGIEARPVEVQCAVAPGLPAFSIVGLPDKAVSEARERVRSALAT-----M 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 56 SIALPSRRITVNLSPADL 73


>gi|257481731|ref|ZP_05635772.1| Mg-chelatase subunits D/I family, ComM subfamily protein
          [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 189

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  +++GL F  
Sbjct: 3  LAIVHSRAQVGVEAPAVTVEAHLANGLPALTLVGLPEGAVKESKDRVRSAILNSGLDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|260753820|ref|YP_003226713.1| Mg chelatase, subunit ChlI [Zymomonas mobilis subsp. mobilis
          NCIMB 11163]
 gi|258553183|gb|ACV76129.1| Mg chelatase, subunit ChlI [Zymomonas mobilis subsp. mobilis
          NCIMB 11163]
          Length = 504

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ + ++AF G++  P+EVQV +S G     +VGLPDKAV ESRER+++     GL   
Sbjct: 1  MVTCVGSLAFLGMEARPIEVQVQLSSGVPAFTVVGLPDKAVSESRERVRAALSAIGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 58 --ALPPKRITVNLSPADL 73


>gi|238897475|ref|YP_002923152.1| putative enzyme (N-terminal); putative transcriptional regulator
          with P-loop containing nucleoside triphosphate
          hydrolase domain (C-terminal) [Candidatus Hamiltonella
          defensa 5AT (Acyrthosiphon pisum)]
 gi|229465230|gb|ACQ67004.1| putative enzyme (N-terminal); putative transcriptional regulator
          with P-loop containing nucleoside triphosphate
          hydrolase domain (C-terminal) [Candidatus Hamiltonella
          defensa 5AT (Acyrthosiphon pisum)]
          Length = 506

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I+T A  G++   V V+  +S G     +VGLP+ AV E+R+R++S  +++G +F  
Sbjct: 3  LAVINTRASLGVQSPAVAVEAHISNGLPCFTLVGLPETAVKEARDRVRSAILNSGFMF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVSLGPADL 74


>gi|288870967|ref|ZP_06115946.2| Mg chelatase-like protein [Clostridium hathewayi DSM 13479]
 gi|288865231|gb|EFC97529.1| Mg chelatase-like protein [Clostridium hathewayi DSM 13479]
          Length = 496

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           S++ +I   G++G PV V+  VS G  G  +VG    AV E+++R+++   ++G     
Sbjct: 10 FSKVHSIGILGVEGYPVVVEADVSEGLPGFTMVGYLSGAVREAQDRVRTALKNSGFR--- 66

Query: 62 NELPSIYLQLIYQKKDL 78
            LP+  + +     D+
Sbjct: 67 --LPARKITVNLSPADV 81


>gi|307153388|ref|YP_003888772.1| Mg chelatase subunit ChlI [Cyanothece sp. PCC 7822]
 gi|306983616|gb|ADN15497.1| Mg chelatase, subunit ChlI [Cyanothece sp. PCC 7822]
          Length = 509

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ I + +  GI  + V V+V VS G   + +VGLPD AV ESRER++S   +AG    
Sbjct: 1  MLATIWSASIVGIDAVKVGVEVDVSGGLPAITVVGLPDLAVQESRERVKSALRNAGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     DL
Sbjct: 58 --AVPVRKIVVNLTPADL 73


>gi|209883559|ref|YP_002287416.1| Mg chelatase-like protein [Oligotropha carboxidovorans OM5]
 gi|209871755|gb|ACI91551.1| Mg chelatase-like protein [Oligotropha carboxidovorans OM5]
          Length = 512

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 49/78 (62%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+  +ST+AF+GI+   V+VQV V+PG     IVGLPDKAV E+RER+++  I +GL   
Sbjct: 1  MVQHVSTMAFEGIEARAVDVQVQVAPGLPAFTIVGLPDKAVSEARERVRAALIASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPARRITVNLAPADL 73


>gi|312621550|ref|YP_004023163.1| Mg chelatase subunit ChlI [Caldicellulosiruptor kronotskyensis
          2002]
 gi|312202017|gb|ADQ45344.1| Mg chelatase, subunit ChlI [Caldicellulosiruptor kronotskyensis
          2002]
          Length = 510

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ T ++ GIKG  V V+  +S G     IVGLPD  + E++ERI+    ++G  F 
Sbjct: 1  MLAKVLTSSYLGIKGYIVTVETDMSNGLPSFDIVGLPDVTIKEAKERIRVAIKNSGFDF- 59

Query: 61 VNELPSIYLQLIYQKKD 77
              P+  + +     +
Sbjct: 60 ----PNRKIIVNLAPAN 72


>gi|221069557|ref|ZP_03545662.1| Mg chelatase, subunit ChlI [Comamonas testosteroni KF-1]
 gi|220714580|gb|EED69948.1| Mg chelatase, subunit ChlI [Comamonas testosteroni KF-1]
          Length = 512

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 4/77 (5%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+V ++ G     +VGL D  V E+RER+++  ++AGL F  
Sbjct: 3  LALVQSRALLGLQAPGVTVEVHLANGLPSFTLVGLADVEVKEARERVRAAIVNAGLQFPN 62

Query: 62 NELPSIYLQLIYQKKDL 78
          N+     + +     DL
Sbjct: 63 NQ----RITVNLAPADL 75


>gi|229593323|ref|YP_002875442.1| putative magnesium chelatase protein [Pseudomonas fluorescens
          SBW25]
 gi|229365189|emb|CAY53461.1| putative magnesium chelatase protein [Pseudomonas fluorescens
          SBW25]
          Length = 498

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+V ++ G   + +VGLP+ AV ES++R++S  +++ L    
Sbjct: 3  LAIVHSRAQIGVEAPAVTVEVHMANGLPSLTLVGLPETAVKESKDRVRSAILNSAL---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           + PS  + L     DL
Sbjct: 59 -QYPSRRITLNLAPADL 74


>gi|313896441|ref|ZP_07829992.1| Mg chelatase-like protein [Selenomonas sp. oral taxon 137 str.
          F0430]
 gi|312974865|gb|EFR40329.1| Mg chelatase-like protein [Selenomonas sp. oral taxon 137 str.
          F0430]
          Length = 365

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M ++       GI G  ++V+V VSPG  G ++VGLPD +V ES+ER+++   ++G    
Sbjct: 1  MFAKTYGATTLGIDGRIIDVEVDVSPGLPGFELVGLPDTSVKESKERVRTAIRNSG---- 56

Query: 61 VNELPSIYLQLIYQKKDL 78
            +L    + +     D+
Sbjct: 57 -IQLRQERVTVNLAPADV 73


>gi|193212214|ref|YP_001998167.1| Mg chelatase subunit ChlI [Chlorobaculum parvum NCIB 8327]
 gi|193085691|gb|ACF10967.1| Mg chelatase, subunit ChlI [Chlorobaculum parvum NCIB 8327]
          Length = 518

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++   A  GI  + VE++  VS G     +VGLPD A+ ESRERI +   ++G    
Sbjct: 1  MLTKLCAAALVGIDALKVEIETNVSGGLPAFTVVGLPDSAIKESRERILTAIRNSGFD-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     D+
Sbjct: 59 ---LPSKKITVNLAPADV 73


>gi|168184645|ref|ZP_02619309.1| Mg chelatase family protein [Clostridium botulinum Bf]
 gi|182672291|gb|EDT84252.1| Mg chelatase family protein [Clostridium botulinum Bf]
          Length = 507

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S++ T    G     + V+V +S G     IVGL D +V ES+ER++S   ++G    
Sbjct: 1  MTSKVITATLNGACCNLISVEVDISHGLPAFNIVGLADTSVKESKERVKSAITNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     D+
Sbjct: 58 --EFPISKITVNLSPADI 73


>gi|170754832|ref|YP_001781982.1| Mg chelatase-like protein [Clostridium botulinum B1 str. Okra]
 gi|169120044|gb|ACA43880.1| Mg chelatase family protein [Clostridium botulinum B1 str. Okra]
          Length = 507

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S++ T    G     + V+V +S G     IVGL D +V ES+ER++S   ++G    
Sbjct: 1  MTSKVITATLNGACCNLISVEVDISHGLPAFNIVGLADTSVKESKERVKSAITNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     D+
Sbjct: 58 --EFPISKITVNLSPADI 73


>gi|289548690|ref|YP_003473678.1| Mg chelatase, subunit ChlI [Thermocrinis albus DSM 14484]
 gi|289182307|gb|ADC89551.1| Mg chelatase, subunit ChlI [Thermocrinis albus DSM 14484]
          Length = 504

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 25/76 (32%), Positives = 42/76 (55%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  R+ +    GI+G  V+V+V +SPG     IVGLPDKA+ E+++R++S   + G    
Sbjct: 1  MFCRVKSGGVWGIEGFEVDVEVDLSPGIPQFNIVGLPDKAINEAKDRVRSALRNLG---- 56

Query: 61 VNELPSIYLQLIYQKK 76
            +LP+  + +     
Sbjct: 57 -VQLPAKRITVNLSPS 71


>gi|238927020|ref|ZP_04658780.1| ATPase [Selenomonas flueggei ATCC 43531]
 gi|238885126|gb|EEQ48764.1| ATPase [Selenomonas flueggei ATCC 43531]
          Length = 365

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M ++       GI G  ++V+V VSPG  G ++VGLPD +V ES+ER+++   ++G    
Sbjct: 1  MFAKTYGATTLGIDGRIIDVEVDVSPGLPGFELVGLPDTSVKESKERVRTAIRNSG---- 56

Query: 61 VNELPSIYLQLIYQKKDL 78
            +L    + +     D+
Sbjct: 57 -IQLRQERVTVNLAPADV 73


>gi|18310686|ref|NP_562620.1| Mg chelatase-like protein [Clostridium perfringens str. 13]
 gi|18145367|dbj|BAB81410.1| probable competence-related protein [Clostridium perfringens str.
          13]
          Length = 507

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M   + +    GI+G+ V ++V +S G     +VGL D +V E++ER+++  +++G    
Sbjct: 1  MSISLKSSTLIGIEGVIVNIEVDISKGLPSFTLVGLADTSVREAKERVRAAILNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     +L
Sbjct: 58 --EFPLGRITVNLAPGNL 73


>gi|27375772|ref|NP_767301.1| hypothetical protein bll0661 [Bradyrhizobium japonicum USDA 110]
 gi|27348910|dbj|BAC45926.1| bll0661 [Bradyrhizobium japonicum USDA 110]
          Length = 512

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ R+ST+AF+GI+   V+VQV V+PG     IVGLPDKAV E+RER++S  I +GL   
Sbjct: 1  MVQRVSTVAFEGIEARAVDVQVQVAPGLPAFAIVGLPDKAVSEARERVRSALIASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPARRIIVNLAPADL 73


>gi|237795875|ref|YP_002863427.1| putative Mg chelatase [Clostridium botulinum Ba4 str. 657]
 gi|229261582|gb|ACQ52615.1| putative Mg chelatase [Clostridium botulinum Ba4 str. 657]
          Length = 507

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S++ T    G     + V+V +S G     IVGL D +V ES+ER++S   ++G    
Sbjct: 1  MTSKVITATLNGACCNLISVEVDISHGLPAFNIVGLADTSVKESKERVKSAITNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     D+
Sbjct: 58 --EFPISKITVNLSPADI 73


>gi|322806705|emb|CBZ04274.1| Mg(2+) chelatase family protein / ComM-related protein
          [Clostridium botulinum H04402 065]
          Length = 507

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S++ T    G     + V+V +S G     IVGL D +V ES+ER++S   ++G    
Sbjct: 1  MTSKVITATLNGACCNLISVEVDISHGLPAFNIVGLADTSVKESKERVKSAITNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     D+
Sbjct: 58 --EFPISKITVNLSPADI 73


>gi|153932454|ref|YP_001384614.1| Mg chelatase-like protein [Clostridium botulinum A str. ATCC
          19397]
 gi|153937157|ref|YP_001388131.1| Mg chelatase-like protein [Clostridium botulinum A str. Hall]
 gi|152928498|gb|ABS33998.1| Mg chelatase family protein [Clostridium botulinum A str. ATCC
          19397]
 gi|152933071|gb|ABS38570.1| Mg chelatase family protein [Clostridium botulinum A str. Hall]
          Length = 507

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S++ T    G     + V+V +S G     IVGL D +V ES+ER++S   ++G    
Sbjct: 1  MTSKVITATLNGACCNLISVEVDISHGLPAFNIVGLADTSVKESKERVKSAITNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     D+
Sbjct: 58 --EFPISKITVNLSPADI 73


>gi|269468475|gb|EEZ80136.1| Mg(2+) chelatase family protein [uncultured SUP05 cluster
          bacterium]
          Length = 254

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +++I T A  G+    V ++V +S G     IVGLP+ AV ES++R++S  +++   F  
Sbjct: 4  LAKIFTRASTGMDAPLVTIEVHISGGLPSFTIVGLPEGAVKESKDRVRSALMNSNFKF-- 61

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     +L
Sbjct: 62 ---PKGRITVSLAPANL 75


>gi|312792630|ref|YP_004025553.1| Mg chelatase subunit ChlI [Caldicellulosiruptor kristjanssonii
          177R1B]
 gi|312179770|gb|ADQ39940.1| Mg chelatase, subunit ChlI [Caldicellulosiruptor kristjanssonii
          177R1B]
          Length = 510

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ T ++ GIKG  V V+  +S G     IVGLPD  + E++ERI+    ++G  F 
Sbjct: 1  MLAKVLTSSYLGIKGYIVTVETDMSNGLPSFDIVGLPDVTIKEAKERIRVAIKNSGFDF- 59

Query: 61 VNELPSIYLQLIYQKK 76
              P+  + +     
Sbjct: 60 ----PTRKIIVNLAPA 71


>gi|168216991|ref|ZP_02642616.1| Mg chelatase homolog [Clostridium perfringens NCTC 8239]
 gi|182380950|gb|EDT78429.1| Mg chelatase homolog [Clostridium perfringens NCTC 8239]
          Length = 507

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M   + +    GI+G+ V ++V +S G     +VGL D +V E++ER+++  +++G    
Sbjct: 1  MSISLKSSTLIGIEGVIVNIEVDISKGLPSFTLVGLADTSVREAKERVRAAILNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     +L
Sbjct: 58 --EFPLGRITVNLAPGNL 73


>gi|110803244|ref|YP_698991.1| Mg chelatase-like protein [Clostridium perfringens SM101]
 gi|110683745|gb|ABG87115.1| Mg chelatase homolog [Clostridium perfringens SM101]
          Length = 507

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M   + +    GI+G+ V ++V +S G     +VGL D +V E++ER++S  +++G    
Sbjct: 1  MSISLKSSTLIGIEGVIVNIEVDISKGLPSFTLVGLADTSVREAKERVRSAILNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     +L
Sbjct: 58 --EFPLGRITVNLAPGNL 73


>gi|110798594|ref|YP_696391.1| Mg chelatase-like protein [Clostridium perfringens ATCC 13124]
 gi|110673241|gb|ABG82228.1| Mg chelatase homolog [Clostridium perfringens ATCC 13124]
          Length = 507

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M   + +    GI+G+ V ++V +S G     +VGL D +V E++ER+++  +++G    
Sbjct: 1  MSISLKSSTLIGIEGVIVNIEVDISKGLPSFTLVGLADTSVREAKERVRAAILNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     +L
Sbjct: 58 --EFPLGRITVNLAPGNL 73


>gi|168215354|ref|ZP_02640979.1| Mg chelatase homolog [Clostridium perfringens CPE str. F4969]
 gi|170713270|gb|EDT25452.1| Mg chelatase homolog [Clostridium perfringens CPE str. F4969]
          Length = 507

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M   + +    GI+G+ V ++V +S G     +VGL D +V E++ER+++  +++G    
Sbjct: 1  MSISLKSSTLIGIEGVIVNIEVDISKGLPSFTLVGLADTSVREAKERVRAAILNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     +L
Sbjct: 58 --EFPLGRITVNLAPGNL 73


>gi|148380397|ref|YP_001254938.1| Mg chelatase-like protein [Clostridium botulinum A str. ATCC
          3502]
 gi|148289881|emb|CAL83989.1| putative magnesium chelatase [Clostridium botulinum A str. ATCC
          3502]
          Length = 507

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S++ T    G     + V+V +S G     IVGL D +V ES+ER++S   ++G    
Sbjct: 1  MTSKVITATLNGACCNLISVEVDISHGLPAFNIVGLADTSVKESKERVKSAITNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     D+
Sbjct: 58 --EFPISKITVNLSPADI 73


>gi|332284520|ref|YP_004416431.1| putative chelatase [Pusillimonas sp. T7-7]
 gi|330428473|gb|AEC19807.1| putative chelatase [Pusillimonas sp. T7-7]
          Length = 505

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ +++ A  G++ +PV V+V ++PG     +VGLPD  V ESRER++S  + +G  F  
Sbjct: 3  LAVLASRALCGLQALPVRVEVHMAPGLPAFHVVGLPDAGVRESRERVRSAILSSGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  L +     DL
Sbjct: 61 ---PAGRLTVNLAPADL 74


>gi|168210663|ref|ZP_02636288.1| Mg chelatase homolog [Clostridium perfringens B str. ATCC 3626]
 gi|170711298|gb|EDT23480.1| Mg chelatase homolog [Clostridium perfringens B str. ATCC 3626]
          Length = 507

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M   + +    GI+G+ V ++V +S G     +VGL D +V E++ER+++  +++G    
Sbjct: 1  MSISLKSSTLIGIEGVIVNIEVDISKGLPSFTLVGLADTSVREAKERVRAAILNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     +L
Sbjct: 58 --EFPLGRITVNLAPGNL 73


>gi|153940242|ref|YP_001391737.1| Mg chelatase-like protein [Clostridium botulinum F str.
          Langeland]
 gi|152936138|gb|ABS41636.1| Mg chelatase family protein [Clostridium botulinum F str.
          Langeland]
          Length = 507

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S++ T    G     + V+V +S G     IVGL D +V ES+ER++S   ++G    
Sbjct: 1  MTSKVITATLNGACCNLISVEVDISHGLPAFNIVGLADTSVKESKERVKSAITNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     D+
Sbjct: 58 --EFPISKITVNLSPADI 73


>gi|167771395|ref|ZP_02443448.1| hypothetical protein ANACOL_02761 [Anaerotruncus colihominis DSM
          17241]
 gi|167666035|gb|EDS10165.1| hypothetical protein ANACOL_02761 [Anaerotruncus colihominis DSM
          17241]
          Length = 509

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S + ++   GI+   V V+V V+      +IVGLPD AV ESRER++S F++ G  F 
Sbjct: 1  MLSTVQSLGLLGIEPFSVTVEVNVARAIPAFEIVGLPDAAVRESRERVRSAFLNCGYPF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 60 ----PDGRITVNLAPADV 73


>gi|292486645|ref|YP_003529515.1| hypothetical protein EAMY_0157 [Erwinia amylovora CFBP1430]
 gi|292897882|ref|YP_003537251.1| magnesium chelatase family protein [Erwinia amylovora ATCC 49946]
 gi|291197730|emb|CBJ44825.1| putative magnesium chelatase family protein [Erwinia amylovora
          ATCC 49946]
 gi|291552062|emb|CBA19099.1| Uncharacterized protein yifB [Erwinia amylovora CFBP1430]
          Length = 506

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S   T A  GI+   V V+V +S G   + +VGLP+  V E+R+R++S  +++G  F  
Sbjct: 3  LSVAYTRAAIGIQAPLVSVEVHLSNGLPALSLVGLPETTVKEARDRVRSAILNSGFFF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVSLAPADL 74


>gi|168180680|ref|ZP_02615344.1| Mg chelatase homolog [Clostridium botulinum NCTC 2916]
 gi|182668502|gb|EDT80481.1| Mg chelatase homolog [Clostridium botulinum NCTC 2916]
          Length = 507

 Score =  107 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S++ T    G     + V+V +S G     IVGL D +V ES+ER++S   ++G    
Sbjct: 1  MTSKVITATLNGACCNLISVEVDISHGLPAFNIVGLADTSVKESKERVKSAITNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     D+
Sbjct: 58 --EFPISKITVNLSPADI 73


>gi|168207945|ref|ZP_02633950.1| Mg chelatase homolog [Clostridium perfringens E str. JGS1987]
 gi|170660763|gb|EDT13446.1| Mg chelatase homolog [Clostridium perfringens E str. JGS1987]
          Length = 507

 Score =  107 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M   + +    GI+G+ V ++V +S G     +VGL D +V E++ER+++  +++G    
Sbjct: 1  MSISLKSSTLIGIEGVIVNIEVDISKGLPSFTLVGLADTSVREAKERVRAAILNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     +L
Sbjct: 58 --EFPLGRITVNLAPGNL 73


>gi|312876477|ref|ZP_07736460.1| Mg chelatase, subunit ChlI [Caldicellulosiruptor lactoaceticus
          6A]
 gi|311796688|gb|EFR13034.1| Mg chelatase, subunit ChlI [Caldicellulosiruptor lactoaceticus
          6A]
          Length = 510

 Score =  107 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ T ++ GIKG  V V+  +S G     IVGLPD  + E++ERI+    ++G  F 
Sbjct: 1  MLAKVLTSSYLGIKGYIVTVETDMSNGLPSFDIVGLPDVTIKEAKERIRVAIKNSGFDF- 59

Query: 61 VNELPSIYLQLIYQKK 76
              P+  + +     
Sbjct: 60 ----PTRKIIVNLAPA 71


>gi|312963825|ref|ZP_07778296.1| Mg chelatase-like protein [Pseudomonas fluorescens WH6]
 gi|311281860|gb|EFQ60470.1| Mg chelatase-like protein [Pseudomonas fluorescens WH6]
          Length = 498

 Score =  107 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+V ++ G   + +VGLP+ AV ES++R++S  +++ L    
Sbjct: 3  LAIVHSRAQVGVEAPAVTVEVHMANGLPSLTLVGLPETAVKESKDRVRSAILNSAL---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           + P+  + L     DL
Sbjct: 59 -QYPARRITLNLAPADL 74


>gi|289207336|ref|YP_003459402.1| Mg chelatase, subunit ChlI [Thioalkalivibrio sp. K90mix]
 gi|288942967|gb|ADC70666.1| Mg chelatase, subunit ChlI [Thioalkalivibrio sp. K90mix]
          Length = 501

 Score =  107 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I+     A  GI+   V ++  ++ G    QIVGLP+ AV ESR+R+++    +G  F  
Sbjct: 3  IAISHARAVAGIQAPLVTIETHLANGLPSFQIVGLPEAAVRESRDRVRAAIQTSGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PRRRITVNLAPADL 74


>gi|182625831|ref|ZP_02953597.1| Mg chelatase homolog [Clostridium perfringens D str. JGS1721]
 gi|177908865|gb|EDT71357.1| Mg chelatase homolog [Clostridium perfringens D str. JGS1721]
          Length = 507

 Score =  107 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M   + +    GI+G+ V ++V +S G     +VGL D +V E++ER+++  +++G    
Sbjct: 1  MSISLKSSTLIGIEGVIVNIEVDISKGLPSFTLVGLADTSVREAKERVRAAILNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     +L
Sbjct: 58 --EFPLGRITVNLAPGNL 73


>gi|302872587|ref|YP_003841223.1| Mg chelatase, subunit ChlI [Caldicellulosiruptor obsidiansis
          OB47]
 gi|302575446|gb|ADL43237.1| Mg chelatase, subunit ChlI [Caldicellulosiruptor obsidiansis
          OB47]
          Length = 510

 Score =  107 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ T ++ GIKG  V V+  +S G     IVGLPD  + E++ERI+    ++G  F 
Sbjct: 1  MLAKVLTSSYLGIKGYIVTVETDMSNGLPSFDIVGLPDVTIKEAKERIRVAIKNSGFDF- 59

Query: 61 VNELPSIYLQLIYQKK 76
              P+  + +     
Sbjct: 60 ----PTRKIIVNLAPA 71


>gi|188532340|ref|YP_001906137.1| Probable magnesium-chelatase [Erwinia tasmaniensis Et1/99]
 gi|188027382|emb|CAO95229.1| Probable magnesium-chelatase [Erwinia tasmaniensis Et1/99]
          Length = 506

 Score =  107 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S   T A  GI+   V V+V +S G   + +VGLP+  V E+R+R++S  I++G  F  
Sbjct: 3  LSVAFTRAAIGIQAPLVSVEVHLSNGLPALSLVGLPETTVKEARDRVRSAIINSGFNF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVSLAPADL 74


>gi|170761520|ref|YP_001787751.1| Mg chelatase-like protein [Clostridium botulinum A3 str. Loch
          Maree]
 gi|169408509|gb|ACA56920.1| Mg chelatase family protein [Clostridium botulinum A3 str. Loch
          Maree]
          Length = 507

 Score =  107 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S++ T    G     + V+V +S G     IVGL D +V ES+ER++S   ++G    
Sbjct: 1  MTSKVITATLNGACCNLISVEVDISHGLPAFNIVGLADTSVKESKERVKSAITNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     D+
Sbjct: 58 --EFPISKITVNLSPADI 73


>gi|260574112|ref|ZP_05842117.1| Mg chelatase, subunit ChlI [Rhodobacter sp. SW2]
 gi|259023578|gb|EEW26869.1| Mg chelatase, subunit ChlI [Rhodobacter sp. SW2]
          Length = 504

 Score =  107 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R  T+AF+G++   VEVQ  ++ G     IVGLPDKAV E+RER+++         +
Sbjct: 1  MVARAYTVAFEGVEARIVEVQCAIAAGLPSFSIVGLPDKAVSEARERVRAALAS-----M 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 56 SIALPSKRITVNLSPADL 73


>gi|19033133|gb|AAL83551.1|AF414717_1 competence related protein [Pseudomonas stutzeri A15]
          Length = 259

 Score =  107 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  + +G  F  
Sbjct: 3  LAIVHSRAQIGVEAPAVTVEAHLANGLPALTLVGLPETAVKESKDRVRSAILTSGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|313896481|ref|ZP_07830032.1| Mg chelatase-like protein [Selenomonas sp. oral taxon 137 str.
          F0430]
 gi|312974905|gb|EFR40369.1| Mg chelatase-like protein [Selenomonas sp. oral taxon 137 str.
          F0430]
          Length = 365

 Score =  107 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M ++       GI G  ++V+V VSPG  G ++VGLPD +V ES+ER+++   ++G+   
Sbjct: 1  MFAKTYGATTLGIDGRIIDVEVDVSPGLPGFELVGLPDTSVKESKERVRTAIRNSGM--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            +L    + +     D+
Sbjct: 58 --QLRQERVTVNLAPADV 73


>gi|312126801|ref|YP_003991675.1| Mg chelatase subunit ChlI [Caldicellulosiruptor hydrothermalis
          108]
 gi|311776820|gb|ADQ06306.1| Mg chelatase, subunit ChlI [Caldicellulosiruptor hydrothermalis
          108]
          Length = 510

 Score =  107 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ T ++ GIKG  V V+  +S G     IVGLPD  + E++ERI+    ++G  F 
Sbjct: 1  MLAKVLTSSYLGIKGYIVTVETDMSNGLPSFDIVGLPDVTIKEAKERIRVAIKNSGFDF- 59

Query: 61 VNELPSIYLQLIYQKK 76
              P+  + +     
Sbjct: 60 ----PNRKIIVNLAPA 71


>gi|253997652|ref|YP_003049716.1| Mg chelatase subunit ChlI [Methylotenera mobilis JLW8]
 gi|253984331|gb|ACT49189.1| Mg chelatase, subunit ChlI [Methylotenera mobilis JLW8]
          Length = 496

 Score =  107 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V ++ G     IVGLP+  V ES++R+++    A      
Sbjct: 3  LAVLYSRALTGMDAPEVVVEVHLANGLPSFTIVGLPEAEVKESKDRVRAALQTAQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITVNLAPADL 74


>gi|320353480|ref|YP_004194819.1| Mg chelatase subunit ChlI [Desulfobulbus propionicus DSM 2032]
 gi|320121982|gb|ADW17528.1| Mg chelatase, subunit ChlI [Desulfobulbus propionicus DSM 2032]
          Length = 509

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 18/76 (23%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ + A  G+ G+ V V+V ++ G      VGL + AV E+++R+++   + G    
Sbjct: 1  MLAKVISCAVAGVDGLAVRVEVDLAQGLPSFSTVGLAEGAVREAKDRVRAAIKNTGY--- 57

Query: 61 VNELPSIYLQLIYQKK 76
            E P   + +     
Sbjct: 58 --EFPQRRITVNLAPA 71


>gi|145630216|ref|ZP_01785998.1| deoxyribose-phosphate aldolase [Haemophilus influenzae R3021]
 gi|144984497|gb|EDJ91920.1| deoxyribose-phosphate aldolase [Haemophilus influenzae R3021]
          Length = 509

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G  +VGLP+K V E+++R++S  ++A   +  
Sbjct: 3  LAIVYSRASMGVQAPLVTIEVHLSNGKPGFTLVGLPEKTVKEAQDRVRSALMNAQFKY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|160880856|ref|YP_001559824.1| Mg chelatase, subunit ChlI [Clostridium phytofermentans ISDg]
 gi|160429522|gb|ABX43085.1| Mg chelatase, subunit ChlI [Clostridium phytofermentans ISDg]
          Length = 512

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 34/78 (43%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S+    A  GI    V V+  VS G     +VG     V E++ER+++   ++G    
Sbjct: 1  MFSKSFCAAIDGIDAFIVNVEADVSDGLPSFDLVGFLGSEVKEAKERVKTAIRNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP  ++ +     D+
Sbjct: 58 --SLPPKHITINLSPADV 73


>gi|189346142|ref|YP_001942671.1| Mg chelatase, subunit ChlI [Chlorobium limicola DSM 245]
 gi|189340289|gb|ACD89692.1| Mg chelatase, subunit ChlI [Chlorobium limicola DSM 245]
          Length = 518

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+SR+S     GI  + V+V+  VS G     +VGLPD A+ ESRERI +   ++G    
Sbjct: 1  MLSRLSAATLIGIDAVKVDVETNVSGGIPSFTVVGLPDNAIRESRERILTAIKNSGFD-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     D+
Sbjct: 59 ---MPPKKVTVNLAPADI 73


>gi|299144232|ref|ZP_07037312.1| Mg chelatase-like protein [Peptoniphilus sp. oral taxon 386 str.
          F0131]
 gi|298518717|gb|EFI42456.1| Mg chelatase-like protein [Peptoniphilus sp. oral taxon 386 str.
          F0131]
          Length = 505

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S + T + QG+ G  +E Q  ++ G     IVGLPD A+ ES ER++S   ++G    
Sbjct: 1  MYSCVKTCSLQGLSGDVIEAQADITNGLPKFTIVGLPDTAIKESGERVRSGIKNSGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     +L
Sbjct: 58 --EFPLKRITINLAPANL 73


>gi|293391509|ref|ZP_06635843.1| putative Mg chelatase-like protein [Aggregatibacter
          actinomycetemcomitans D7S-1]
 gi|290952043|gb|EFE02162.1| putative Mg chelatase-like protein [Aggregatibacter
          actinomycetemcomitans D7S-1]
          Length = 511

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G  +VGLP+K V E+++R++S  ++A   +  
Sbjct: 3  LAIVYSRASMGVQAPLVTIEVHLSNGKPGFTLVGLPEKTVKEAQDRVRSALLNAEFRY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRVTVNLAPADL 74


>gi|229846149|ref|ZP_04466261.1| GTPase EngB [Haemophilus influenzae 7P49H1]
 gi|229811153|gb|EEP46870.1| GTPase EngB [Haemophilus influenzae 7P49H1]
          Length = 509

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G  +VGLP+K V E+++R++S  ++A   +  
Sbjct: 3  LAIVYSRASMGVQAPLVTIEVHLSNGKPGFTLVGLPEKTVKEAQDRVRSALMNAQFKY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|119944172|ref|YP_941852.1| Mg chelatase, subunit ChlI [Psychromonas ingrahamii 37]
 gi|119862776|gb|ABM02253.1| Mg chelatase, subunit ChlI [Psychromonas ingrahamii 37]
          Length = 504

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ +   A  G+    V V+V +  G     +VGLP+ +V E++ER++S  +++   F  
Sbjct: 3  LASLYCRALLGVDAPEVLVEVHLGTGLPSFSLVGLPETSVKEAKERVRSAILNSNFKF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             PS  + +     +L
Sbjct: 61 ---PSKRITVNLGPANL 74


>gi|148828277|ref|YP_001293030.1| deoxyribose-phosphate aldolase [Haemophilus influenzae PittGG]
 gi|260580202|ref|ZP_05848032.1| deoxyribose-phosphate aldolase [Haemophilus influenzae RdAW]
 gi|319897414|ref|YP_004135611.1| competence protein comm [Haemophilus influenzae F3031]
 gi|148719519|gb|ABR00647.1| deoxyribose-phosphate aldolase [Haemophilus influenzae PittGG]
 gi|260093486|gb|EEW77419.1| deoxyribose-phosphate aldolase [Haemophilus influenzae RdAW]
 gi|317432920|emb|CBY81286.1| competence protein ComM [Haemophilus influenzae F3031]
          Length = 509

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G  +VGLP+K V E+++R++S  ++A   +  
Sbjct: 3  LAIVYSRASMGVQAPLVTIEVHLSNGKPGFTLVGLPEKTVKEAQDRVRSALMNAQFKY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|145641304|ref|ZP_01796884.1| GTPase EngB [Haemophilus influenzae R3021]
 gi|145274141|gb|EDK14007.1| GTPase EngB [Haemophilus influenzae 22.4-21]
          Length = 509

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G  +VGLP+K V E+++R++S  ++A   +  
Sbjct: 3  LAIVYSRASMGVQAPLVTIEVHLSNGKPGFTLVGLPEKTVKEAQDRVRSALMNAQFKY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|83589870|ref|YP_429879.1| Mg chelatase-related protein [Moorella thermoacetica ATCC 39073]
 gi|83572784|gb|ABC19336.1| Mg chelatase-related protein [Moorella thermoacetica ATCC 39073]
          Length = 509

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ ++++   G++G  V V+V +S G     IVGLPD +V E+RER+++   ++G  F 
Sbjct: 1  MLAIVNSVVLVGLEGQSVRVEVDISNGLPLCDIVGLPDPSVREARERVRAAIKNSGFDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 60 ----PLRRIIVNLAPGDI 73


>gi|145635885|ref|ZP_01791574.1| deoxyribose-phosphate aldolase [Haemophilus influenzae PittAA]
 gi|145266868|gb|EDK06883.1| deoxyribose-phosphate aldolase [Haemophilus influenzae PittAA]
          Length = 509

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G  +VGLP+K V E+++R++S  ++A   +  
Sbjct: 3  LAIVYSRASMGVQAPLVTIEVHLSNGKPGFTLVGLPEKTVKEAQDRVRSALMNAQFKY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|251793600|ref|YP_003008329.1| putative Mg chelatase-like protein [Aggregatibacter aphrophilus
          NJ8700]
 gi|247534996|gb|ACS98242.1| putative Mg chelatase-like protein [Aggregatibacter aphrophilus
          NJ8700]
          Length = 511

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+    +VGLP+K V E+++R++S  ++A   +  
Sbjct: 3  LAIVYSRASMGVQAPLVTIEVHLSNGKPNFTLVGLPEKTVKEAQDRVRSALLNAEFKY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|92115274|ref|YP_575202.1| Mg chelatase-related protein [Chromohalobacter salexigens DSM
          3043]
 gi|91798364|gb|ABE60503.1| Mg chelatase-related protein [Chromohalobacter salexigens DSM
          3043]
          Length = 504

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 45/77 (58%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I+T A  G++   V V+V ++ G  G+ IVGLP+ AV ESRER++S  I+AG  F  
Sbjct: 3  LAIINTRAGLGLEAPDVLVEVHLTNGLPGLAIVGLPEAAVKESRERVRSALINAGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PTRRITLNLAPADL 74


>gi|68249668|ref|YP_248780.1| competence protein ComM [Haemophilus influenzae 86-028NP]
 gi|68057867|gb|AAX88120.1| competence protein ComM [Haemophilus influenzae 86-028NP]
          Length = 509

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G  +VGLP+K V E+++R++S  ++A   +  
Sbjct: 3  LAIVYSRASMGVQAPLVTIEVHLSNGKPGFTLVGLPEKTVKEAQDRVRSALMNAQFKY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|319776640|ref|YP_004139128.1| competence protein ComM [Haemophilus influenzae F3047]
 gi|317451231|emb|CBY87464.1| competence protein ComM [Haemophilus influenzae F3047]
          Length = 509

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G  +VGLP+K V E+++R++S  ++A   +  
Sbjct: 3  LAIVYSRASMGVQAPLVTIEVHLSNGKPGFTLVGLPEKTVKEAQDRVRSALMNAQFKY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|145627917|ref|ZP_01783718.1| GTPase EngB [Haemophilus influenzae 22.1-21]
 gi|148826268|ref|YP_001291021.1| GTPase EngB [Haemophilus influenzae PittEE]
 gi|260581833|ref|ZP_05849629.1| GTPase EngB [Haemophilus influenzae NT127]
 gi|144979692|gb|EDJ89351.1| GTPase EngB [Haemophilus influenzae 22.1-21]
 gi|148716428|gb|ABQ98638.1| GTPase EngB [Haemophilus influenzae PittEE]
 gi|260095026|gb|EEW78918.1| GTPase EngB [Haemophilus influenzae NT127]
 gi|301169859|emb|CBW29463.1| predicted bifunctional enzyme and transcriptional regulator
          [Haemophilus influenzae 10810]
 gi|309973415|gb|ADO96616.1| Competence protein ComM [Haemophilus influenzae R2846]
          Length = 509

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G  +VGLP+K V E+++R++S  ++A   +  
Sbjct: 3  LAIVYSRASMGVQAPLVTIEVHLSNGKPGFTLVGLPEKTVKEAQDRVRSALMNAQFKY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|289423568|ref|ZP_06425369.1| putative Mg chelatase [Peptostreptococcus anaerobius 653-L]
 gi|289156070|gb|EFD04734.1| putative Mg chelatase [Peptostreptococcus anaerobius 653-L]
          Length = 531

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI+++      GI+G  ++V++ +  G     IVGL    V ES+ER++S   ++G  F 
Sbjct: 1  MINKVKAGMILGIEGRIIDVEIDIGKGMPCFSIVGLAGTEVKESKERVRSAITNSGYDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PLKRIVVNLSPADL 73


>gi|15603375|ref|NP_246449.1| ComM [Pasteurella multocida subsp. multocida str. Pm70]
 gi|12721896|gb|AAK03594.1| ComM [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 509

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V  S G+    +VGLP+K V E+++R++S  ++A   +  
Sbjct: 3  LAIVYSRASMGVQAPLVTIEVHFSNGKPQFNLVGLPEKTVKEAQDRVRSALLNAQFKY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|119483342|ref|ZP_01618756.1| Mg chelatase-related protein [Lyngbya sp. PCC 8106]
 gi|119458109|gb|EAW39231.1| Mg chelatase-related protein [Lyngbya sp. PCC 8106]
          Length = 509

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + +  GI  + V V+V +S G   + ++GLPD AV ESRER+++   +AG  F 
Sbjct: 1  MLARVWSASVVGIDAVKVGVEVDISGGLPKIVVLGLPDTAVQESRERVKATLKNAGYAF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PMRSIVINLTPADL 73


>gi|37520045|ref|NP_923422.1| competence protein ComM-like protein [Gloeobacter violaceus PCC
          7421]
 gi|35211037|dbj|BAC88417.1| glr0476 [Gloeobacter violaceus PCC 7421]
          Length = 512

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ + + A  GI  + V V+V V  G     +VGLPD AV ESRERI++   +AG +F 
Sbjct: 1  MLACVRSAALSGIDALGVTVEVDVGFGLPQTTLVGLPDAAVQESRERIKAALQNAGFVF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PMRRIIVNLAPGDL 73


>gi|16273042|ref|NP_439274.1| competence protein [Haemophilus influenzae Rd KW20]
 gi|1176314|sp|P45049|COMM_HAEIN RecName: Full=Competence protein ComM
 gi|1574671|gb|AAC22771.1| competence protein (comM) [Haemophilus influenzae Rd KW20]
          Length = 509

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G  +VGLP+K V E+++R++S  ++A   +  
Sbjct: 3  LAIVYSRASMGVQAPLVTIEVHLSNGKPGFTLVGLPEKTVKEAQDRVRSALMNAQFKY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|121610257|ref|YP_998064.1| Mg chelatase subunit ChlI [Verminephrobacter eiseniae EF01-2]
 gi|121554897|gb|ABM59046.1| Mg chelatase, subunit ChlI [Verminephrobacter eiseniae EF01-2]
          Length = 569

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 4/77 (5%)

Query: 2   ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           ++ + + A  G++   V V+V ++ G     +VGL +  V E+RER++S   +AGL F  
Sbjct: 61  LALVQSRALLGLQAPCVTVEVHLANGLPSFTLVGLAEVEVKEARERVRSALQNAGLEFPH 120

Query: 62  NELPSIYLQLIYQKKDL 78
           N      + +     DL
Sbjct: 121 N----KRITVNLAPADL 133


>gi|320529023|ref|ZP_08030115.1| Mg chelatase-like protein [Selenomonas artemidis F0399]
 gi|320138653|gb|EFW30543.1| Mg chelatase-like protein [Selenomonas artemidis F0399]
          Length = 509

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M ++       GI G  ++V+V  S G  G ++VGLPD +V ES+ER+++   ++G    
Sbjct: 1  MFAKTYGATTLGIDGRIIDVEVDASFGLPGFELVGLPDTSVKESKERVRTAIRNSGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            +L    + +     D+
Sbjct: 58 --QLRQERVTVNLAPADV 73


>gi|226949792|ref|YP_002804883.1| putative Mg chelatase [Clostridium botulinum A2 str. Kyoto]
 gi|226843448|gb|ACO86114.1| putative Mg chelatase [Clostridium botulinum A2 str. Kyoto]
          Length = 507

 Score =  107 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S++ T    G     + V+V +S G     IVGL D +V ES+ER++S   ++G  F 
Sbjct: 1  MTSKVITATLNGACCNLISVEVDISHGLPAFNIVGLADTSVKESKERVKSAITNSGYQF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 60 ----PISKITVNLSPADI 73


>gi|325576564|ref|ZP_08147282.1| Mg chelatase-like protein [Haemophilus parainfluenzae ATCC 33392]
 gi|325161127|gb|EGC73242.1| Mg chelatase-like protein [Haemophilus parainfluenzae ATCC 33392]
          Length = 509

 Score =  107 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G  +VGLP+K V E+++R++S  ++A   +  
Sbjct: 3  LAIVYSRASMGVQAPLVTIEVHLSNGKPGFTLVGLPEKTVKEAQDRVRSALMNAQFKY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|220925263|ref|YP_002500565.1| Mg chelatase subunit ChlI [Methylobacterium nodulans ORS 2060]
 gi|219949870|gb|ACL60262.1| Mg chelatase, subunit ChlI [Methylobacterium nodulans ORS 2060]
          Length = 512

 Score =  106 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 52/78 (66%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R++T+AF+GI+   V+VQV ++PG V   +VGLPDKAV ESRER+++  I +GL   
Sbjct: 1  MVTRVATVAFEGIEARAVDVQVQIAPGTVAFTVVGLPDKAVAESRERVRAALIASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPAKRITVNLAPADL 73


>gi|332652558|ref|ZP_08418303.1| Mg chelatase-like protein [Ruminococcaceae bacterium D16]
 gi|332517704|gb|EGJ47307.1| Mg chelatase-like protein [Ruminococcaceae bacterium D16]
          Length = 522

 Score =  106 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+  + ++   GI G  V V+  +S G     IVGLPD AV E+RER+++   + G  F 
Sbjct: 23 MVYNVRSLGLHGIAGYSVSVECDLSSGLPAFTIVGLPDAAVNEARERVRAAIKNCGFSF- 81

Query: 61 VNELPSIYLQLIYQKK 76
              P   + +     
Sbjct: 82 ----PVSRITVNLAPA 93


>gi|254495886|ref|ZP_05108795.1| competence related protein ComM [Legionella drancourtii LLAP12]
 gi|254354868|gb|EET13494.1| competence related protein ComM [Legionella drancourtii LLAP12]
          Length = 503

 Score =  106 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++   T +  GI   PV V+V +S G     IVGL + AV ES++R++S  I++      
Sbjct: 3  LAFTKTRSTIGILAQPVSVEVHLSNGLPSFTIVGLAETAVKESKDRVRSAIINSQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPCRKITVNLGPADL 74


>gi|13473967|ref|NP_105535.1| Mg(2+) chelatase family protein [Mesorhizobium loti MAFF303099]
 gi|14024718|dbj|BAB51321.1| Mg(2+) chelatase family protein [Mesorhizobium loti MAFF303099]
          Length = 231

 Score =  106 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 40/78 (51%), Positives = 57/78 (73%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AFQGI+ +PV+VQVM++PG+VG+QIVGLPDKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVRTVAFQGIEAVPVDVQVMIAPGKVGMQIVGLPDKAVAESRERVQAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +PS  + +     DL
Sbjct: 58 --SMPSKKVTVNLAPADL 73


>gi|78484547|ref|YP_390472.1| Mg chelatase-related protein [Thiomicrospira crunogena XCL-2]
 gi|78362833|gb|ABB40798.1| Mg chelatase-related protein [Thiomicrospira crunogena XCL-2]
          Length = 511

 Score =  106 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           S I +    G++   V+V+V  + G   + IVGLP+ +V ESR+R++S  + +G     
Sbjct: 8  YSTIFSRTVSGVQAPEVQVEVHSTNGLPSLSIVGLPEASVKESRDRVRSALLSSGF---- 63

Query: 62 NELPSIYLQLIYQKKDL 78
            LP   + +     D+
Sbjct: 64 -SLPPKRITINLAPADI 79


>gi|170738562|ref|YP_001767217.1| Mg chelatase subunit ChlI [Methylobacterium sp. 4-46]
 gi|168192836|gb|ACA14783.1| Mg chelatase, subunit ChlI [Methylobacterium sp. 4-46]
          Length = 512

 Score =  106 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 51/78 (65%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R++T+AF+GI+   V+VQV ++ G V   +VGLPDKAV ESRER+++  I +GL   
Sbjct: 1  MVTRVATVAFEGIEARAVDVQVQIAAGAVAFTVVGLPDKAVAESRERVRAALIASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPAKRITVNLAPADL 73


>gi|229843850|ref|ZP_04463991.1| GTPase EngB [Haemophilus influenzae 6P18H1]
 gi|229812844|gb|EEP48532.1| GTPase EngB [Haemophilus influenzae 6P18H1]
          Length = 509

 Score =  106 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G  +VGLP+K V E+++R++S  ++A   +  
Sbjct: 3  LAIVYSRASMGVQAPLVTIEVHLSNGKPGFTLVGLPEKTVKEAQDRVRSALMNAQFKY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|301155453|emb|CBW14919.1| predicted bifunctional enzyme and transcriptional regulator
          [Haemophilus parainfluenzae T3T1]
          Length = 509

 Score =  106 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G  +VGLP+K V E+++R++S  ++A   +  
Sbjct: 3  LAIVYSRASMGVQAPLVTIEVHLSNGKPGFTLVGLPEKTVKEAQDRVRSALMNAQFKY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|237805523|ref|ZP_04592227.1| Mg chelatase-related protein [Pseudomonas syringae pv. oryzae
          str. 1_6]
 gi|331026630|gb|EGI06685.1| Mg chelatase-related protein [Pseudomonas syringae pv. oryzae
          str. 1_6]
          Length = 144

 Score =  106 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  +++GL F  
Sbjct: 3  LAIVHSRAQVGVEAPAVTVEAHLANGLPALTLVGLPEGAVKESKDRVRSAILNSGLDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|86747541|ref|YP_484037.1| Mg chelatase-related protein [Rhodopseudomonas palustris HaA2]
 gi|86570569|gb|ABD05126.1| Mg chelatase-related protein [Rhodopseudomonas palustris HaA2]
          Length = 512

 Score =  106 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 47/78 (60%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+  +ST+AF+GI    V+VQV VSPG     +VGL DKAV E+RER++S  I +GL   
Sbjct: 1  MVQHVSTVAFEGIDARAVDVQVQVSPGLPAFAVVGLADKAVSEARERVRSALIASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPARRITVNLAPADL 73


>gi|300870915|ref|YP_003785786.1| putative ATPase with chaperone activity [Brachyspira pilosicoli
          95/1000]
 gi|300688614|gb|ADK31285.1| predicted ATPase with chaperone activity [Brachyspira pilosicoli
          95/1000]
          Length = 507

 Score =  106 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M ++I + A  GI+GIP+ ++V +S G     +VGLPD+AV E++ER+ +   ++     
Sbjct: 1  MHTKIYSEALYGIEGIPITIEVNISEGLPKFDVVGLPDQAVNEAKERVIAAINNS----- 55

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 56 DRFFPPKRITINLAPADI 73


>gi|261367454|ref|ZP_05980337.1| Mg chelatase-like protein [Subdoligranulum variabile DSM 15176]
 gi|282570226|gb|EFB75761.1| Mg chelatase-like protein [Subdoligranulum variabile DSM 15176]
          Length = 509

 Score =  106 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M ++++++   G+ G  V+V+  +S G     +V LPD AV ES ER++S   +      
Sbjct: 1  MYAKVTSLGVTGLAGYLVQVEADLSGGLPQFNLVDLPDSAVKESSERVRSAVKNLHYP-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 59 ---WPPSRITINLAPADV 73


>gi|225849938|ref|YP_002730172.1| putative Mg chelatase family protein [Persephonella marina EX-H1]
 gi|225644861|gb|ACO03047.1| putative Mg chelatase family protein [Persephonella marina EX-H1]
          Length = 506

 Score =  106 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 5/79 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S + +    G+ G  V V+V +S G      VGLPD AV ES+ER++S   + G+ F 
Sbjct: 1  MLSVVKSGGVIGVDGYSVHVEVNISQGLPQFITVGLPDAAVKESKERVKSAINNIGISF- 59

Query: 61 VNELPSIYLQLIYQKKDLI 79
              P   + +     D++
Sbjct: 60 ----PLRKIVVNLAPADIL 74


>gi|52426053|ref|YP_089190.1| hypothetical protein MS1998 [Mannheimia succiniciproducens
          MBEL55E]
 gi|52308105|gb|AAU38605.1| unknown [Mannheimia succiniciproducens MBEL55E]
          Length = 290

 Score =  106 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  GI+   V ++V +S G+ G  +VGLP+K V E+++R++S  I+    +  
Sbjct: 3  LAIVYTRASMGIQAPLVTIEVHISNGKPGFTLVGLPEKTVKEAQDRVRSALINTQFKY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|260463427|ref|ZP_05811627.1| Mg chelatase, subunit ChlI [Mesorhizobium opportunistum WSM2075]
 gi|259030752|gb|EEW32028.1| Mg chelatase, subunit ChlI [Mesorhizobium opportunistum WSM2075]
          Length = 510

 Score =  106 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 38/78 (48%), Positives = 55/78 (70%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AFQGI+ +PV+VQVM++PG+V + IVGLPDKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVRTVAFQGIEAVPVDVQVMIAPGKVNMHIVGLPDKAVAESRERVQAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +PS  + +     DL
Sbjct: 58 --SMPSKKVTINLAPADL 73


>gi|160895227|ref|ZP_02075999.1| hypothetical protein CLOL250_02787 [Clostridium sp. L2-50]
 gi|156863106|gb|EDO56537.1| hypothetical protein CLOL250_02787 [Clostridium sp. L2-50]
          Length = 529

 Score =  106 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 15/78 (19%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S++++    G++G+ ++V+  ++ G     +VG     V E+ ER+++   ++G    
Sbjct: 3  MYSKVTSGGVLGVEGLLIQVETDINDGLPMFNMVGFLSACVKEAGERVRTALKNSGF--- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
            ++P   + +     D+
Sbjct: 60 --QIPPKRITINLSPADI 75


>gi|329124155|ref|ZP_08252702.1| competence protein ComM [Haemophilus aegyptius ATCC 11116]
 gi|327467580|gb|EGF13078.1| competence protein ComM [Haemophilus aegyptius ATCC 11116]
          Length = 532

 Score =  106 bits (267), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G  +VGLP+K V E+++R++S  ++A   +  
Sbjct: 26 LAIVYSRASMGVQAPLVTIEVHLSNGKPGFTLVGLPEKTVKEAQDRVRSALMNAQFKY-- 83

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 84 ---PAKRITVNLAPADL 97


>gi|222109400|ref|YP_002551664.1| mg chelatase subunit chli [Acidovorax ebreus TPSY]
 gi|221728844|gb|ACM31664.1| Mg chelatase, subunit ChlI [Acidovorax ebreus TPSY]
          Length = 512

 Score =  106 bits (267), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 4/77 (5%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V ++ G     +VGL D  V E+RER++S   +AGL F  
Sbjct: 3  LALVQSRALLGLHAPAVTVEVHLANGLPSFALVGLADVEVKEARERVRSALQNAGLEFPA 62

Query: 62 NELPSIYLQLIYQKKDL 78
          N      + +     DL
Sbjct: 63 N----KKITVNLAPADL 75


>gi|254465541|ref|ZP_05078952.1| Mg chelatase family protein [Rhodobacterales bacterium Y4I]
 gi|206686449|gb|EDZ46931.1| Mg chelatase family protein [Rhodobacterales bacterium Y4I]
          Length = 502

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +R  T+AFQG++   VEVQ  V+PG     +VGLPDKAV E+RER+++         +
Sbjct: 1  MTARSYTVAFQGVEARLVEVQCAVAPGLPAFSVVGLPDKAVQEARERVRAA-----FAAM 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 56 SIALPSRRITVNLSPADL 73


>gi|307543691|ref|YP_003896170.1| magnesium chelatase [Halomonas elongata DSM 2581]
 gi|307215715|emb|CBV40985.1| K07391 magnesium chelatase family protein [Halomonas elongata DSM
          2581]
          Length = 501

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  G++   V V+V ++ G  G+ +VGLP+ AV ESRER++S  ++AG     
Sbjct: 3  LAIIRTRAGLGLEAPEVLVEVHLTNGLPGITLVGLPETAVKESRERVRSALVNAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + L     DL
Sbjct: 59 -EFPLRRITLNLAPADL 74


>gi|315633422|ref|ZP_07888713.1| competence protein ComM family protein [Aggregatibacter segnis
          ATCC 33393]
 gi|315477922|gb|EFU68663.1| competence protein ComM family protein [Aggregatibacter segnis
          ATCC 33393]
          Length = 293

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G  +VGLP+K V E+++R++S  ++A   +  
Sbjct: 8  LAIVYSRASIGVQAPLVTIEVHLSNGKPGFTLVGLPEKTVKEAQDRVRSALLNAEFRY-- 65

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 66 ---PAKRITVNLAPADL 79


>gi|300863843|ref|ZP_07108768.1| Mg chelatase, subunit ChlI [Oscillatoria sp. PCC 6506]
 gi|300338191|emb|CBN53914.1| Mg chelatase, subunit ChlI [Oscillatoria sp. PCC 6506]
          Length = 509

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + +  GI  + V V+V VS G   + +VGLPD AV E++ER+++   +AG  F 
Sbjct: 1  MLARVWSASIVGIDAVKVGVEVDVSGGLPKIVVVGLPDTAVQEAKERVKATLKNAGYAF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PMRSIVINLTPADL 73


>gi|192288751|ref|YP_001989356.1| Mg chelatase, subunit ChlI [Rhodopseudomonas palustris TIE-1]
 gi|192282500|gb|ACE98880.1| Mg chelatase, subunit ChlI [Rhodopseudomonas palustris TIE-1]
          Length = 512

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 48/78 (61%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+  +ST+AF+GI+   V+VQV VSPG     +VGL DKAV E+RER++S  I +GL   
Sbjct: 1  MVQHVSTVAFEGIEARSVDVQVQVSPGLPAFAMVGLADKAVSEARERVRSALIASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPARRITVNLAPADL 73


>gi|160895733|ref|YP_001561315.1| Mg chelatase subunit ChlI [Delftia acidovorans SPH-1]
 gi|160361317|gb|ABX32930.1| Mg chelatase, subunit ChlI [Delftia acidovorans SPH-1]
          Length = 549

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 4/77 (5%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V ++ G     +VGL D  V E+RER++S  +++GL F  
Sbjct: 3  LALVQSRALLGLAAPRVTVEVHLANGLPSFTLVGLADVEVKEARERVRSALLNSGLEFPS 62

Query: 62 NELPSIYLQLIYQKKDL 78
          N      + +     DL
Sbjct: 63 N----KRIIVNLAPADL 75


>gi|110807541|ref|YP_691061.1| putative ATP-dependent protease [Shigella flexneri 5 str. 8401]
 gi|110617089|gb|ABF05756.1| putative 2-component regulator [Shigella flexneri 5 str. 8401]
 gi|332751006|gb|EGJ81411.1| competence protein comM [Shigella flexneri 4343-70]
 gi|332996868|gb|EGK16488.1| competence protein comM [Shigella flexneri VA-6]
 gi|332997926|gb|EGK17533.1| competence protein comM [Shigella flexneri K-218]
          Length = 506

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A   +   P+ V+V +S G  G+ +VGL +  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALEVNAPPITVEVHISKGLPGLTMVGLTETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|88658582|ref|YP_507346.1| magnesium chelatase subunit D/I family protein [Ehrlichia
          chaffeensis str. Arkansas]
 gi|88600039|gb|ABD45508.1| magnesium chelatase, subunit D/I family, ComM subfamily
          [Ehrlichia chaffeensis str. Arkansas]
          Length = 500

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++RI +I F GI  I V+VQ+ V+ G     IVGLPDKAV ESRERI++          
Sbjct: 1  MMARIKSIGFYGIHTINVDVQIHVAKGIPAFNIVGLPDKAVAESRERIRAALNSI----- 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 56 NISLPTQRITVNLSPADL 73


>gi|327192037|gb|EGE59018.1| putative Mg-chelatase protein [Rhizobium etli CNPAF512]
          Length = 540

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 42/78 (53%), Positives = 59/78 (75%), Gaps = 5/78 (6%)

Query: 1   MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
           M++R+ST+AFQGI+G+PVEVQVM++PG++G+QIVGLPDKAV ESRER+Q+    +GL   
Sbjct: 31  MVARVSTVAFQGIEGVPVEVQVMIAPGKIGMQIVGLPDKAVAESRERVQAALHASGL--- 87

Query: 61  VNELPSIYLQLIYQKKDL 78
              LP+  + +     DL
Sbjct: 88  --ALPAKRVTVNLAPADL 103


>gi|121592596|ref|YP_984492.1| Mg chelatase subunit ChlI [Acidovorax sp. JS42]
 gi|120604676|gb|ABM40416.1| Mg chelatase, subunit ChlI [Acidovorax sp. JS42]
          Length = 512

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 4/77 (5%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V ++ G     +VGL D  V E+RER++S   +AGL F  
Sbjct: 3  LALVQSRALLGLHAPAVTVEVHLANGLPSFALVGLADVEVKEARERVRSALQNAGLEFPA 62

Query: 62 NELPSIYLQLIYQKKDL 78
          N      + +     DL
Sbjct: 63 N----KKITVNLAPADL 75


>gi|299133253|ref|ZP_07026448.1| magnesium chelatase ChlI subunit [Afipia sp. 1NLS2]
 gi|298593390|gb|EFI53590.1| magnesium chelatase ChlI subunit [Afipia sp. 1NLS2]
          Length = 215

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 49/78 (62%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+  +ST+AF+GI+   V+VQV V+PG     IVGLPDKAV E+RER+++  I +GL   
Sbjct: 1  MVQHVSTMAFEGIEARAVDVQVQVAPGLPAFSIVGLPDKAVSEARERVRAALIASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPARRITVNLAPADL 73


>gi|91974885|ref|YP_567544.1| Mg chelatase-related protein [Rhodopseudomonas palustris BisB5]
 gi|91681341|gb|ABE37643.1| Mg chelatase-related protein [Rhodopseudomonas palustris BisB5]
          Length = 512

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 48/78 (61%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+  +ST+AF+GI+   V+VQV VSPG     +VGL DKAV E+RER++S  I +GL   
Sbjct: 1  MVQHVSTVAFEGIEARAVDVQVQVSPGLPAFAVVGLADKAVSEARERVRSALIASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPARRITVNLAPADL 73


>gi|237797804|ref|ZP_04586265.1| Mg-chelatase subunits D/I family, ComM subfamily protein
          [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|237806013|ref|ZP_04592717.1| Mg-chelatase subunits D/I family, ComM subfamily protein
          [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331020654|gb|EGI00711.1| Mg-chelatase subunits D/I family, ComM subfamily protein
          [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331027123|gb|EGI07178.1| Mg-chelatase subunits D/I family, ComM subfamily protein
          [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 180

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  +++GL F  
Sbjct: 3  LAIVHSRAQVGVEAPAVTVEAHLANGLPALTLVGLPEGAVKESKDRVRSAILNSGLDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|39933395|ref|NP_945671.1| Mg chelatase-like protein [Rhodopseudomonas palustris CGA009]
 gi|39653020|emb|CAE25762.1| putative Mg(2+) chelatase family protein [Rhodopseudomonas
          palustris CGA009]
          Length = 512

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 48/78 (61%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+  +ST+AF+GI+   V+VQV VSPG     +VGL DKAV E+RER++S  I +GL   
Sbjct: 1  MVQHVSTVAFEGIEARSVDVQVQVSPGLPAFAMVGLADKAVSEARERVRSALIASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPARRITVNLAPADL 73


>gi|68171916|ref|ZP_00545235.1| Mg chelatase-related protein [Ehrlichia chaffeensis str. Sapulpa]
 gi|67998661|gb|EAM85394.1| Mg chelatase-related protein [Ehrlichia chaffeensis str. Sapulpa]
          Length = 500

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++RI +I F GI  I V+VQ+ V+ G     IVGLPDKAV ESRERI++          
Sbjct: 1  MMARIKSIGFYGIHTINVDVQIHVAKGIPAFNIVGLPDKAVAESRERIRAALNSI----- 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 56 NISLPTQRITVNLSPADL 73


>gi|320106037|ref|YP_004181627.1| Mg chelatase subunit ChlI [Terriglobus saanensis SP1PR4]
 gi|319924558|gb|ADV81633.1| Mg chelatase, subunit ChlI [Terriglobus saanensis SP1PR4]
          Length = 527

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 8/81 (9%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVS---PGRVGVQIVGLPDKAVIESRERIQSHFIHAGL 57
          M+ +  + A  GI    ++V+V  S          +VGLPD AV ESR+R+++   ++G 
Sbjct: 1  MLFKARSAAVYGIDAHIIDVEVDFSGVKREEEQFAMVGLPDAAVRESRDRVRAAIKNSGF 60

Query: 58 LFLVNELPSIYLQLIYQKKDL 78
                LP   + +     DL
Sbjct: 61 D-----LPPTRITINLAPADL 76


>gi|238028726|ref|YP_002912957.1| Mg chelatase subunit ChlI [Burkholderia glumae BGR1]
 gi|237877920|gb|ACR30253.1| Mg chelatase, subunit ChlI [Burkholderia glumae BGR1]
          Length = 557

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A        V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPAAGHAPEVTVEVHLANGLPSFSIVGLPDTEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|293604701|ref|ZP_06687101.1| competence protein ComM [Achromobacter piechaudii ATCC 43553]
 gi|292816870|gb|EFF75951.1| competence protein ComM [Achromobacter piechaudii ATCC 43553]
          Length = 510

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ +++ A  G+    V V+  + PG     +VGL D  V ESRER+++  +++G  F  
Sbjct: 3  LAVLASRALSGLHAHAVRVETHLGPGLPSFNVVGLADTEVRESRERVRAAILNSGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     D+
Sbjct: 61 ---PPGRITVNLSPADI 74


>gi|225620993|ref|YP_002722251.1| putative ATPase with chaperone activity [Brachyspira
          hyodysenteriae WA1]
 gi|225215813|gb|ACN84547.1| predicted ATPase with chaperone activity [Brachyspira
          hyodysenteriae WA1]
          Length = 518

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M ++I + A  GI+GIP+ ++V +S G     +VGLPD+AV E++ER+ +   ++     
Sbjct: 12 MHTKIYSEALYGIEGIPIVIEVNISEGLPKFDVVGLPDQAVNEAKERVIAAINNS----- 66

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 67 DRFFPPKRITINLAPADL 84


>gi|313647786|gb|EFS12233.1| competence protein comM [Shigella flexneri 2a str. 2457T]
 gi|332751095|gb|EGJ81499.1| competence protein comM [Shigella flexneri K-671]
 gi|332751940|gb|EGJ82335.1| competence protein comM [Shigella flexneri 2747-71]
 gi|333013581|gb|EGK32948.1| competence protein comM [Shigella flexneri K-304]
          Length = 380

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + T A   +   P+ V+V +S G  G+ +VGL +  V E+R+R++S  I++G     
Sbjct: 3  LSIVHTRAALEVNAPPITVEVHISKGLPGLTMVGLTETTVKEARDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPAKKITINLAPADL 74


>gi|85709453|ref|ZP_01040518.1| predicted ATPase [Erythrobacter sp. NAP1]
 gi|85688163|gb|EAQ28167.1| predicted ATPase [Erythrobacter sp. NAP1]
          Length = 497

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ + T+A+ G++   VEVQ  V+PG     IVGLPDKAV ESRER+Q+     GL   
Sbjct: 1  MVALVQTVAYLGLEARKVEVQCQVAPGLPRFSIVGLPDKAVSESRERVQAALSAMGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     DL
Sbjct: 58 --AMPPKRITINLSPADL 73


>gi|163757804|ref|ZP_02164893.1| probable Mg-chelatase protein [Hoeflea phototrophica DFL-43]
 gi|162285306|gb|EDQ35588.1| probable Mg-chelatase protein [Hoeflea phototrophica DFL-43]
          Length = 510

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/78 (51%), Positives = 57/78 (73%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ST+AF+GI+ +PV+VQVMV+PG+VG+ IVGLPDKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVSTVAFEGIEAVPVDVQVMVAPGKVGMHIVGLPDKAVAESRERVQAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPAKKVTINLAPADL 73


>gi|298530296|ref|ZP_07017698.1| Mg chelatase, subunit ChlI [Desulfonatronospira thiodismutans
          ASO3-1]
 gi|298509670|gb|EFI33574.1| Mg chelatase, subunit ChlI [Desulfonatronospira thiodismutans
          ASO3-1]
          Length = 510

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSP-GRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M ++I+T A  GI  I +E++V  S  G     +VGL + AV ES+ER+ S   ++G   
Sbjct: 1  MFAKITTAALLGIDAIRIELEVDYSRAGMPAFTLVGLAEGAVKESKERVFSALKNSGYK- 59

Query: 60 LVNELPSIYLQLIYQKKDL 78
              LP   + +     D+
Sbjct: 60 ----LPPARITINLAPADV 74


>gi|221135035|ref|ZP_03561338.1| Mg chelatase, subunit ChlI [Glaciecola sp. HTCC2999]
          Length = 518

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S I   +  GIK   + ++V +S G     +VGLP +++ E++ER++S  +++GL F  
Sbjct: 3  LSVIHARSAIGIKAPLITIEVHISAGLPAFNVVGLPHRSISEAKERVRSAILNSGLTF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PPKRITINLSPADL 74


>gi|269928641|ref|YP_003320962.1| Mg chelatase, subunit ChlI [Sphaerobacter thermophilus DSM 20745]
 gi|269787998|gb|ACZ40140.1| Mg chelatase, subunit ChlI [Sphaerobacter thermophilus DSM 20745]
          Length = 506

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ + T A  G+ G+ VEV+V    G  G+ IVGLPD AV ESRER+++   ++G  F 
Sbjct: 1  MLATVLTCAVIGLDGVLVEVEVDCRSGSPGLTIVGLPDAAVQESRERVRAAIRNSGARF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 60 ----PLGRITVNLAPADI 73


>gi|145636431|ref|ZP_01792099.1| competence protein [Haemophilus influenzae PittHH]
 gi|145270256|gb|EDK10191.1| competence protein [Haemophilus influenzae PittHH]
          Length = 380

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G  +VGLP+K V E+++R++S  ++A   +  
Sbjct: 3  LAIVYSRASMGVQAPLVTIEVHLSNGKPGFTLVGLPEKTVKEAQDRVRSALMNAQFKY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|145639363|ref|ZP_01794969.1| competence protein [Haemophilus influenzae PittII]
 gi|145271666|gb|EDK11577.1| competence protein [Haemophilus influenzae PittII]
          Length = 389

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G  +VGLP+K V E+++R++S  ++A   +  
Sbjct: 3  LAIVYSRASMGVQAPLVTIEVHLSNGKPGFTLVGLPEKTVKEAQDRVRSALMNAQFKY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|316931701|ref|YP_004106683.1| Mg chelatase subunit ChlI [Rhodopseudomonas palustris DX-1]
 gi|315599415|gb|ADU41950.1| Mg chelatase, subunit ChlI [Rhodopseudomonas palustris DX-1]
          Length = 512

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 48/78 (61%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+  +ST+AF+GI+   V+VQV VSPG     +VGL DKAV E+RER++S  I +GL   
Sbjct: 1  MVQHVSTVAFEGIEARSVDVQVQVSPGLPAFAVVGLADKAVSEARERVRSALIASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPARRITVNLAPADL 73


>gi|189220304|ref|YP_001940944.1| ATPase with chaperone activity [Methylacidiphilum infernorum V4]
 gi|189187162|gb|ACD84347.1| Predicted ATPase with chaperone activity [Methylacidiphilum
          infernorum V4]
          Length = 512

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +RI + A  GI+ IPVEV+  VSPG    ++VGLPD AV ES  R+ S   + G    
Sbjct: 4  MFTRIFSAALWGIESIPVEVETDVSPGLPSTRVVGLPDAAVKESLHRVSSSLKNCGF--- 60

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   L +     DL
Sbjct: 61 --SLPLGKLTINLAPADL 76


>gi|304404232|ref|ZP_07385894.1| Mg chelatase, subunit ChlI [Paenibacillus curdlanolyticus YK9]
 gi|304347210|gb|EFM13042.1| Mg chelatase, subunit ChlI [Paenibacillus curdlanolyticus YK9]
          Length = 520

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M + +   +  GI GI + V+  ++ G   V +VGLPD A+ ES ER+++   + G  F 
Sbjct: 1  MYASLLGSSVSGIDGISIAVEADIASGLPQVNLVGLPDSAIRESSERVRAAIRNCGFQF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PMSRITINLAPADL 73


>gi|261866836|ref|YP_003254758.1| putative Mg chelatase-like protein [Aggregatibacter
          actinomycetemcomitans D11S-1]
 gi|261412168|gb|ACX81539.1| putative Mg chelatase-like protein [Aggregatibacter
          actinomycetemcomitans D11S-1]
          Length = 288

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G  +VGLP+K V E+++R++S  ++A   +  
Sbjct: 3  LAIVYSRASMGVQAPLVTIEVHLSNGKPGFTLVGLPEKTVKEAQDRVRSALLNAEFRY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRVTVNLAPADL 74


>gi|182677560|ref|YP_001831706.1| Mg chelatase, subunit ChlI [Beijerinckia indica subsp. indica
          ATCC 9039]
 gi|182633443|gb|ACB94217.1| Mg chelatase, subunit ChlI [Beijerinckia indica subsp. indica
          ATCC 9039]
          Length = 512

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 49/78 (62%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ RI+T+AF+GI+  PV+VQV ++ G V   +VGL DKAV ESRER+++    +GL   
Sbjct: 1  MVVRIATVAFEGIEARPVDVQVQIANGNVVFAVVGLGDKAVAESRERVRAALNASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPAKRITVNLAPADL 73


>gi|194333355|ref|YP_002015215.1| Mg chelatase subunit ChlI [Prosthecochloris aestuarii DSM 271]
 gi|194311173|gb|ACF45568.1| Mg chelatase, subunit ChlI [Prosthecochloris aestuarii DSM 271]
          Length = 516

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S++S  A  GI  + VEV+   + G     +VGLPD A+ ESRERI +   ++GL   
Sbjct: 1  MLSQLSAAALTGIDALKVEVETNAASGIPSFTVVGLPDNAIRESRERIMTAIRNSGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            ELP   + +     D+
Sbjct: 58 --ELPPKKITVNLAPADV 73


>gi|291166171|gb|EFE28217.1| Mg chelatase-like protein [Filifactor alocis ATCC 35896]
          Length = 507

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 39/76 (51%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  +  +   +GI+G  V V+  VS G     +VGLPD AV ES+ERI S  +++GL F 
Sbjct: 1  MFFKSLSSGIEGIEGYIVNVEADVSKGIPNFTMVGLPDTAVKESKERIHSAILNSGLKF- 59

Query: 61 VNELPSIYLQLIYQKK 76
              P+  + +     
Sbjct: 60 ----PNKKIVINLSPS 71


>gi|167855938|ref|ZP_02478686.1| Competence protein comM [Haemophilus parasuis 29755]
 gi|167852932|gb|EDS24198.1| Competence protein comM [Haemophilus parasuis 29755]
          Length = 510

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V ++V +S G  G+ +VGLP+K+V E+++R++S  ++A   +  
Sbjct: 3  LAIIYSRASIGVEAPLVTIEVHISGGSPGLTLVGLPEKSVKEAQDRVRSALMNANFDY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PARRITINLAPADL 74


>gi|332295817|ref|YP_004437740.1| Mg chelatase, subunit ChlI [Thermodesulfobium narugense DSM
          14796]
 gi|332178920|gb|AEE14609.1| Mg chelatase, subunit ChlI [Thermodesulfobium narugense DSM
          14796]
          Length = 508

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MIS+I ++   G+    V+++V  + G  G  IVGLPD  + ESRERI++   H     +
Sbjct: 1  MISKIKSVTLNGLDAYLVDIEVSFTTGYPGFTIVGLPDTVIQESRERIKTALKH-----V 55

Query: 61 VNELPSIYLQLIYQKKDL 78
           +E+P   + +     DL
Sbjct: 56 YSEIPVKKITVNLAPADL 73


>gi|219871833|ref|YP_002476208.1| competence protein M [Haemophilus parasuis SH0165]
 gi|219692037|gb|ACL33260.1| competence protein M [Haemophilus parasuis SH0165]
          Length = 510

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I + A  G++   V ++V +S G  G+ +VGLP+K+V E+++R++S  ++A   +  
Sbjct: 3  LAIIYSRASIGVEAPLVTIEVHISGGSPGLTLVGLPEKSVKEAQDRVRSALMNANFDY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PARRITINLAPADL 74


>gi|259416239|ref|ZP_05740159.1| putative Mg chelatase family protein [Silicibacter sp. TrichCH4B]
 gi|259347678|gb|EEW59455.1| putative Mg chelatase family protein [Silicibacter sp. TrichCH4B]
          Length = 500

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 46/78 (58%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MISR  T+AFQG++  PVEVQ  V+PG     IVGLPDKAV E+R+R++S         +
Sbjct: 1  MISRAQTVAFQGVEACPVEVQCAVAPGLPAFSIVGLPDKAVSEARDRVRSAL-----AVM 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 56 SIALPSKRITINLSPADL 73


>gi|209524574|ref|ZP_03273122.1| Mg chelatase, subunit ChlI [Arthrospira maxima CS-328]
 gi|209495032|gb|EDZ95339.1| Mg chelatase, subunit ChlI [Arthrospira maxima CS-328]
          Length = 509

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + +  GI  + V V+V +S G   + ++GLPD AV ESRER+++   +AG  F 
Sbjct: 1  MLARVWSASVVGIDAVKVGVEVDLSGGLPKIIVLGLPDTAVQESRERVKATLKNAGYSF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PMGNIVINLTPADL 73


>gi|299138345|ref|ZP_07031524.1| Mg chelatase, subunit ChlI [Acidobacterium sp. MP5ACTX8]
 gi|298599591|gb|EFI55750.1| Mg chelatase, subunit ChlI [Acidobacterium sp. MP5ACTX8]
          Length = 530

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 8/81 (9%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSP---GRVGVQIVGLPDKAVIESRERIQSHFIHAGL 57
          M+ +  + A  GI    ++V+V  S     +     VGLPD AV ESR+R++S   ++G 
Sbjct: 1  MLFKTRSAAVYGIDAHIIDVEVDFSGVKLDQENFSTVGLPDAAVRESRDRVRSAIKNSGF 60

Query: 58 LFLVNELPSIYLQLIYQKKDL 78
                LP   + +     DL
Sbjct: 61 D-----LPPTRITINLAPADL 76


>gi|148556514|ref|YP_001264096.1| Mg chelatase subunit ChlI [Sphingomonas wittichii RW1]
 gi|148501704|gb|ABQ69958.1| Mg chelatase, subunit ChlI [Sphingomonas wittichii RW1]
          Length = 502

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 46/78 (58%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S ++T+AF G++   VEVQV V+PG     +VGLPDKAV ESRER+++     GL   
Sbjct: 1  MVSHVATVAFLGLEARAVEVQVQVAPGMPAFVVVGLPDKAVAESRERVRAALSAIGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 58 --ALPPKRITVNLSPADL 73


>gi|241207282|ref|YP_002978378.1| Mg chelatase, subunit ChlI [Rhizobium leguminosarum bv. trifolii
          WSM1325]
 gi|240861172|gb|ACS58839.1| Mg chelatase, subunit ChlI [Rhizobium leguminosarum bv. trifolii
          WSM1325]
          Length = 510

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 59/78 (75%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ST+AFQGI+G+PVEVQVMV+PG+VG+QIVGLPDKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVSTVAFQGIEGVPVEVQVMVAPGKVGMQIVGLPDKAVAESRERVQAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPAKRVTVNLAPADL 73


>gi|295101002|emb|CBK98547.1| Mg chelatase-related protein [Faecalibacterium prausnitzii L2-6]
          Length = 514

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M + + +   +G+ G PVEV+  +S G   + IVGLPD AV ES +R+ +   + G    
Sbjct: 1  MYAVLKSFGLKGLNGFPVEVEADISGGMPALSIVGLPDSAVRESGDRVHAALKNLGFK-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 59 ---WPDRRITINLAPADV 73


>gi|152978186|ref|YP_001343815.1| Mg chelatase, subunit ChlI [Actinobacillus succinogenes 130Z]
 gi|150839909|gb|ABR73880.1| Mg chelatase, subunit ChlI [Actinobacillus succinogenes 130Z]
          Length = 511

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+    +VGLP+K V E+++R++S  I+A   +  
Sbjct: 3  LAIVYSRASIGVQAPLVTIEVHISNGKPAFVLVGLPEKTVKEAQDRVRSALINAQFKY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|126739151|ref|ZP_01754845.1| competence protein ComM [Roseobacter sp. SK209-2-6]
 gi|126719768|gb|EBA16476.1| competence protein ComM [Roseobacter sp. SK209-2-6]
          Length = 500

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI+R  T+ FQGI+  PVEVQ  ++ G     IVGLPDKAV E+RERI++         +
Sbjct: 1  MIARAHTVTFQGIEARPVEVQCSLAAGLPAFSIVGLPDKAVSEARERIRAV-----FSAM 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 56 SIALPAKRITVNLSPADL 73


>gi|159045368|ref|YP_001534162.1| hypothetical protein Dshi_2828 [Dinoroseobacter shibae DFL 12]
 gi|157913128|gb|ABV94561.1| conserved hypothetical protein [Dinoroseobacter shibae DFL 12]
          Length = 504

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +R  T+AF+G++  PVEVQ  +S G     IVGLPDKAV E+RER+++     GL   
Sbjct: 1  MTTRAHTVAFEGVEARPVEVQCALSAGIPSFAIVGLPDKAVSEARERVRAAMSALGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 58 --ALPSRRITINLSPADL 73


>gi|331091327|ref|ZP_08340167.1| Mg chelatase [Lachnospiraceae bacterium 2_1_46FAA]
 gi|330404488|gb|EGG84032.1| Mg chelatase [Lachnospiraceae bacterium 2_1_46FAA]
          Length = 502

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 36/78 (46%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S + + A  G++   + V+  VS G     +VG     V E+ ER+++   ++G L  
Sbjct: 1  MYSTVLSAAIHGLEVKCIHVEADVSNGLPLFHMVGYLSSEVKEAGERVRTAIRNSGFL-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     D+
Sbjct: 59 ---LPSKKIVINLSPADV 73


>gi|210622559|ref|ZP_03293241.1| hypothetical protein CLOHIR_01189 [Clostridium hiranonis DSM
          13275]
 gi|210154142|gb|EEA85148.1| hypothetical protein CLOHIR_01189 [Clostridium hiranonis DSM
          13275]
          Length = 518

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MIS I++    GI    ++V+V +  G     IVGL    + E+RER++S   ++G  F 
Sbjct: 1  MISSINSRNIIGIDSCDIKVEVDIGKGMPTFNIVGLASTEIKEARERVKSAITNSGYRF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     D+
Sbjct: 60 ----PNARIVVNLSPADM 73


>gi|163856956|ref|YP_001631254.1| putative chelatase [Bordetella petrii DSM 12804]
 gi|163260684|emb|CAP42986.1| putative chelatase [Bordetella petrii]
          Length = 508

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ +++ A  G     V V+  + PG     +VGLPD  V ESRER+++  + +G     
Sbjct: 3  LAILASRALSGADAPAVRVETHLGPGLPAFTVVGLPDTEVRESRERVRAAILSSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPNGRITVNLSPADL 74


>gi|312897997|ref|ZP_07757406.1| Mg chelatase-like protein [Megasphaera micronuciformis F0359]
 gi|310620922|gb|EFQ04473.1| Mg chelatase-like protein [Megasphaera micronuciformis F0359]
          Length = 505

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M SRI      G+ G  + V+  ++ G     IVGL   AV E++ER+++   ++GL F 
Sbjct: 1  MFSRIYGAVLFGLNGCLITVETDIANGLPSFDIVGLATVAVKEAKERVRTAVKNSGLAF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 60 ----PVRRITVNLAPADM 73


>gi|154482593|ref|ZP_02025041.1| hypothetical protein EUBVEN_00260 [Eubacterium ventriosum ATCC
          27560]
 gi|149736618|gb|EDM52504.1| hypothetical protein EUBVEN_00260 [Eubacterium ventriosum ATCC
          27560]
          Length = 499

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +I   A  GI   PV V+  V  G     +VGL    + ESRER+++   ++G +  
Sbjct: 1  MVCKIKCAAITGIDTQPVIVETDVCNGLPSFDMVGLLASNIKESRERVRTAIKNSGFM-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + + +   ++
Sbjct: 59 ---IPPKRITINFSPANI 73


>gi|284053280|ref|ZP_06383490.1| competence protein [Arthrospira platensis str. Paraca]
 gi|291566001|dbj|BAI88273.1| competence protein ComM homolog [Arthrospira platensis NIES-39]
          Length = 508

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + +  GI  + V V+V +S G   + ++GLPD AV ESRER+++   +AG  F 
Sbjct: 1  MLARVWSASVVGIDAVKVGVEVDLSGGLPKIIVLGLPDTAVQESRERVKATLKNAGYSF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PMGNIVINLTPADL 73


>gi|270159106|ref|ZP_06187762.1| Mg chelatase-like protein [Legionella longbeachae D-4968]
 gi|289166059|ref|YP_003456197.1| bifunctional enzyme and transcriptional regulator [Legionella
          longbeachae NSW150]
 gi|269987445|gb|EEZ93700.1| Mg chelatase-like protein [Legionella longbeachae D-4968]
 gi|288859232|emb|CBJ13166.1| putative bifunctional enzyme and transcriptional regulator
          [Legionella longbeachae NSW150]
          Length = 502

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++     +  G+   PV V+V +S G  G  IVGL + AV ES++R++S  +++      
Sbjct: 3  LAFTKARSTIGMLAHPVSVEVHLSNGLPGFTIVGLAETAVKESKDRVRSAIVNSQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPCRKITVNLGPADL 74


>gi|307243656|ref|ZP_07525797.1| Mg chelatase-like protein [Peptostreptococcus stomatis DSM 17678]
 gi|306492966|gb|EFM64978.1| Mg chelatase-like protein [Peptostreptococcus stomatis DSM 17678]
          Length = 538

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI++I +    G+ G+ V+++V +S G     +VGL    V ES+ER++S  I++G  F 
Sbjct: 1  MINKIKSGMVMGVDGLIVDIEVDISKGMPYFSVVGLAGTEVKESKERVRSAIINSGYDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   L +     D+
Sbjct: 60 ----PLNRLVINLSPADV 73


>gi|99080293|ref|YP_612447.1| Mg chelatase-related protein [Ruegeria sp. TM1040]
 gi|99036573|gb|ABF63185.1| Mg chelatase-related protein [Ruegeria sp. TM1040]
          Length = 500

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 46/78 (58%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MISR  T+AFQG++  PVEVQ  V+PG     IVGLPDKAV E+R+R++S         +
Sbjct: 1  MISRAQTVAFQGVEACPVEVQCAVAPGLPAFSIVGLPDKAVSEARDRVRSAL-----AVM 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 56 SIALPAKRITINLSPADL 73


>gi|304436553|ref|ZP_07396523.1| competence protein ComM [Selenomonas sp. oral taxon 149 str.
          67H29BP]
 gi|304370423|gb|EFM24078.1| competence protein ComM [Selenomonas sp. oral taxon 149 str.
          67H29BP]
          Length = 148

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M ++       GI G  ++V+V VSPG  G ++VGLPD +V ES+ER+++   ++G    
Sbjct: 1  MFAKTYGATTLGIDGQIIDVEVDVSPGLPGFELVGLPDTSVKESKERVRTAIRNSG---- 56

Query: 61 VNELPSIYLQLIYQKKDL 78
            +L    + +     D+
Sbjct: 57 -IQLRQERVTVNLAPADV 73


>gi|116250107|ref|YP_765945.1| Mg2+ chelatase family protein [Rhizobium leguminosarum bv. viciae
          3841]
 gi|115254755|emb|CAK05829.1| putative Mg2+ chelatase family protein [Rhizobium leguminosarum
          bv. viciae 3841]
          Length = 510

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 59/78 (75%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ST+AFQGI+G+PVEVQVMV+PG+VG+QIVGLPDKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVSTVAFQGIEGVPVEVQVMVAPGKVGMQIVGLPDKAVAESRERVQAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPAKRVTVNLAPADL 73


>gi|15964092|ref|NP_384445.1| hypothetical protein SMc00420 [Sinorhizobium meliloti 1021]
 gi|307301236|ref|ZP_07580998.1| Mg chelatase, subunit ChlI [Sinorhizobium meliloti BL225C]
 gi|15073268|emb|CAC41776.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306903692|gb|EFN34279.1| Mg chelatase, subunit ChlI [Sinorhizobium meliloti BL225C]
          Length = 510

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 59/78 (75%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ST+AFQGI+G+PV+VQVMV+PG+VG+QIVGLPDKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVSTVAFQGIEGVPVDVQVMVAPGKVGMQIVGLPDKAVAESRERVQAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPAKRVTVNLAPADL 73


>gi|326315104|ref|YP_004232776.1| Mg chelatase subunit ChlI [Acidovorax avenae subsp. avenae ATCC
          19860]
 gi|323371940|gb|ADX44209.1| Mg chelatase, subunit ChlI [Acidovorax avenae subsp. avenae ATCC
          19860]
          Length = 517

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 4/77 (5%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+V ++ G     +VGL D  V E+RER++S   +AGL F  
Sbjct: 3  LALVQSRALLGLQAAAVTVEVHLANGLPSFTLVGLADVEVKEARERVRSALQNAGLEFPH 62

Query: 62 NELPSIYLQLIYQKKDL 78
          N      + +     DL
Sbjct: 63 N----KKITVNLAPADL 75


>gi|323484745|ref|ZP_08090104.1| Mg chelatase [Clostridium symbiosum WAL-14163]
 gi|323691813|ref|ZP_08106070.1| hypothetical protein HMPREF9475_00932 [Clostridium symbiosum
          WAL-14673]
 gi|323401982|gb|EGA94321.1| Mg chelatase [Clostridium symbiosum WAL-14163]
 gi|323504179|gb|EGB19984.1| hypothetical protein HMPREF9475_00932 [Clostridium symbiosum
          WAL-14673]
          Length = 513

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S+I++    G++G PV V+  VS G  G  +VG   +AV E++ER+++   +AG+   
Sbjct: 1  MFSKINSFGVHGVEGFPVTVEADVSDGLPGFIMVGFLSEAVREAQERVRTALKNAGIH-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     D+
Sbjct: 59 ---LPPKKVMVNLSPGDI 73


>gi|51892614|ref|YP_075305.1| hypothetical protein STH1476 [Symbiobacterium thermophilum IAM
          14863]
 gi|51856303|dbj|BAD40461.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM
          14863]
          Length = 510

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 40/75 (53%), Gaps = 5/75 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
            R+ +   QGI+ +PV V+V VSPG    +IVGLPD AV E+RER+++   + G  F  
Sbjct: 5  FVRVWSFTLQGIEALPVAVEVDVSPGLPSFEIVGLPDAAVREARERVRAAVRNGGWPF-- 62

Query: 62 NELPSIYLQLIYQKK 76
             P   + +     
Sbjct: 63 ---PLQRITVNLAPA 74


>gi|120608935|ref|YP_968613.1| Mg chelatase subunit ChlI [Acidovorax citrulli AAC00-1]
 gi|120587399|gb|ABM30839.1| Mg chelatase, subunit ChlI [Acidovorax citrulli AAC00-1]
          Length = 517

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 4/77 (5%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+V ++ G     +VGL D  V E+RER++S   +AGL F  
Sbjct: 3  LALVQSRALLGLQAAAVTVEVHLANGLPSFTLVGLADVEVKEARERVRSALQNAGLEFPH 62

Query: 62 NELPSIYLQLIYQKKDL 78
          N      + +     DL
Sbjct: 63 N----KKITVNLAPADL 75


>gi|307317907|ref|ZP_07597344.1| Mg chelatase, subunit ChlI [Sinorhizobium meliloti AK83]
 gi|306896309|gb|EFN27058.1| Mg chelatase, subunit ChlI [Sinorhizobium meliloti AK83]
          Length = 510

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 59/78 (75%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ST+AFQGI+G+PV+VQVMV+PG+VG+QIVGLPDKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVSTVAFQGIEGVPVDVQVMVAPGKVGMQIVGLPDKAVAESRERVQAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPAKRVTVNLAPADL 73


>gi|146329759|ref|YP_001209129.1| Mg chelatase family protein [Dichelobacter nodosus VCS1703A]
 gi|146233229|gb|ABQ14207.1| Mg chelatase family protein [Dichelobacter nodosus VCS1703A]
          Length = 495

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A   +K   V V++ +S G   + +VGLP+KAV ES++R+++  I++G  F  
Sbjct: 3  LATVYSRAPLAMKAPLVRVEIDLSAGLPAMTLVGLPEKAVKESKDRVRAAIINSGFSF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PQKRITINLAPADL 74


>gi|161620044|ref|YP_001593931.1| Mg chelatase-like protein [Brucella canis ATCC 23365]
 gi|161336855|gb|ABX63160.1| Mg chelatase-like protein [Brucella canis ATCC 23365]
          Length = 521

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 55/78 (70%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AF GI+ +PV+VQVM++PG++G+ IVGLPDKAV ESRER+Q+    +GL   
Sbjct: 12 MVARVGTVAFHGIEAVPVDVQVMIAPGKMGMSIVGLPDKAVAESRERVQAALHASGL--- 68

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 69 --SMPAKRVTVNLAPADL 84


>gi|260589067|ref|ZP_05854980.1| Mg chelatase-like protein [Blautia hansenii DSM 20583]
 gi|331082497|ref|ZP_08331622.1| Mg chelatase [Lachnospiraceae bacterium 6_1_63FAA]
 gi|260540487|gb|EEX21056.1| Mg chelatase-like protein [Blautia hansenii DSM 20583]
 gi|330400475|gb|EGG80105.1| Mg chelatase [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 507

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  ++ +    G+  IP++V+  V  G  G  +VG     V E+++R+ +   ++G  F 
Sbjct: 1  MFRKVMSATIIGVNCIPIQVEADVRNGLPGFSMVGYLSSRVREAQDRVCTALRNSGFSF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+ ++ +     D+
Sbjct: 60 ----PAKHITVNLSPADV 73


>gi|268317079|ref|YP_003290798.1| Mg chelatase, subunit ChlI [Rhodothermus marinus DSM 4252]
 gi|262334613|gb|ACY48410.1| Mg chelatase, subunit ChlI [Rhodothermus marinus DSM 4252]
          Length = 513

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+SR+ +    GI+ IPVE++  +  G     +VGLPD AV ESR+RI +   ++GL   
Sbjct: 1  MLSRVWSSTTLGIEAIPVEIETHIESGMPRYTVVGLPDGAVRESRDRIWAALRNSGLP-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 59 ---LPRGAITVNLAPADL 73


>gi|163844148|ref|YP_001628553.1| Mg chelatase-related protein [Brucella suis ATCC 23445]
 gi|163674871|gb|ABY38982.1| Mg chelatase-related protein [Brucella suis ATCC 23445]
          Length = 521

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 55/78 (70%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AF GI+ +PV+VQVM++PG++G+ IVGLPDKAV ESRER+Q+    +GL   
Sbjct: 12 MVARVGTVAFHGIEAVPVDVQVMIAPGKMGMSIVGLPDKAVAESRERVQAALHASGL--- 68

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 69 --SMPAKRVTVNLAPADL 84


>gi|332289411|ref|YP_004420263.1| putative ATP-dependent protease [Gallibacterium anatis UMN179]
 gi|330432307|gb|AEC17366.1| putative ATP-dependent protease [Gallibacterium anatis UMN179]
          Length = 512

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   + ++V +S G  G+ +VGLP+  V E+R+R++S  I+A  ++  
Sbjct: 3  LAVVYSRASIGVQAPLITIEVHMSNGAPGLTLVGLPETTVKEARDRVRSALINANFVY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PTQRITINLAPADL 74


>gi|91776860|ref|YP_546616.1| Mg chelatase-related protein [Methylobacillus flagellatus KT]
 gi|91710847|gb|ABE50775.1| Mg chelatase-related protein [Methylobacillus flagellatus KT]
          Length = 496

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+V ++ G     IVGLP+  V ES++R+++    A      
Sbjct: 3  LAVLHSRALAGMEAPAVAVEVHLANGLPSFTIVGLPEAEVKESKDRVRAALQTAQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITVNLAPADL 74


>gi|306843552|ref|ZP_07476153.1| Mg chelatase-related protein [Brucella sp. BO1]
 gi|306276243|gb|EFM57943.1| Mg chelatase-related protein [Brucella sp. BO1]
          Length = 521

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 55/78 (70%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AF GI+ +PV+VQVM++PG++G+ IVGLPDKAV ESRER+Q+    +GL   
Sbjct: 12 MVARVGTVAFHGIEAVPVDVQVMIAPGKMGMSIVGLPDKAVAESRERVQAALHASGL--- 68

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 69 --SMPAKRVTVNLAPADL 84


>gi|119900025|ref|YP_935238.1| hypothetical protein azo3736 [Azoarcus sp. BH72]
 gi|119672438|emb|CAL96352.1| conserved hypothetical protein [Azoarcus sp. BH72]
          Length = 499

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ +   A  G+    V V+V ++ G     +VGLPD  V E+R+R+++  + +      
Sbjct: 3  LAIVRARALDGLAAPEVTVEVHLANGLPAFNLVGLPDTEVREARDRVRAALVTSQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPQRRITVNLAPADL 74


>gi|84686313|ref|ZP_01014208.1| competence protein ComM [Maritimibacter alkaliphilus HTCC2654]
 gi|84665840|gb|EAQ12315.1| competence protein ComM [Rhodobacterales bacterium HTCC2654]
          Length = 504

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R  T+AF+G++   VEVQ  +SPG     IVGLPDKAV E+R+R+++         +
Sbjct: 1  MVARAYTVAFEGVEARTVEVQCALSPGVPAFSIVGLPDKAVSEARDRVRAALSA-----M 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 56 AIALPARKITVNLSPADL 73


>gi|159184251|ref|NP_353342.2| hypothetical protein Atu0311 [Agrobacterium tumefaciens str. C58]
 gi|159139578|gb|AAK86127.2| conserved hypothetical protein [Agrobacterium tumefaciens str.
          C58]
          Length = 510

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 42/78 (53%), Positives = 59/78 (75%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R++T+AFQGI+G+PVEVQVMV+PG++G+QIVGLPDKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVNTVAFQGIEGVPVEVQVMVAPGKIGIQIVGLPDKAVAESRERVQAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPAKKVTVNLAPADL 73


>gi|284045126|ref|YP_003395466.1| Mg chelatase, subunit ChlI [Conexibacter woesei DSM 14684]
 gi|283949347|gb|ADB52091.1| Mg chelatase, subunit ChlI [Conexibacter woesei DSM 14684]
          Length = 507

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+SR++T A  GI   PV V+V + PG    ++VG+  KAV E+RER+++  +++G    
Sbjct: 1  MLSRVATFAIDGIDPRPVWVEVDIRPGLPTFRVVGMAGKAVREARERVRAAVLNSGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P+  +        L
Sbjct: 58 --EFPARRITANLAPASL 73


>gi|304436347|ref|ZP_07396323.1| Mg chelatase-like protein [Selenomonas sp. oral taxon 149 str.
          67H29BP]
 gi|304370616|gb|EFM24265.1| Mg chelatase-like protein [Selenomonas sp. oral taxon 149 str.
          67H29BP]
          Length = 377

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           ++       GI G  ++V+V VSPG  G ++VGLPD +V ES+ER+++   ++G     
Sbjct: 17 FAKTYGATTLGIDGRIIDVEVDVSPGLPGFELVGLPDTSVKESKERVRTAIRNSG----- 71

Query: 62 NELPSIYLQLIYQKKDL 78
           +L    + +     D+
Sbjct: 72 IQLRQERVTVNLAPADV 88


>gi|261324072|ref|ZP_05963269.1| Mg chelatase [Brucella neotomae 5K33]
 gi|261300052|gb|EEY03549.1| Mg chelatase [Brucella neotomae 5K33]
          Length = 518

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 55/78 (70%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AF GI+ +PV+VQVM++PG++G+ IVGLPDKAV ESRER+Q+    +GL   
Sbjct: 9  MVARVGTVAFHGIEAVPVDVQVMIAPGKMGMSIVGLPDKAVAESRERVQAALHASGL--- 65

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 66 --SMPAKRVTVNLAPADL 81


>gi|256112459|ref|ZP_05453380.1| Mg chelatase-related protein [Brucella melitensis bv. 3 str.
          Ether]
 gi|265993893|ref|ZP_06106450.1| Mg chelatase [Brucella melitensis bv. 3 str. Ether]
 gi|262764874|gb|EEZ10795.1| Mg chelatase [Brucella melitensis bv. 3 str. Ether]
          Length = 510

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 55/78 (70%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AF GI+ +PV+VQVM++PG++G+ IVGLPDKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVGTVAFHGIEAVPVDVQVMIAPGKMGMSIVGLPDKAVAESRERVQAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 58 --SMPAKRVTVNLAPADL 73


>gi|23502980|ref|NP_699107.1| Mg chelatase-like protein [Brucella suis 1330]
 gi|23349018|gb|AAN31022.1| Mg chelatase-related protein [Brucella suis 1330]
          Length = 510

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 55/78 (70%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AF GI+ +PV+VQVM++PG++G+ IVGLPDKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVGTVAFHGIEAVPVDVQVMIAPGKMGMSIVGLPDKAVAESRERVQAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 58 --SMPAKRVTVNLAPADL 73


>gi|87120782|ref|ZP_01076675.1| Mg chelatase-related protein [Marinomonas sp. MED121]
 gi|86164010|gb|EAQ65282.1| Mg chelatase-related protein [Marinomonas sp. MED121]
          Length = 289

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++R+ + A  G+    V V+  +S G   + IVGLP+ AV E+++R++S  + +      
Sbjct: 3  LARVYSRARVGVDAPLVMVETHISNGLPALNIVGLPEAAVREAKDRVRSAIMMSQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPTRRITINLAPADL 74


>gi|260567396|ref|ZP_05837866.1| Mg chelatase [Brucella suis bv. 4 str. 40]
 gi|260156914|gb|EEW91994.1| Mg chelatase [Brucella suis bv. 4 str. 40]
          Length = 510

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 55/78 (70%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AF GI+ +PV+VQVM++PG++G+ IVGLPDKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVGTVAFHGIEAVPVDVQVMIAPGKMGMSIVGLPDKAVAESRERVQAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 58 --SMPAKRVTVNLAPADL 73


>gi|256060097|ref|ZP_05450279.1| Mg chelatase-related protein [Brucella neotomae 5K33]
          Length = 510

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 55/78 (70%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AF GI+ +PV+VQVM++PG++G+ IVGLPDKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVGTVAFHGIEAVPVDVQVMIAPGKMGMSIVGLPDKAVAESRERVQAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 58 --SMPAKRVTVNLAPADL 73


>gi|225853560|ref|YP_002733793.1| Mg chelatase-related protein [Brucella melitensis ATCC 23457]
 gi|225641925|gb|ACO01839.1| Mg chelatase-related protein [Brucella melitensis ATCC 23457]
          Length = 518

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 55/78 (70%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AF GI+ +PV+VQVM++PG++G+ IVGLPDKAV ESRER+Q+    +GL   
Sbjct: 9  MVARVGTVAFHGIEAVPVDVQVMIAPGKMGMSIVGLPDKAVAESRERVQAALHASGL--- 65

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 66 --SMPAKRVTVNLAPADL 81


>gi|225626503|ref|ZP_03784542.1| Mg chelatase-related protein [Brucella ceti str. Cudo]
 gi|225618160|gb|EEH15203.1| Mg chelatase-related protein [Brucella ceti str. Cudo]
          Length = 521

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 55/78 (70%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AF GI+ +PV+VQVM++PG++G+ IVGLPDKAV ESRER+Q+    +GL   
Sbjct: 12 MVARVGTVAFHGIEAVPVDVQVMIAPGKMGMSIVGLPDKAVAESRERVQAALHASGL--- 68

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 69 --SMPAKRVTVNLAPADL 84


>gi|83594918|ref|YP_428670.1| Mg chelatase-like protein [Rhodospirillum rubrum ATCC 11170]
 gi|83577832|gb|ABC24383.1| Mg chelatase-related protein [Rhodospirillum rubrum ATCC 11170]
          Length = 506

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +R+ T+AFQGI  + +EVQV ++ G     +VGLPDKAV ESRER++S     GL   
Sbjct: 1  MGARVHTVAFQGIDTLAIEVQVSITGGLPAFTVVGLPDKAVGESRERVRSALAAIGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     D+
Sbjct: 58 --SLPPNRITVNLAPADV 73


>gi|256254042|ref|ZP_05459578.1| Mg chelatase-related protein [Brucella ceti B1/94]
 gi|261221181|ref|ZP_05935462.1| Mg chelatase [Brucella ceti B1/94]
 gi|260919765|gb|EEX86418.1| Mg chelatase [Brucella ceti B1/94]
          Length = 510

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 55/78 (70%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AF GI+ +PV+VQVM++PG++G+ IVGLPDKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVGTVAFHGIEAVPVDVQVMIAPGKMGMSIVGLPDKAVAESRERVQAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 58 --SMPAKRVTVNLAPADL 73


>gi|88810938|ref|ZP_01126194.1| Mg chelatase-related protein [Nitrococcus mobilis Nb-231]
 gi|88791477|gb|EAR22588.1| Mg chelatase-related protein [Nitrococcus mobilis Nb-231]
          Length = 500

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++     A  G++   V V+V ++ G   + +VGLP+ AV E+++R++S  +++G     
Sbjct: 3  VAIAYGRAAVGVQAPSVAVEVHLTNGLPSLSVVGLPETAVKEAKDRVRSAILNSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPTRRITVNLAPADL 74


>gi|148559506|ref|YP_001259931.1| Mg chelatase-like protein [Brucella ovis ATCC 25840]
 gi|254700765|ref|ZP_05162593.1| Mg chelatase-related protein [Brucella suis bv. 5 str. 513]
 gi|254705136|ref|ZP_05166964.1| Mg chelatase-related protein [Brucella suis bv. 3 str. 686]
 gi|254709110|ref|ZP_05170921.1| Mg chelatase-related protein [Brucella pinnipedialis B2/94]
 gi|254713464|ref|ZP_05175275.1| Mg chelatase-related protein [Brucella ceti M644/93/1]
 gi|254716180|ref|ZP_05177991.1| Mg chelatase-related protein [Brucella ceti M13/05/1]
 gi|256030636|ref|ZP_05444250.1| Mg chelatase-related protein [Brucella pinnipedialis M292/94/1]
 gi|256262955|ref|ZP_05465487.1| Mg chelatase [Brucella melitensis bv. 2 str. 63/9]
 gi|261217952|ref|ZP_05932233.1| Mg chelatase [Brucella ceti M13/05/1]
 gi|261316609|ref|ZP_05955806.1| Mg chelatase [Brucella pinnipedialis B2/94]
 gi|261321198|ref|ZP_05960395.1| Mg chelatase [Brucella ceti M644/93/1]
 gi|261751273|ref|ZP_05994982.1| Mg chelatase [Brucella suis bv. 5 str. 513]
 gi|261755838|ref|ZP_05999547.1| Mg chelatase [Brucella suis bv. 3 str. 686]
 gi|265987681|ref|ZP_06100238.1| Mg chelatase [Brucella pinnipedialis M292/94/1]
 gi|148370763|gb|ABQ60742.1| Mg chelatase-related protein [Brucella ovis ATCC 25840]
 gi|260923041|gb|EEX89609.1| Mg chelatase [Brucella ceti M13/05/1]
 gi|261293888|gb|EEX97384.1| Mg chelatase [Brucella ceti M644/93/1]
 gi|261295832|gb|EEX99328.1| Mg chelatase [Brucella pinnipedialis B2/94]
 gi|261741026|gb|EEY28952.1| Mg chelatase [Brucella suis bv. 5 str. 513]
 gi|261745591|gb|EEY33517.1| Mg chelatase [Brucella suis bv. 3 str. 686]
 gi|263092830|gb|EEZ17005.1| Mg chelatase [Brucella melitensis bv. 2 str. 63/9]
 gi|264659878|gb|EEZ30139.1| Mg chelatase [Brucella pinnipedialis M292/94/1]
 gi|326410132|gb|ADZ67197.1| Mg chelatase-related protein [Brucella melitensis M28]
 gi|326539852|gb|ADZ88067.1| Mg chelatase-related protein [Brucella melitensis M5-90]
          Length = 510

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 55/78 (70%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AF GI+ +PV+VQVM++PG++G+ IVGLPDKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVGTVAFHGIEAVPVDVQVMIAPGKMGMSIVGLPDKAVAESRERVQAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 58 --SMPAKRVTVNLAPADL 73


>gi|296126122|ref|YP_003633374.1| Mg chelatase, subunit ChlI [Brachyspira murdochii DSM 12563]
 gi|296017938|gb|ADG71175.1| Mg chelatase, subunit ChlI [Brachyspira murdochii DSM 12563]
          Length = 507

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M ++I + A  GI+GIP+ ++V +S G     +VGLPD+AV E++ER+ +   ++     
Sbjct: 1  MHTKIYSEALYGIEGIPIVIEVNISEGLPKFDVVGLPDQAVNEAKERVIAAINNS----- 55

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 56 DRFFPPKRITINLAPADI 73


>gi|217976851|ref|YP_002360998.1| Mg chelatase, subunit ChlI [Methylocella silvestris BL2]
 gi|217502227|gb|ACK49636.1| Mg chelatase, subunit ChlI [Methylocella silvestris BL2]
          Length = 512

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 48/78 (61%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ R++T+AF+G+   PV+VQV ++ G V   +VGL DKAV ESRER+++    +GL   
Sbjct: 1  MVVRVATVAFEGVDARPVDVQVQIANGNVVFTVVGLGDKAVAESRERVRAALNSSGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPAKRITVNLAPADL 73


>gi|145633155|ref|ZP_01788887.1| GTPase EngB [Haemophilus influenzae 3655]
 gi|144986381|gb|EDJ92960.1| GTPase EngB [Haemophilus influenzae 3655]
          Length = 509

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G  +VGLP+K V E ++R++S  ++A   +  
Sbjct: 3  LAIVYSRASMGVQAPLVTIEVHLSNGKPGFTLVGLPEKTVKEVQDRVRSALMNAQFKY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|188581068|ref|YP_001924513.1| Mg chelatase, subunit ChlI [Methylobacterium populi BJ001]
 gi|179344566|gb|ACB79978.1| Mg chelatase, subunit ChlI [Methylobacterium populi BJ001]
          Length = 512

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 50/78 (64%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R++T+AF+GI+   V+VQV ++ G V   IVGLPDKAV ESRER++S  I +GL   
Sbjct: 1  MVTRVATVAFEGIEARAVDVQVQIAAGAVAFTIVGLPDKAVAESRERVRSALIASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  +       DL
Sbjct: 58 --ALPAKRITCNLAPADL 73


>gi|52840827|ref|YP_094626.1| competence related protein ComM [Legionella pneumophila subsp.
          pneumophila str. Philadelphia 1]
 gi|52627938|gb|AAU26679.1| competence related protein ComM [Legionella pneumophila subsp.
          pneumophila str. Philadelphia 1]
          Length = 503

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++   T +  GI   PV V+V +S G  G  +VGL + AV ES++R++S  I++      
Sbjct: 3  LAFTKTRSTIGIVAQPVSVEVHLSNGLPGFTMVGLAETAVKESKDRVRSAIINSQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     +L
Sbjct: 59 -EFPCRKITVNLGPANL 74


>gi|332141665|ref|YP_004427403.1| Mg chelatase, subunit ChlI [Alteromonas macleodii str. 'Deep
          ecotype']
 gi|327551687|gb|AEA98405.1| Mg chelatase, subunit ChlI [Alteromonas macleodii str. 'Deep
          ecotype']
          Length = 502

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 41/76 (53%), Gaps = 5/76 (6%)

Query: 3  SRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVN 62
          + + T A QG+    V V++ ++ G    Q+VG+ + +V E+RER++S  I++G      
Sbjct: 2  AVVKTFAGQGVTAPEVSVEIHLANGLPAFQLVGMAETSVKEARERVRSALINSGF----- 56

Query: 63 ELPSIYLQLIYQKKDL 78
          E P+  + +     D+
Sbjct: 57 EFPAKRITVNLAPADI 72


>gi|309389201|gb|ADO77081.1| Mg chelatase, subunit ChlI [Halanaerobium praevalens DSM 2228]
          Length = 507

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S + +    G+K   V+V+V +S G    +IVGL  K V ES +R++S  I++G    
Sbjct: 1  MYSYVYSAVIHGVKAKMVKVEVDISRGLPCFKIVGLAGKTVQESAKRVRSALINSGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     +L
Sbjct: 58 --EWPVKKITINLAPGNL 73


>gi|158522745|ref|YP_001530615.1| Mg chelatase, subunit ChlI [Desulfococcus oleovorans Hxd3]
 gi|158511571|gb|ABW68538.1| Mg chelatase, subunit ChlI [Desulfococcus oleovorans Hxd3]
          Length = 510

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 40/76 (52%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + A  GI    VEV+V ++ G      VGL + +V ESR+R+++  +++G  F 
Sbjct: 1  MLTRVFSSAVTGIDAGIVEVEVNIARGLPYFTTVGLAEVSVKESRDRVKAAMVNSGFSF- 59

Query: 61 VNELPSIYLQLIYQKK 76
              P  ++ +     
Sbjct: 60 ----PYDHITVNLAPA 71


>gi|126724984|ref|ZP_01740827.1| competence protein ComM [Rhodobacterales bacterium HTCC2150]
 gi|126706148|gb|EBA05238.1| competence protein ComM [Rhodobacterales bacterium HTCC2150]
          Length = 513

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R  T+AF+G+    VEVQ  V+ G     +VGLPDKAV E+RER+++         +
Sbjct: 1  MVARTFTVAFEGVDARLVEVQCAVTAGMPAFSVVGLPDKAVSEARERVRAALTA-----M 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 56 AIALPSKRVTINMSPADL 73


>gi|260169540|ref|ZP_05756351.1| Mg chelatase-related protein [Brucella sp. F5/99]
 gi|261759066|ref|ZP_06002775.1| Mg chelatase [Brucella sp. F5/99]
 gi|261739050|gb|EEY27046.1| Mg chelatase [Brucella sp. F5/99]
          Length = 510

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 55/78 (70%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AF GI+ +PV+VQVM++PG++G+ IVGLPDKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVGTVAFHGIEAVPVDVQVMIAPGKMGMSIVGLPDKAVAESRERVQAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 58 --SMPAKRVTVNLAPADL 73


>gi|307257842|ref|ZP_07539599.1| Magnesium chelatase family protein [Actinobacillus
          pleuropneumoniae serovar 10 str. D13039]
 gi|306863748|gb|EFM95674.1| Magnesium chelatase family protein [Actinobacillus
          pleuropneumoniae serovar 10 str. D13039]
          Length = 508

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G+ IVGLP+  V E+ +R++S  ++A  ++  
Sbjct: 3  LAIVYSRASIGVEAPLVTIEVHLSNGKPGLTIVGLPETTVKEAGDRVRSALMNANFMY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PPQRITINLAPADL 74


>gi|294851361|ref|ZP_06792034.1| Mg chelatase [Brucella sp. NVSL 07-0026]
 gi|294819950|gb|EFG36949.1| Mg chelatase [Brucella sp. NVSL 07-0026]
          Length = 521

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 55/78 (70%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AF GI+ +PV+VQVM++PG++GV IVGLPDKAV ESRER+Q+    +GL   
Sbjct: 12 MVARVGTVAFHGIEAVPVDVQVMIAPGKMGVSIVGLPDKAVAESRERVQAALHASGL--- 68

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 69 --SMPAKRVTVNLAPADL 84


>gi|307264450|ref|ZP_07546035.1| Magnesium chelatase family protein [Actinobacillus
          pleuropneumoniae serovar 13 str. N273]
 gi|306870147|gb|EFN01906.1| Magnesium chelatase family protein [Actinobacillus
          pleuropneumoniae serovar 13 str. N273]
          Length = 508

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G+ IVGLP+  V E+ +R++S  ++A  ++  
Sbjct: 3  LAIVYSRASIGVEAPLVTIEVHLSNGKPGLTIVGLPETTVKEAGDRVRSALMNANFMY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PPQRITINLAPADL 74


>gi|322513183|ref|ZP_08066313.1| competence protein ComM [Actinobacillus ureae ATCC 25976]
 gi|322121052|gb|EFX92879.1| competence protein ComM [Actinobacillus ureae ATCC 25976]
          Length = 508

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G+ IVGLP+  V E+ +R++S  ++A  ++  
Sbjct: 3  LAIVYSRASIGVEAPLVTIEVHLSNGKPGLTIVGLPETTVKEAGDRVRSALMNANFMY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PPQRITINLAPADL 74


>gi|240948105|ref|ZP_04752515.1| competence protein M [Actinobacillus minor NM305]
 gi|240297585|gb|EER48077.1| competence protein M [Actinobacillus minor NM305]
          Length = 511

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+  + IVGLP+  V E+ +R++S  I+A   +  
Sbjct: 3  LAIVYSRASIGVEAPLVTIEVHISNGQPKLTIVGLPEATVKEAGDRVRSALINANFFY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PPQRITINLAPADL 74


>gi|300813834|ref|ZP_07094139.1| Mg chelatase-like protein [Peptoniphilus sp. oral taxon 836 str.
          F0141]
 gi|300512021|gb|EFK39216.1| Mg chelatase-like protein [Peptoniphilus sp. oral taxon 836 str.
          F0141]
          Length = 506

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M SR+ T    G+ G  V+V+  +S     V +VGLPD A+ ES ER++S   ++   F 
Sbjct: 1  MYSRVKTCTLFGLNGYEVDVETDLSRSLPKVSLVGLPDTAIKESIERVKSAINNSAYDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     +L
Sbjct: 60 ----PNKKITINLAPANL 73


>gi|254450922|ref|ZP_05064359.1| Mg chelatase family protein [Octadecabacter antarcticus 238]
 gi|198265328|gb|EDY89598.1| Mg chelatase family protein [Octadecabacter antarcticus 238]
          Length = 503

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R  T+AF+G+    VEVQ   SPG  G  IVGLPDKAV E+R+R+++         L
Sbjct: 1  MVARAYTVAFEGVDARLVEVQCATSPGMPGFSIVGLPDKAVSEARDRVRASLSA-----L 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 56 SIALPSKRITINLSPADL 73


>gi|165977183|ref|YP_001652776.1| competence protein M [Actinobacillus pleuropneumoniae serovar 3
          str. JL03]
 gi|307251043|ref|ZP_07532967.1| Magnesium chelatase family protein [Actinobacillus
          pleuropneumoniae serovar 4 str. M62]
 gi|307255659|ref|ZP_07537463.1| Magnesium chelatase family protein [Actinobacillus
          pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307260111|ref|ZP_07541821.1| Magnesium chelatase family protein [Actinobacillus
          pleuropneumoniae serovar 11 str. 56153]
 gi|165877284|gb|ABY70332.1| competence protein M [Actinobacillus pleuropneumoniae serovar 3
          str. JL03]
 gi|306856873|gb|EFM89005.1| Magnesium chelatase family protein [Actinobacillus
          pleuropneumoniae serovar 4 str. M62]
 gi|306861336|gb|EFM93326.1| Magnesium chelatase family protein [Actinobacillus
          pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306865757|gb|EFM97635.1| Magnesium chelatase family protein [Actinobacillus
          pleuropneumoniae serovar 11 str. 56153]
          Length = 508

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G+ IVGLP+  V E+ +R++S  ++A  ++  
Sbjct: 3  LAIVYSRASIGVEAPLVTIEVHLSNGKPGLTIVGLPETTVKEAGDRVRSALMNANFMY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PPQRITINLAPADL 74


>gi|110597069|ref|ZP_01385358.1| Mg chelatase-related protein [Chlorobium ferrooxidans DSM 13031]
 gi|110341260|gb|EAT59725.1| Mg chelatase-related protein [Chlorobium ferrooxidans DSM 13031]
          Length = 516

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S ++  A  GI  + V V+  V+ G     +VGLPD A+ ESRERI +   ++G    
Sbjct: 1  MLSTLNAAALIGIDAMQVAVETNVTGGIPSFTVVGLPDNAIRESRERILTAIRNSGFD-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     D+
Sbjct: 59 ---IPPKKITVNLAPADI 73


>gi|46143420|ref|ZP_00135294.2| COG0606: Predicted ATPase with chaperone activity [Actinobacillus
          pleuropneumoniae serovar 1 str. 4074]
 gi|126209211|ref|YP_001054436.1| competence protein comM [Actinobacillus pleuropneumoniae L20]
 gi|126098003|gb|ABN74831.1| Competence protein comM [Actinobacillus pleuropneumoniae serovar
          5b str. L20]
          Length = 508

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G+ IVGLP+  V E+ +R++S  ++A  ++  
Sbjct: 3  LAIVYSRASIGVEAPLVTIEVHLSNGKPGLTIVGLPETTVKEAGDRVRSALMNANFMY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PPQRITINLAPADL 74


>gi|307262240|ref|ZP_07543889.1| Magnesium chelatase family protein [Actinobacillus
          pleuropneumoniae serovar 12 str. 1096]
 gi|306868003|gb|EFM99830.1| Magnesium chelatase family protein [Actinobacillus
          pleuropneumoniae serovar 12 str. 1096]
          Length = 508

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G+ IVGLP+  V E+ +R++S  ++A  ++  
Sbjct: 3  LAIVYSRASIGVEAPLVTIEVHLSNGKPGLTIVGLPETTVKEAGDRVRSALMNANFMY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PPQRITINLAPADL 74


>gi|307246675|ref|ZP_07528745.1| Magnesium chelatase family protein [Actinobacillus
          pleuropneumoniae serovar 1 str. 4074]
 gi|306852375|gb|EFM84610.1| Magnesium chelatase family protein [Actinobacillus
          pleuropneumoniae serovar 1 str. 4074]
          Length = 508

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G+ IVGLP+  V E+ +R++S  ++A  ++  
Sbjct: 3  LAIVYSRASIGVEAPLVTIEVHLSNGKPGLTIVGLPETTVKEAGDRVRSALMNANFMY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PPQRITINLAPADL 74


>gi|282883303|ref|ZP_06291897.1| Mg chelatase-like protein [Peptoniphilus lacrimalis 315-B]
 gi|281296807|gb|EFA89309.1| Mg chelatase-like protein [Peptoniphilus lacrimalis 315-B]
          Length = 506

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M SR+ T    G+ G  V+V+  +S     V +VGLPD A+ ES ER++S   ++   F 
Sbjct: 1  MYSRVKTCTLFGLNGYEVDVETDLSRSLPKVSLVGLPDTAIKESIERVKSAINNSAYDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     +L
Sbjct: 60 ----PNKKITINLAPANL 73


>gi|261492764|ref|ZP_05989312.1| deoxyribose-phosphate aldolase [Mannheimia haemolytica serotype
          A2 str. BOVINE]
 gi|261495622|ref|ZP_05992068.1| deoxyribose-phosphate aldolase [Mannheimia haemolytica serotype
          A2 str. OVINE]
 gi|261308729|gb|EEY09986.1| deoxyribose-phosphate aldolase [Mannheimia haemolytica serotype
          A2 str. OVINE]
 gi|261311617|gb|EEY12772.1| deoxyribose-phosphate aldolase [Mannheimia haemolytica serotype
          A2 str. BOVINE]
          Length = 510

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+  + IVGLP+  V E+ +R++S  ++A  ++  
Sbjct: 3  LAIVYSRASIGVEAPLVTIEVHISNGQPKLTIVGLPEATVKEAGDRVRSALLNANFIY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PPQRITINLAPADL 74


>gi|49473723|ref|YP_031765.1| competence protein comM [Bartonella quintana str. Toulouse]
 gi|49239226|emb|CAF25546.1| Competence protein comM [Bartonella quintana str. Toulouse]
          Length = 510

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 55/78 (70%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI+R++T+AF+G++ IPV+VQVM+S G++G+ IVGLPDKA+ ESRER+Q+     GL   
Sbjct: 1  MIARVTTVAFRGLEAIPVDVQVMISSGKIGMAIVGLPDKAIAESRERVQAALHACGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 58 --SMPNKRVTINLAPADL 73


>gi|86139303|ref|ZP_01057873.1| competence protein ComM [Roseobacter sp. MED193]
 gi|85824147|gb|EAQ44352.1| competence protein ComM [Roseobacter sp. MED193]
          Length = 504

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MISR +T+AF GI+   VEVQ  +  G     IVGLPDKAV E+RER+++         +
Sbjct: 1  MISRANTVAFHGIEARQVEVQCSLVAGLPAFAIVGLPDKAVSEARERVRAA-----FASM 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 56 SIALPAKRITVNLSPADL 73


>gi|325290403|ref|YP_004266584.1| Mg chelatase, subunit ChlI [Syntrophobotulus glycolicus DSM 8271]
 gi|324965804|gb|ADY56583.1| Mg chelatase, subunit ChlI [Syntrophobotulus glycolicus DSM 8271]
          Length = 508

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M + +  IA  G+K   ++V+V +S G   + IVGL   AV E+R+R+++   ++G    
Sbjct: 1  MYAHVRGIALDGLKANIIKVEVDISNGLPSLDIVGLAGMAVKEARDRVRAALKNSGCP-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     D+
Sbjct: 59 ---LPLQRITVNLAPADI 73


>gi|315122602|ref|YP_004063091.1| hypothetical protein CKC_04270 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
 gi|313496004|gb|ADR52603.1| hypothetical protein CKC_04270 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
          Length = 422

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 55/78 (70%), Positives = 59/78 (75%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MISRISTIAFQGIKGIPVEVQVMVSPGRVG+QIVGLPDKAVIESRERIQS     GL   
Sbjct: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGIQIVGLPDKAVIESRERIQSALYSCGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPAKRVTINLAPADL 73


>gi|33597176|ref|NP_884819.1| putative chelatase [Bordetella parapertussis 12822]
 gi|33573603|emb|CAE37887.1| putative chelatase [Bordetella parapertussis]
          Length = 500

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ +++ A  G +   V V+  +  G     IVGLPD  V ESRER+++   ++G  F  
Sbjct: 3  LAVLASRAIAGWQAPAVRVETHLGSGLPAFAIVGLPDVEVRESRERVRAAIQNSGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PPGRITVNLSPADL 74


>gi|303253172|ref|ZP_07339321.1| competence protein comM [Actinobacillus pleuropneumoniae serovar
          2 str. 4226]
 gi|307248816|ref|ZP_07530829.1| Magnesium chelatase family protein [Actinobacillus
          pleuropneumoniae serovar 2 str. S1536]
 gi|302647854|gb|EFL78061.1| competence protein comM [Actinobacillus pleuropneumoniae serovar
          2 str. 4226]
 gi|306854743|gb|EFM86933.1| Magnesium chelatase family protein [Actinobacillus
          pleuropneumoniae serovar 2 str. S1536]
          Length = 508

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G+ IVGLP+  V E+ +R++S  ++A  ++  
Sbjct: 3  LAIVYSRASIGVEAPLVTIEVHLSNGKPGLTIVGLPETTVKEAGDRVRSALMNANFMY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PPQRITINLAPADL 74


>gi|163867347|ref|YP_001608541.1| hypothetical protein Btr_0043 [Bartonella tribocorum CIP 105476]
 gi|161016988|emb|CAK00546.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 510

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 55/78 (70%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI+RI+T+AF+G++ +PV+VQVM+SPG++G+ IVGL DKAV ESRER+Q+     GL   
Sbjct: 1  MIARITTVAFRGLEAVPVDVQVMISPGKIGMAIVGLADKAVAESRERVQAALHACGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 58 --SMPTKRITINLAPADL 73


>gi|89068066|ref|ZP_01155483.1| competence protein ComM [Oceanicola granulosus HTCC2516]
 gi|89046305|gb|EAR52362.1| competence protein ComM [Oceanicola granulosus HTCC2516]
          Length = 504

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++   T+AF+GI+   VEVQ  V+PG  G  IVGLPDKAV E+RER+++         L
Sbjct: 1  MVATAHTVAFEGIEARAVEVQCAVAPGLPGFAIVGLPDKAVSEARERVRAALNA-----L 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 56 TIALPSKRITVNLSPADL 73


>gi|226313172|ref|YP_002773066.1| hypothetical protein BBR47_35850 [Brevibacillus brevis NBRC
          100599]
 gi|226096120|dbj|BAH44562.1| truncated hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 357

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 35/77 (45%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +   +    GI G+ V V+  ++ G     +VGL   AV E+R+R+++   +AG  + 
Sbjct: 1  MYACSYSGTVLGIDGMVVTVETDIANGLPQFDLVGLGGSAVKEARDRVRAALRNAGYDY- 59

Query: 61 VNELPSIYLQLIYQKKD 77
              P   + +     D
Sbjct: 60 ----PMQRITVNLAPAD 72


>gi|85374958|ref|YP_459020.1| ATPase [Erythrobacter litoralis HTCC2594]
 gi|84788041|gb|ABC64223.1| predicted ATPase [Erythrobacter litoralis HTCC2594]
          Length = 335

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ + T+A+ G++   VEVQ  ++PG     IVGL DKAV ES+ER+++     GL   
Sbjct: 1  MVALVRTVAYLGLEARAVEVQCSIAPGLPNFNIVGLADKAVGESKERVRASLSSMGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 58 --ALPPKRITINLSPADL 73


>gi|33601020|ref|NP_888580.1| putative chelatase [Bordetella bronchiseptica RB50]
 gi|33575455|emb|CAE32533.1| putative chelatase [Bordetella bronchiseptica RB50]
          Length = 500

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ +++ A  G +   V V+  +  G     IVGLPD  V ESRER+++   ++G  F  
Sbjct: 3  LAVLASRAIAGWQAPAVRVETHLGSGLPAFAIVGLPDVEVRESRERVRAAIQNSGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PPGRITVNLSPADL 74


>gi|255021628|ref|ZP_05293671.1| Mg(2+) chelatase family protein / ComM-like protein
          [Acidithiobacillus caldus ATCC 51756]
 gi|254969016|gb|EET26535.1| Mg(2+) chelatase family protein / ComM-like protein
          [Acidithiobacillus caldus ATCC 51756]
          Length = 506

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  GI+G  V V+  + PG     +VGL + AV E+R+R++S   ++GL F  
Sbjct: 3  LAIVQSRAVAGIQGAEVVVECDLGPGLPTFAVVGLAETAVKEARDRVRSAIQNSGLDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PARRIVVNLAPADL 74


>gi|251797457|ref|YP_003012188.1| Mg chelatase, subunit ChlI [Paenibacillus sp. JDR-2]
 gi|247545083|gb|ACT02102.1| Mg chelatase, subunit ChlI [Paenibacillus sp. JDR-2]
          Length = 519

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S + + +  G++G  + V+V ++ G   V +VGLPD AV ES ER+++   ++G  F 
Sbjct: 1  MFSLMHSSSVLGVEGKGISVEVDIASGLPQVSVVGLPDPAVRESVERVRAAIKNSGFAF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PLERITVNLAPADL 73


>gi|33593697|ref|NP_881341.1| putative chelatase (pseudogene) [Bordetella pertussis Tohama I]
 gi|33563770|emb|CAE43011.1| putative chelatase (Pseudogene) [Bordetella pertussis Tohama I]
          Length = 500

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ +++ A  G +   V V+  +  G     IVGLPD  V ESRER+++   ++G  F  
Sbjct: 3  LAVLASRAIAGWQAPAVRVETHLGSGLPAFAIVGLPDVEVRESRERVRAAIQNSGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PPGRITVNLSPADL 74


>gi|258545195|ref|ZP_05705429.1| competence protein ComM [Cardiobacterium hominis ATCC 15826]
 gi|258519547|gb|EEV88406.1| competence protein ComM [Cardiobacterium hominis ATCC 15826]
          Length = 498

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++   T A   +    V V+V ++ G   + +VGLP+KAV ES++R+++  +++G     
Sbjct: 3  LATTYTRAPLSMHAPLVRVEVHLASGLPAMTLVGLPEKAVKESKDRVRAAILNSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+ ++ +     +L
Sbjct: 59 -EFPAKHITINLAPAEL 74


>gi|54293572|ref|YP_125987.1| hypothetical protein lpl0624 [Legionella pneumophila str. Lens]
 gi|53753404|emb|CAH14857.1| hypothetical protein lpl0624 [Legionella pneumophila str. Lens]
          Length = 503

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++   T +  GI   PV V+V +S G     +VGL + AV ES++R++S  I++      
Sbjct: 3  LAFTKTRSTIGIVAQPVSVEVHLSNGLPSFTMVGLAETAVKESKDRVRSAIINSQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     +L
Sbjct: 59 -EFPCRKITVNLGPANL 74


>gi|319760998|ref|YP_004124935.1| mg chelatase, subunit chli [Alicycliphilus denitrificans BC]
 gi|317115559|gb|ADU98047.1| Mg chelatase, subunit ChlI [Alicycliphilus denitrificans BC]
          Length = 511

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 4/77 (5%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+V ++ G     +VGL D  V E+RER++S   +AGL F  
Sbjct: 3  LALVQSRALLGLQASAVTVEVHLANGLPSFALVGLADVEVKEARERVRSALQNAGLEFPT 62

Query: 62 NELPSIYLQLIYQKKDL 78
          N      + +     DL
Sbjct: 63 N----KKITVNLAPADL 75


>gi|114319246|ref|YP_740929.1| Mg chelatase, subunit ChlI [Alkalilimnicola ehrlichii MLHE-1]
 gi|114225640|gb|ABI55439.1| Mg chelatase, subunit ChlI [Alkalilimnicola ehrlichii MLHE-1]
          Length = 505

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  G+    V V+V + PG   + IVGLP+ AV E+RER++S    AG     
Sbjct: 3  LAVVHTRASLGLAAPEVTVEVHIGPGLPALAIVGLPETAVREARERVRSALTMAGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPAGRITVNLAPADL 74


>gi|330822860|ref|YP_004386163.1| Mg chelatase subunit ChlI [Alicycliphilus denitrificans K601]
 gi|329308232|gb|AEB82647.1| Mg chelatase, subunit ChlI [Alicycliphilus denitrificans K601]
          Length = 511

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 4/77 (5%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+V ++ G     +VGL D  V E+RER++S   +AGL F  
Sbjct: 3  LALVQSRALLGLQASAVTVEVHLANGLPSFALVGLADVEVKEARERVRSALQNAGLEFPT 62

Query: 62 NELPSIYLQLIYQKKDL 78
          N      + +     DL
Sbjct: 63 N----KKITVNLAPADL 75


>gi|148360762|ref|YP_001251969.1| competence related protein ComM [Legionella pneumophila str.
          Corby]
 gi|296106172|ref|YP_003617872.1| ComM, competence-like protein [Legionella pneumophila 2300/99
          Alcoy]
 gi|148282535|gb|ABQ56623.1| competence related protein ComM [Legionella pneumophila str.
          Corby]
 gi|295648073|gb|ADG23920.1| ComM, competence-like protein [Legionella pneumophila 2300/99
          Alcoy]
          Length = 503

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++   T +  GI   PV V+V +S G     +VGL + AV ES++R++S  I++      
Sbjct: 3  LAFTKTRSTIGIVAQPVSVEVHLSNGLPSFTMVGLAETAVKESKDRVRSAIINSQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     +L
Sbjct: 59 -EFPCRKITVNLGPANL 74


>gi|54296609|ref|YP_122978.1| hypothetical protein lpp0640 [Legionella pneumophila str. Paris]
 gi|53750394|emb|CAH11788.1| hypothetical protein lpp0640 [Legionella pneumophila str. Paris]
          Length = 503

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++   T +  GI   PV V+V +S G     +VGL + AV ES++R++S  I++      
Sbjct: 3  LAFTKTRSTIGIVAQPVSVEVHLSNGLPSFTMVGLAETAVKESKDRVRSAIINSQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     +L
Sbjct: 59 -EFPCRKITVNLGPANL 74


>gi|153008118|ref|YP_001369333.1| Mg chelatase subunit ChlI [Ochrobactrum anthropi ATCC 49188]
 gi|151560006|gb|ABS13504.1| Mg chelatase, subunit ChlI [Ochrobactrum anthropi ATCC 49188]
          Length = 510

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 38/78 (48%), Positives = 56/78 (71%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AFQGI+ +PV+VQVMV+PG++G+ IVGLPDKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVGTVAFQGIEAVPVDVQVMVAPGKMGMSIVGLPDKAVAESRERVQAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 58 --SMPTKRVTVNLAPADL 73


>gi|240138444|ref|YP_002962916.1| island insertion determinant, chelatase family [Methylobacterium
          extorquens AM1]
 gi|240008413|gb|ACS39639.1| island insertion determinant, chelatase family [Methylobacterium
          extorquens AM1]
          Length = 512

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 50/78 (64%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R++T+AF+GI+   V+VQV ++ G V   IVGL DKAV ESRER++S  I +GL   
Sbjct: 1  MVTRVATVAFEGIEARAVDVQVQIAAGAVAFTIVGLADKAVAESRERVRSALIASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPAKRITVNLAPADL 73


>gi|218530158|ref|YP_002420974.1| Mg chelatase, subunit ChlI [Methylobacterium chloromethanicum
          CM4]
 gi|218522461|gb|ACK83046.1| Mg chelatase, subunit ChlI [Methylobacterium chloromethanicum
          CM4]
          Length = 512

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 50/78 (64%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R++T+AF+GI+   V+VQV ++ G V   IVGL DKAV ESRER++S  I +GL   
Sbjct: 1  MVTRVATVAFEGIEARAVDVQVQIAAGAVAFTIVGLADKAVAESRERVRSALIASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPAKRITVNLAPADL 73


>gi|223041639|ref|ZP_03611836.1| competence protein comM [Actinobacillus minor 202]
 gi|223017503|gb|EEF15917.1| competence protein comM [Actinobacillus minor 202]
          Length = 511

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+  + IVGLP+  V E+ +R++S  I+A   +  
Sbjct: 3  LAIVYSRASIGVEAPLVTIEVHISNGQPKLTIVGLPEATVKEAGDRVRSALINANFFY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PPQRITINLAPADL 74


>gi|108804232|ref|YP_644169.1| Mg chelatase-like protein [Rubrobacter xylanophilus DSM 9941]
 gi|108765475|gb|ABG04357.1| Mg chelatase-related protein [Rubrobacter xylanophilus DSM 9941]
          Length = 501

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R+ ++A  GI  +PV+V+V + PG  G  +VGLPD AV E+RER++    +AG  F  
Sbjct: 3  VCRVRSLALVGIDALPVDVEVDMGPGLPGFSVVGLPDAAVQEARERVRVAISNAGYRF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             PS  + +     +L
Sbjct: 61 ---PSKKVIVNLAPANL 74


>gi|56477209|ref|YP_158798.1| Mg(2+) chelatase family protein [Aromatoleum aromaticum EbN1]
 gi|56313252|emb|CAI07897.1| probable Mg(2+) chelatase family related protein [Aromatoleum
          aromaticum EbN1]
          Length = 497

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I T A  G+    V V+V ++ G     +VGL D  V E+R+R+++  + +      
Sbjct: 3  LALIRTRALVGLAAPEVTVEVHLANGLPAFNLVGLADTEVREARDRVRAAIVTSQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPQRRITVNLAPADL 74


>gi|190889991|ref|YP_001976533.1| Mg-chelatase [Rhizobium etli CIAT 652]
 gi|190695270|gb|ACE89355.1| probable Mg-chelatase protein [Rhizobium etli CIAT 652]
          Length = 510

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 41/78 (52%), Positives = 58/78 (74%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AFQGI+G+PVEVQVM++PG++G+QIVGLPDKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVGTVAFQGIEGVPVEVQVMIAPGKIGMQIVGLPDKAVAESRERVQAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPAKRVTVNLAPADL 73


>gi|297625010|ref|YP_003706444.1| Mg chelatase subunit ChlI [Truepera radiovictrix DSM 17093]
 gi|297166190|gb|ADI15901.1| Mg chelatase, subunit ChlI [Truepera radiovictrix DSM 17093]
          Length = 493

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +++++    G+    V+V+V VS G  G+ IVGLPD AV ESRER+++   +AGL F 
Sbjct: 1  MFAQLTSATTLGVNAFAVQVEVDVSGGLPGMLIVGLPDAAVQESRERVRAAVRNAGLPF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     D+
Sbjct: 60 ----PASRIVVNLAPADV 73


>gi|325295555|ref|YP_004282069.1| Mg chelatase, subunit ChlI [Desulfurobacterium thermolithotrophum
          DSM 11699]
 gi|325066003|gb|ADY74010.1| Mg chelatase, subunit ChlI [Desulfurobacterium thermolithotrophum
          DSM 11699]
          Length = 505

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+  + + A  G+ G+ V+V+V    G  G  IVGLPD AV ES+ER+++  +++G  F 
Sbjct: 1  MVFTVRSFAVVGVDGVEVKVEVDAGRGLPGTVIVGLPDSAVKESKERVKAAIVNSGYPF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     D+
Sbjct: 60 ----PTKKIVVNLAPADV 73


>gi|163744696|ref|ZP_02152056.1| competence protein ComM [Oceanibulbus indolifex HEL-45]
 gi|161381514|gb|EDQ05923.1| competence protein ComM [Oceanibulbus indolifex HEL-45]
          Length = 505

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MISR  T+AFQG++   VEVQ  V+ G  G  IVGL DKAV E+R+R+++         +
Sbjct: 1  MISRAYTVAFQGVEARIVEVQCAVTAGLPGFSIVGLADKAVSEARDRVRTALSA-----M 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 56 AIALPSKRITVNLSPADL 73


>gi|126734875|ref|ZP_01750621.1| competence protein ComM [Roseobacter sp. CCS2]
 gi|126715430|gb|EBA12295.1| competence protein ComM [Roseobacter sp. CCS2]
          Length = 504

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++   T+AF+GI+   VEVQ  V+PG     IVGLPDKAV E+RER+++         +
Sbjct: 1  MVALAYTVAFEGIEARLVEVQCAVTPGIPAFSIVGLPDKAVSEARERVRAALTA-----M 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 56 AIALPSKRITVNLSPADL 73


>gi|227824185|ref|YP_002828158.1| Mg chelatase-related protein [Sinorhizobium fredii NGR234]
 gi|227343187|gb|ACP27405.1| Mg chelatase-related protein [Sinorhizobium fredii NGR234]
          Length = 510

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 59/78 (75%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ST+AFQGI+G+PV+VQVMV+PG+VG+QIVGLPDKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVSTVAFQGIEGVPVDVQVMVAPGKVGMQIVGLPDKAVAESRERVQAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPAKKVTVNLAPADL 73


>gi|296448572|ref|ZP_06890445.1| Mg chelatase, subunit ChlI [Methylosinus trichosporium OB3b]
 gi|296253912|gb|EFH01066.1| Mg chelatase, subunit ChlI [Methylosinus trichosporium OB3b]
          Length = 512

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 49/78 (62%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ R++T+AF+GI+  PV+VQV ++ G V   +VGL DKAV ESRER+++    +GL   
Sbjct: 1  MVVRVATVAFEGIEAKPVDVQVQIANGNVVFTLVGLADKAVAESRERVRAALTASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  L +     D+
Sbjct: 58 --ALPAKRLTVNLAPADM 73


>gi|239833180|ref|ZP_04681509.1| Mg chelatase-related protein [Ochrobactrum intermedium LMG 3301]
 gi|239825447|gb|EEQ97015.1| Mg chelatase-related protein [Ochrobactrum intermedium LMG 3301]
          Length = 521

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 38/78 (48%), Positives = 56/78 (71%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AFQGI+ +PV+VQVMV+PG++G+ IVGLPDKAV ESRER+Q+    +GL   
Sbjct: 12 MVARVGTVAFQGIEAVPVDVQVMVAPGKMGMSIVGLPDKAVAESRERVQAALHASGL--- 68

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 69 --SMPTKRVTVNLAPADL 84


>gi|150398731|ref|YP_001329198.1| Mg chelatase subunit ChlI [Sinorhizobium medicae WSM419]
 gi|150030246|gb|ABR62363.1| Mg chelatase, subunit ChlI [Sinorhizobium medicae WSM419]
          Length = 532

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 59/78 (75%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ST+AFQGI+G+PV+VQVMV+PGRVG+QIVGLPDKAV ESRER+Q+    +GL   
Sbjct: 23 MVARVSTVAFQGIEGLPVDVQVMVAPGRVGMQIVGLPDKAVAESRERVQAALHASGL--- 79

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 80 --ALPAKRVTVNLAPADL 95


>gi|239995747|ref|ZP_04716271.1| Mg chelatase, subunit ChlI [Alteromonas macleodii ATCC 27126]
          Length = 504

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 41/76 (53%), Gaps = 5/76 (6%)

Query: 3  SRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVN 62
          + + T A QG+    V V++ ++ G    Q+VG+ + +V E+RER++S  I++G      
Sbjct: 4  AVVKTFAGQGVAAPEVSVEIHLANGLPAFQLVGMAETSVKEARERVRSALINSGF----- 58

Query: 63 ELPSIYLQLIYQKKDL 78
          E P+  + +     D+
Sbjct: 59 EFPAKRITVNLAPADI 74


>gi|117928756|ref|YP_873307.1| Mg chelatase, subunit ChlI [Acidothermus cellulolyticus 11B]
 gi|117649219|gb|ABK53321.1| Mg chelatase, subunit ChlI [Acidothermus cellulolyticus 11B]
          Length = 515

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++R  +I   GI G  VEV+  ++PG  G  +VGLPD A+ E+R+RI++  +++G     
Sbjct: 3  LARTWSITLTGIIGHLVEVEADLAPGLPGCTLVGLPDAALSEARDRIRAAILNSG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
             PS  + L     DL
Sbjct: 58 ESWPSRRITLGLSPADL 74


>gi|312143694|ref|YP_003995140.1| Mg chelatase, subunit ChlI [Halanaerobium sp. 'sapolanicus']
 gi|311904345|gb|ADQ14786.1| Mg chelatase, subunit ChlI [Halanaerobium sp. 'sapolanicus']
          Length = 512

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S + +    G+K   V V++ +S G  G  IVGL  K V ES +R++S  I++G    
Sbjct: 1  MYSFVHSAVISGVKAEIVRVEIDISRGLPGFHIVGLAGKTVKESAKRVRSAIINSGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     ++
Sbjct: 58 --EWPIKKITVNLAPGNI 73


>gi|170749545|ref|YP_001755805.1| Mg chelatase, subunit ChlI [Methylobacterium radiotolerans JCM
          2831]
 gi|170656067|gb|ACB25122.1| Mg chelatase, subunit ChlI [Methylobacterium radiotolerans JCM
          2831]
          Length = 512

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 51/78 (65%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R++T+AF+GI+   V+VQV + PG V   +VGLPDKAV ESRER++S  I +GL   
Sbjct: 1  MVTRVATVAFEGIEARAVDVQVQIVPGSVVFTVVGLPDKAVAESRERVRSALIASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPAKRITVNLAPADL 73


>gi|23015838|ref|ZP_00055604.1| COG0606: Predicted ATPase with chaperone activity
          [Magnetospirillum magnetotacticum MS-1]
          Length = 504

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 32/79 (40%), Positives = 46/79 (58%), Gaps = 5/79 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +R +T+AF GI  + ++VQV V+ G     +VGLPDKAV ESRER+++ F   GL   
Sbjct: 1  MTTRTNTVAFSGIDCLDIDVQVQVAAGLPAFTLVGLPDKAVGESRERVRAAFNAIGL--- 57

Query: 61 VNELPSIYLQLIYQKKDLI 79
             LP   + +     DL+
Sbjct: 58 --ALPPKRITVNLAPADLL 74


>gi|304440376|ref|ZP_07400265.1| Mg chelatase-like protein [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304371128|gb|EFM24745.1| Mg chelatase-like protein [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 506

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 37/76 (48%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +++ T+   G++G  V V+  +      + IVGL D AV ES ER++S   ++G  F 
Sbjct: 1  MYAKVKTVTLLGLEGTLVNVEADIVRNIPKLTIVGLADTAVKESGERVRSAITNSGYSF- 59

Query: 61 VNELPSIYLQLIYQKK 76
              P+  + +     
Sbjct: 60 ----PNERVTVNLAPA 71


>gi|114327640|ref|YP_744797.1| ATPase related to magnesium chelatase subunit ChlI [Granulibacter
          bethesdensis CGDNIH1]
 gi|114315814|gb|ABI61874.1| ATPase related to magnesium chelatase subunit ChlI [Granulibacter
          bethesdensis CGDNIH1]
          Length = 503

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  + AF GI  IPVE+QV +SPG    Q+VGLPDKAV E+RER+++     GL    
Sbjct: 12 VVRTHSFAFAGITAIPVEIQVQISPGLPAFQVVGLPDKAVGEARERVRAALASMGL---- 67

Query: 62 NELPSIYLQLIYQKKDLI 79
            LP   + +     DL+
Sbjct: 68 -ALPPRRILVNLAPADLL 84


>gi|86355980|ref|YP_467872.1| Mg-chelatase protein [Rhizobium etli CFN 42]
 gi|86280082|gb|ABC89145.1| probable Mg-chelatase protein [Rhizobium etli CFN 42]
          Length = 510

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 41/78 (52%), Positives = 58/78 (74%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AFQGI+G+PVEVQVM++PG++G+QIVGLPDKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVGTVAFQGIEGVPVEVQVMIAPGKIGMQIVGLPDKAVAESRERVQAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPAKRVTVNLAPADL 73


>gi|242280938|ref|YP_002993067.1| Mg chelatase, subunit ChlI [Desulfovibrio salexigens DSM 2638]
 gi|242123832|gb|ACS81528.1| Mg chelatase, subunit ChlI [Desulfovibrio salexigens DSM 2638]
          Length = 508

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSP-GRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          MI+++S  A  GI    V+++V ++  G     +VGL + AV ES+ER+ S   ++G   
Sbjct: 1  MIAKVSCAALMGIDAFKVDLEVDLTRQGMPAFTMVGLAEGAVKESKERVFSALKNSGYR- 59

Query: 60 LVNELPSIYLQLIYQKKDL 78
              +P   + +     D+
Sbjct: 60 ----IPPSRITVNLAPADI 74


>gi|209551905|ref|YP_002283822.1| Mg chelatase, subunit ChlI [Rhizobium leguminosarum bv. trifolii
          WSM2304]
 gi|209537661|gb|ACI57596.1| Mg chelatase, subunit ChlI [Rhizobium leguminosarum bv. trifolii
          WSM2304]
          Length = 510

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 42/78 (53%), Positives = 58/78 (74%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ST+AFQGI+G+PVEVQVM++PG++G+QIVGLPDKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVSTVAFQGIEGVPVEVQVMIAPGKIGMQIVGLPDKAVAESRERVQAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 58 --ALPGKRVTVNLAPADL 73


>gi|149915378|ref|ZP_01903905.1| competence protein ComM [Roseobacter sp. AzwK-3b]
 gi|149810667|gb|EDM70508.1| competence protein ComM [Roseobacter sp. AzwK-3b]
          Length = 504

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R  T+AF+G++   VEVQ  ++PG     +VGLPDKAV E+R+R+++         +
Sbjct: 1  MVTRTYTVAFEGVEARDVEVQCAITPGMPAFSLVGLPDKAVSEARDRVRTALSS-----M 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     D+
Sbjct: 56 AIALPSKRITINLSPADM 73


>gi|330972244|gb|EGH72310.1| Mg-chelatase subunits D/I family, ComM subfamily protein
          [Pseudomonas syringae pv. aceris str. M302273PT]
          Length = 287

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++ ++S  +++GL F  
Sbjct: 3  LAIVHSRAQVGVEAPAVTVEAHLANGLPALTLVGLPEGAVKESKDGVRSAILNSGLDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L     DL
Sbjct: 61 ---PARRITLNLAPADL 74


>gi|254461823|ref|ZP_05075239.1| Mg chelatase family protein [Rhodobacterales bacterium HTCC2083]
 gi|206678412|gb|EDZ42899.1| Mg chelatase family protein [Rhodobacteraceae bacterium HTCC2083]
          Length = 504

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++   T+AF+G+    VEVQ  V+PG     IVGLPDKAV E+R+R+++         +
Sbjct: 1  MVAHAYTVAFEGVSARSVEVQCAVTPGLPAFSIVGLPDKAVSEARDRVRAALSA-----M 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 56 SIALPSKRITINISPADL 73


>gi|187778968|ref|ZP_02995441.1| hypothetical protein CLOSPO_02563 [Clostridium sporogenes ATCC
          15579]
 gi|187772593|gb|EDU36395.1| hypothetical protein CLOSPO_02563 [Clostridium sporogenes ATCC
          15579]
          Length = 510

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 5/76 (6%)

Query: 3  SRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVN 62
          S++ T    G     + V+V +S G     IVGL D +V ES+ER++S   ++G      
Sbjct: 6  SKVITATLNGACCNLISVEVDISHGLPAFNIVGLADTSVKESKERVKSAITNSGY----- 60

Query: 63 ELPSIYLQLIYQKKDL 78
          E P   + +     D+
Sbjct: 61 EFPISKITVNLSPADI 76


>gi|303249999|ref|ZP_07336201.1| competence protein M [Actinobacillus pleuropneumoniae serovar 6
          str. Femo]
 gi|307253429|ref|ZP_07535300.1| Magnesium chelatase family protein [Actinobacillus
          pleuropneumoniae serovar 6 str. Femo]
 gi|302651062|gb|EFL81216.1| competence protein M [Actinobacillus pleuropneumoniae serovar 6
          str. Femo]
 gi|306859108|gb|EFM91150.1| Magnesium chelatase family protein [Actinobacillus
          pleuropneumoniae serovar 6 str. Femo]
          Length = 508

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G+ IVGLP+  V E+ +R++S  ++A  ++  
Sbjct: 3  LAIVYSRASIGVEAPLVTIEVHLSNGKPGLTIVGLPETTVKEAGDRVRSALMNANFMY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PPHRITINLAPADL 74


>gi|222147291|ref|YP_002548248.1| hypothetical protein Avi_0363 [Agrobacterium vitis S4]
 gi|221734281|gb|ACM35244.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 510

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 42/78 (53%), Positives = 56/78 (71%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AFQGI G+PV+VQVMV+PG++GVQIVGLPDKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVGTVAFQGIDGVPVDVQVMVAPGKIGVQIVGLPDKAVAESRERVQAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 58 --ALPPKRVTINLAPADL 73


>gi|332995792|gb|AEF05847.1| Mg chelatase, subunit ChlI [Alteromonas sp. SN2]
          Length = 504

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 41/76 (53%), Gaps = 5/76 (6%)

Query: 3  SRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVN 62
          + + T A QG+    V V++ ++ G    Q+VG+ + +V E+RER++S  I++G  F   
Sbjct: 4  AVVKTFAGQGVAAPEVSVEIHLANGLPAFQLVGMAETSVKEARERVRSALINSGFDF--- 60

Query: 63 ELPSIYLQLIYQKKDL 78
            P+  + +     D+
Sbjct: 61 --PAKRITVNLAPADI 74


>gi|319780481|ref|YP_004139957.1| Mg chelatase, subunit ChlI [Mesorhizobium ciceri biovar
          biserrulae WSM1271]
 gi|317166369|gb|ADV09907.1| Mg chelatase, subunit ChlI [Mesorhizobium ciceri biovar
          biserrulae WSM1271]
          Length = 510

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 54/78 (69%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AFQGI+ +PV+VQVM++PG+V + IVGL DKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVRTVAFQGIEAVPVDVQVMIAPGKVNMHIVGLGDKAVAESRERVQAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +PS  + +     DL
Sbjct: 58 --SMPSKKVTVNLAPADL 73


>gi|90420455|ref|ZP_01228362.1| putative Mg chelatase [Aurantimonas manganoxydans SI85-9A1]
 gi|90335183|gb|EAS48936.1| putative Mg chelatase [Aurantimonas manganoxydans SI85-9A1]
          Length = 521

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 42/78 (53%), Positives = 56/78 (71%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+SR+ T+AFQGI+ IPV+VQVMV+PG+VG+QIVGLPDKAV ESRER+Q+    +GL   
Sbjct: 12 MVSRVKTVAFQGIEAIPVDVQVMVAPGKVGIQIVGLPDKAVAESRERVQAALHASGL--- 68

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     DL
Sbjct: 69 --SMPPKKVTVNLAPADL 84


>gi|107023801|ref|YP_622128.1| Mg chelatase-related protein [Burkholderia cenocepacia AU 1054]
 gi|116690888|ref|YP_836511.1| Mg chelatase, subunit ChlI [Burkholderia cenocepacia HI2424]
 gi|105893990|gb|ABF77155.1| Mg chelatase-related protein [Burkholderia cenocepacia AU 1054]
 gi|116648977|gb|ABK09618.1| Mg chelatase, subunit ChlI [Burkholderia cenocepacia HI2424]
          Length = 534

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPASGRAPDVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|193214022|ref|YP_001995221.1| Mg chelatase subunit ChlI [Chloroherpeton thalassium ATCC 35110]
 gi|193087499|gb|ACF12774.1| Mg chelatase, subunit ChlI [Chloroherpeton thalassium ATCC 35110]
          Length = 519

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S++   A  G+  I ++V+  +  G     +VGLPD A+ ESRER+ +   ++G    
Sbjct: 1  MLSQLCAAAVIGVDAIRIDVETNLDSGLPAFIVVGLPDSAIKESRERVMTALKNSGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     D+
Sbjct: 58 --SIPPKKITVNLAPADV 73


>gi|206559125|ref|YP_002229885.1| putative magnesium chelatase subunit [Burkholderia cenocepacia
          J2315]
 gi|198035162|emb|CAR51036.1| putative magnesium chelatase subunit [Burkholderia cenocepacia
          J2315]
          Length = 534

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPASGRAPDVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|170734213|ref|YP_001766160.1| Mg chelatase subunit ChlI [Burkholderia cenocepacia MC0-3]
 gi|169817455|gb|ACA92038.1| Mg chelatase, subunit ChlI [Burkholderia cenocepacia MC0-3]
          Length = 534

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPASGRAPDVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|270700779|ref|ZP_06223034.1| Competence protein comM [Haemophilus influenzae HK1212]
 gi|270315886|gb|EFA27972.1| Competence protein comM [Haemophilus influenzae HK1212]
          Length = 115

 Score =  103 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G  +VGLP+K V E+++R++S  I+A   +  
Sbjct: 3  LAIVYSRASMGVQAPLVTIEVHLSNGKPGFTLVGLPEKTVKEAQDRVRSALINAQFKY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|114707808|ref|ZP_01440702.1| hypothetical protein FP2506_17664 [Fulvimarina pelagi HTCC2506]
 gi|114536797|gb|EAU39927.1| hypothetical protein FP2506_17664 [Fulvimarina pelagi HTCC2506]
          Length = 216

 Score =  103 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 38/78 (48%), Positives = 54/78 (69%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AFQGI+  PV+VQVMV+PG++G+ IVGLPDKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVKTVAFQGIEARPVDVQVMVAPGKMGISIVGLPDKAVAESRERVQAAIHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     DL
Sbjct: 58 --AMPPKRVTVNLAPADL 73


>gi|187478563|ref|YP_786587.1| competence protein [Bordetella avium 197N]
 gi|115423149|emb|CAJ49680.1| putative competence protein (putative Mg(2+)chelatase)
          [Bordetella avium 197N]
          Length = 509

 Score =  103 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 4/77 (5%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ +S+ A  G++ + V V+  + PG     +VGLPD  V ESRER+++  I++G  F  
Sbjct: 3  LAVLSSRALLGLQTLAVRVEAHLGPGLPAFTVVGLPDLEVRESRERVRAAIINSGFEFPS 62

Query: 62 NELPSIYLQLIYQKKDL 78
                 + +     DL
Sbjct: 63 G----GRITINLSPADL 75


>gi|83952480|ref|ZP_00961211.1| competence protein ComM [Roseovarius nubinhibens ISM]
 gi|83836153|gb|EAP75451.1| competence protein ComM [Roseovarius nubinhibens ISM]
          Length = 504

 Score =  103 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ R  T+AF+GI+   VEVQ  V+ G     +VGLPDKAV E+R+R+++         +
Sbjct: 1  MVCRAYTVAFEGIEARTVEVQCAVAAGVPAFSVVGLPDKAVSEARDRVRAALTS-----M 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 56 SIALPSKRITINLSPADL 73


>gi|84515919|ref|ZP_01003280.1| competence protein ComM [Loktanella vestfoldensis SKA53]
 gi|84510361|gb|EAQ06817.1| competence protein ComM [Loktanella vestfoldensis SKA53]
          Length = 504

 Score =  103 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++   T+AF+GI+   VEVQ  V+PG     IVGLPDKAV E+RER+++         +
Sbjct: 1  MVAIAYTVAFEGIEARLVEVQCAVTPGVPAFSIVGLPDKAVSEARERVRAALTA-----M 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 56 AIALPSKRITVNLSPADL 73


>gi|317154985|ref|YP_004123033.1| Mg chelatase subunit ChlI [Desulfovibrio aespoeensis Aspo-2]
 gi|316945236|gb|ADU64287.1| Mg chelatase, subunit ChlI [Desulfovibrio aespoeensis Aspo-2]
          Length = 509

 Score =  103 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 23/79 (29%), Positives = 37/79 (46%), Gaps = 6/79 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSP-GRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          MI+ ++  A  GI    VE++V  S  G     +VGL + AV ES+ER+ S   + G   
Sbjct: 1  MIANVACAALMGIDAFKVELEVDFSRSGMPAFTMVGLAEGAVRESKERVFSALKNCGFK- 59

Query: 60 LVNELPSIYLQLIYQKKDL 78
              +P   + +     D+
Sbjct: 60 ----VPPARITVNLAPADV 74


>gi|53724537|ref|YP_104696.1| Mg chelatase subunit D/I family protein [Burkholderia mallei ATCC
          23344]
 gi|67640748|ref|ZP_00439544.1| putative Mg chelatase [Burkholderia mallei GB8 horse 4]
 gi|121599890|ref|YP_991546.1| Mg chelatase, subunit D/I family protein [Burkholderia mallei
          SAVP1]
 gi|124386149|ref|YP_001027381.1| Mg chelatase, subunit D/I family protein [Burkholderia mallei
          NCTC 10229]
 gi|126451139|ref|YP_001082346.1| Mg chelatase, subunit D/I family protein [Burkholderia mallei
          NCTC 10247]
 gi|167001984|ref|ZP_02267774.1| putative Mg chelatase [Burkholderia mallei PRL-20]
 gi|254174759|ref|ZP_04881420.1| Mg chelatase, subunit D/I family protein [Burkholderia mallei
          ATCC 10399]
 gi|254201793|ref|ZP_04908157.1| Mg chelatase [Burkholderia mallei FMH]
 gi|52427960|gb|AAU48553.1| Mg chelatase, subunit D/I family protein [Burkholderia mallei
          ATCC 23344]
 gi|121228700|gb|ABM51218.1| Mg chelatase, subunit D/I family protein [Burkholderia mallei
          SAVP1]
 gi|124294169|gb|ABN03438.1| Mg chelatase homolog [Burkholderia mallei NCTC 10229]
 gi|126244009|gb|ABO07102.1| Mg chelatase homolog [Burkholderia mallei NCTC 10247]
 gi|147747687|gb|EDK54763.1| Mg chelatase [Burkholderia mallei FMH]
 gi|160695804|gb|EDP85774.1| Mg chelatase, subunit D/I family protein [Burkholderia mallei
          ATCC 10399]
 gi|238521522|gb|EEP84973.1| putative Mg chelatase [Burkholderia mallei GB8 horse 4]
 gi|243062311|gb|EES44497.1| putative Mg chelatase [Burkholderia mallei PRL-20]
          Length = 528

 Score =  103 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|225016297|ref|ZP_03705489.1| hypothetical protein CLOSTMETH_00200 [Clostridium methylpentosum
          DSM 5476]
 gi|224950972|gb|EEG32181.1| hypothetical protein CLOSTMETH_00200 [Clostridium methylpentosum
          DSM 5476]
          Length = 501

 Score =  103 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 20/71 (28%), Positives = 34/71 (47%), Gaps = 5/71 (7%)

Query: 8  IAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSI 67
          +   G+   PV V++ ++ G     +VGLPD AV ESR+R+++   + G      E P  
Sbjct: 1  MGLLGLNAYPVTVEIDMAGGLPAFDVVGLPDTAVKESRDRVRAALKNCGY-----EFPVQ 55

Query: 68 YLQLIYQKKDL 78
           +       D+
Sbjct: 56 RITANLAPADV 66


>gi|254295988|ref|ZP_04963445.1| putative Mg chelatase [Burkholderia pseudomallei 406e]
 gi|157806063|gb|EDO83233.1| putative Mg chelatase [Burkholderia pseudomallei 406e]
          Length = 528

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|134279890|ref|ZP_01766602.1| Mg chelatase-like protein [Burkholderia pseudomallei 305]
 gi|167901120|ref|ZP_02488325.1| Mg chelatase, subunit D/I family protein [Burkholderia
          pseudomallei NCTC 13177]
 gi|217419775|ref|ZP_03451281.1| Mg chelatase-like protein [Burkholderia pseudomallei 576]
 gi|226193675|ref|ZP_03789278.1| putative Mg chelatase [Burkholderia pseudomallei Pakistan 9]
 gi|134249090|gb|EBA49172.1| Mg chelatase-like protein [Burkholderia pseudomallei 305]
 gi|217397079|gb|EEC37095.1| Mg chelatase-like protein [Burkholderia pseudomallei 576]
 gi|225934253|gb|EEH30237.1| putative Mg chelatase [Burkholderia pseudomallei Pakistan 9]
          Length = 528

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|254472154|ref|ZP_05085554.1| putative Mg chelatase [Pseudovibrio sp. JE062]
 gi|211958437|gb|EEA93637.1| putative Mg chelatase [Pseudovibrio sp. JE062]
          Length = 508

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M SRIST++FQG+    V+VQV +SPG V   +VGLPDKA+ ES+ER++S  I +GL   
Sbjct: 1  MFSRISTVSFQGVDAANVDVQVQISPGSVYFTLVGLPDKAIAESKERVRSALIASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPAKRVTVNLAPADL 73


>gi|323524618|ref|YP_004226771.1| Mg chelatase subunit ChlI [Burkholderia sp. CCGE1001]
 gi|323381620|gb|ADX53711.1| Mg chelatase, subunit ChlI [Burkholderia sp. CCGE1001]
          Length = 531

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G  F  
Sbjct: 3  LAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PVRRITVNLAPADL 74


>gi|126442182|ref|YP_001057519.1| putative Mg chelatase [Burkholderia pseudomallei 668]
 gi|126221675|gb|ABN85181.1| putative Mg chelatase [Burkholderia pseudomallei 668]
          Length = 528

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|126455239|ref|YP_001064768.1| putative Mg chelatase [Burkholderia pseudomallei 1106a]
 gi|242317990|ref|ZP_04817006.1| putative Mg chelatase [Burkholderia pseudomallei 1106b]
 gi|254187893|ref|ZP_04894405.1| putative Mg chelatase [Burkholderia pseudomallei Pasteur 52237]
 gi|254196859|ref|ZP_04903283.1| putative Mg chelatase [Burkholderia pseudomallei S13]
 gi|126228881|gb|ABN92421.1| Mg chelatase homolog [Burkholderia pseudomallei 1106a]
 gi|157935573|gb|EDO91243.1| putative Mg chelatase [Burkholderia pseudomallei Pasteur 52237]
 gi|169653602|gb|EDS86295.1| putative Mg chelatase [Burkholderia pseudomallei S13]
 gi|242141229|gb|EES27631.1| putative Mg chelatase [Burkholderia pseudomallei 1106b]
          Length = 528

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|254181963|ref|ZP_04888560.1| putative Mg chelatase [Burkholderia pseudomallei 1655]
 gi|184212501|gb|EDU09544.1| putative Mg chelatase [Burkholderia pseudomallei 1655]
          Length = 528

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|323141921|ref|ZP_08076781.1| Mg chelatase-like protein [Phascolarctobacterium sp. YIT 12067]
 gi|322413588|gb|EFY04447.1| Mg chelatase-like protein [Phascolarctobacterium sp. YIT 12067]
          Length = 506

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M ++I      GI G+ + V+V VS G     +VGLP  AV ES+ER+++   ++   F 
Sbjct: 1  MFAQILGETTCGIDGVQILVEVDVSNGLPSFDLVGLPAMAVRESKERVKAALRNSDYPF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PMTRITVNLAPADL 73


>gi|237810671|ref|YP_002895122.1| putative Mg chelatase family protein [Burkholderia pseudomallei
          MSHR346]
 gi|237502991|gb|ACQ95309.1| putative Mg chelatase family protein [Burkholderia pseudomallei
          MSHR346]
          Length = 528

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|76812144|ref|YP_332062.1| Mg chelatase-like protein [Burkholderia pseudomallei 1710b]
 gi|254259571|ref|ZP_04950625.1| putative Mg chelatase [Burkholderia pseudomallei 1710a]
 gi|76581597|gb|ABA51072.1| Mg chelatase homolog [Burkholderia pseudomallei 1710b]
 gi|254218260|gb|EET07644.1| putative Mg chelatase [Burkholderia pseudomallei 1710a]
          Length = 528

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|53718071|ref|YP_107057.1| putative magnesium chelatase subunit [Burkholderia pseudomallei
          K96243]
 gi|52208485|emb|CAH34420.1| putative magnesium chelatase subunit [Burkholderia pseudomallei
          K96243]
          Length = 528

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|218515923|ref|ZP_03512763.1| putative Mg2+ chelatase family protein [Rhizobium etli 8C-3]
          Length = 91

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 42/78 (53%), Positives = 59/78 (75%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ST+AFQGI+G+PVEVQVM++PG++G+QIVGLPDKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVSTVAFQGIEGVPVEVQVMIAPGKIGMQIVGLPDKAVAESRERVQAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 58 --ALPAKRVTVNLAPADL 73


>gi|170691558|ref|ZP_02882723.1| Mg chelatase, subunit ChlI [Burkholderia graminis C4D1M]
 gi|170143763|gb|EDT11926.1| Mg chelatase, subunit ChlI [Burkholderia graminis C4D1M]
          Length = 527

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G  F  
Sbjct: 3  LAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PVRRITVNLAPADL 74


>gi|330818413|ref|YP_004362118.1| Mg chelatase, subunit ChlI [Burkholderia gladioli BSR3]
 gi|327370806|gb|AEA62162.1| Mg chelatase, subunit ChlI [Burkholderia gladioli BSR3]
          Length = 583

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G  F  
Sbjct: 3  LAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PVRRITVNLAPADL 74


>gi|172061826|ref|YP_001809478.1| Mg chelatase subunit ChlI [Burkholderia ambifaria MC40-6]
 gi|171994343|gb|ACB65262.1| Mg chelatase, subunit ChlI [Burkholderia ambifaria MC40-6]
          Length = 528

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPAAGRAPDVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|115352974|ref|YP_774813.1| Mg chelatase subunit ChlI [Burkholderia ambifaria AMMD]
 gi|115282962|gb|ABI88479.1| Mg chelatase, subunit ChlI [Burkholderia ambifaria AMMD]
          Length = 536

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPAAGRAPDVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|21233297|ref|NP_639214.1| competence related protein [Xanthomonas campestris pv. campestris
          str. ATCC 33913]
 gi|66770256|ref|YP_245018.1| competence related protein [Xanthomonas campestris pv. campestris
          str. 8004]
 gi|188993456|ref|YP_001905466.1| Putative competence related protein [Xanthomonas campestris pv.
          campestris str. B100]
 gi|21115136|gb|AAM43105.1| competence related protein [Xanthomonas campestris pv. campestris
          str. ATCC 33913]
 gi|66575588|gb|AAY50998.1| competence related protein [Xanthomonas campestris pv. campestris
          str. 8004]
 gi|167735216|emb|CAP53428.1| Putative competence related protein [Xanthomonas campestris pv.
          campestris]
          Length = 506

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V +S G    QIVGLP+ AV ESRER+++  + A      
Sbjct: 3  LALVHSRARVGVHAPEVRVEVHLSGGLPSTQIVGLPEAAVRESRERVRAALLCAQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITINLAPADL 74


>gi|256158633|ref|ZP_05456520.1| Mg chelatase-related protein [Brucella ceti M490/95/1]
 gi|265997141|ref|ZP_06109698.1| Mg chelatase [Brucella ceti M490/95/1]
 gi|262551609|gb|EEZ07599.1| Mg chelatase [Brucella ceti M490/95/1]
          Length = 315

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 55/78 (70%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AF GI+ +PV+VQVM++PG++G+ IVGLPDKAV ESRER+Q+    +GL   
Sbjct: 12 MVARVGTVAFHGIEAVPVDVQVMIAPGKMGMSIVGLPDKAVAESRERVQAALHASGL--- 68

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 69 --SMPAKRVTVNLAPADL 84


>gi|83719860|ref|YP_440963.1| Mg chelatase-like protein [Burkholderia thailandensis E264]
 gi|167617755|ref|ZP_02386386.1| Mg chelatase-related protein [Burkholderia thailandensis Bt4]
 gi|257140383|ref|ZP_05588645.1| Mg chelatase-related protein [Burkholderia thailandensis E264]
 gi|83653685|gb|ABC37748.1| Mg chelatase-related protein [Burkholderia thailandensis E264]
          Length = 526

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|58038555|ref|YP_190519.1| competence protein ComM [Gluconobacter oxydans 621H]
 gi|58000969|gb|AAW59863.1| Competence protein ComM [Gluconobacter oxydans 621H]
          Length = 500

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++RI + AF GI+ +PV V+V VS G     +VGL DK+V E+RER+++     GL    
Sbjct: 11 LARIQSFAFSGIEAVPVTVEVQVSSGLPAFLVVGLADKSVGEARERVRAALTAMGL---- 66

Query: 62 NELPSIYLQLIYQKKDLI 79
            LP   + +     DL+
Sbjct: 67 -ALPPKRILVNLVPADLL 83


>gi|291288835|ref|YP_003505651.1| Mg chelatase, subunit ChlI [Denitrovibrio acetiphilus DSM 12809]
 gi|290885995|gb|ADD69695.1| Mg chelatase, subunit ChlI [Denitrovibrio acetiphilus DSM 12809]
          Length = 502

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 34/78 (43%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSP-GRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M S++ +    GI    VEV+  +   G     +VGL D AV ESR+R+++   +  +  
Sbjct: 1  MFSKVFSAHVNGIDAELVEVETDIGSMGLPSFSMVGLADAAVRESRDRVRAALKNININV 60

Query: 60 LVNELPSIYLQLIYQKKD 77
                +  + +     D
Sbjct: 61 F-----AKPITINLAPAD 73


>gi|319898234|ref|YP_004158327.1| hypothetical protein BARCL_0048 [Bartonella clarridgeiae 73]
 gi|319402198|emb|CBI75729.1| conserved protein of unknown function [Bartonella clarridgeiae
          73]
          Length = 510

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 55/78 (70%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R++T+AF+G++ IPV+VQVM+SPG++G+ IVGL DKAV ESRERIQ+     GL   
Sbjct: 1  MVARVTTVAFRGLEAIPVDVQVMISPGKIGMAIVGLADKAVAESRERIQAALHACGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 58 --SMPNKRVTVNLAPADL 73


>gi|289669321|ref|ZP_06490396.1| ComM [Xanthomonas campestris pv. musacearum NCPPB4381]
          Length = 506

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V +S G    QIVGLP+ AV ESRER+++  + A      
Sbjct: 3  LALVHSRARVGVHAPEVRVEVHLSGGLPSTQIVGLPEAAVRESRERVRAALLCAQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITINLAPADL 74


>gi|161523615|ref|YP_001578627.1| Mg chelatase subunit ChlI [Burkholderia multivorans ATCC 17616]
 gi|189351616|ref|YP_001947244.1| magnesium chelatase family protein [Burkholderia multivorans ATCC
          17616]
 gi|160341044|gb|ABX14130.1| Mg chelatase, subunit ChlI [Burkholderia multivorans ATCC 17616]
 gi|189335638|dbj|BAG44708.1| magnesium chelatase family protein [Burkholderia multivorans ATCC
          17616]
          Length = 538

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPAAGRAPDVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|289666351|ref|ZP_06487932.1| ComM [Xanthomonas campestris pv. vasculorum NCPPB702]
          Length = 506

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V +S G    QIVGLP+ AV ESRER+++  + A      
Sbjct: 3  LALVHSRARVGVHAPEVRVEVHLSGGLPSTQIVGLPEAAVRESRERVRAALLCAQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITINLAPADL 74


>gi|77462360|ref|YP_351864.1| Mg chelatase-related protein [Rhodobacter sphaeroides 2.4.1]
 gi|77386778|gb|ABA77963.1| Mg chelatase-related protein [Rhodobacter sphaeroides 2.4.1]
          Length = 512

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI+R  T+AF+GI    VEVQ  VSPG     IVGLPDKAV E+RER+++         +
Sbjct: 1  MIARAFTVAFEGIDPRSVEVQCAVSPGLPAFAIVGLPDKAVSEARERVRTALAS-----M 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 56 SIALPSRRITVNLSPADL 73


>gi|126461237|ref|YP_001042351.1| Mg chelatase, subunit ChlI [Rhodobacter sphaeroides ATCC 17029]
 gi|126102901|gb|ABN75579.1| Mg chelatase, subunit ChlI [Rhodobacter sphaeroides ATCC 17029]
          Length = 512

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI+R  T+AF+GI    VEVQ  VSPG     IVGLPDKAV E+RER+++         +
Sbjct: 1  MIARAFTVAFEGIDPRSVEVQCAVSPGLPAFAIVGLPDKAVSEARERVRTALAS-----M 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 56 SIALPSRRITVNLSPADL 73


>gi|325914469|ref|ZP_08176813.1| Mg chelatase-related protein [Xanthomonas vesicatoria ATCC 35937]
 gi|325539239|gb|EGD10891.1| Mg chelatase-related protein [Xanthomonas vesicatoria ATCC 35937]
          Length = 506

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V +S G    QIVGLP+ AV ESRER+++  + A      
Sbjct: 3  LALVHSRARVGVHAPEVRVEVHLSGGLPSTQIVGLPEAAVRESRERVRAALLCAQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITINLAPADL 74


>gi|221199913|ref|ZP_03572956.1| putative Mg chelatase homolog [Burkholderia multivorans CGD2M]
 gi|221207418|ref|ZP_03580427.1| putative Mg chelatase homolog [Burkholderia multivorans CGD2]
 gi|221172621|gb|EEE05059.1| putative Mg chelatase homolog [Burkholderia multivorans CGD2]
 gi|221180152|gb|EEE12556.1| putative Mg chelatase homolog [Burkholderia multivorans CGD2M]
          Length = 538

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPAAGRAPDVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|332560244|ref|ZP_08414566.1| Mg chelatase-related protein [Rhodobacter sphaeroides WS8N]
 gi|332277956|gb|EGJ23271.1| Mg chelatase-related protein [Rhodobacter sphaeroides WS8N]
          Length = 512

 Score =  103 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI+R  T+AF+GI    VEVQ  VSPG     IVGLPDKAV E+RER+++         +
Sbjct: 1  MIARAFTVAFEGIDPRSVEVQCAVSPGLPAFAIVGLPDKAVSEARERVRTALAS-----M 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 56 SIALPSRRITVNLSPADL 73


>gi|256830933|ref|YP_003159661.1| Mg chelatase subunit ChlI [Desulfomicrobium baculatum DSM 4028]
 gi|256580109|gb|ACU91245.1| Mg chelatase, subunit ChlI [Desulfomicrobium baculatum DSM 4028]
          Length = 511

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 42/79 (53%), Gaps = 6/79 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSP-GRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          MI+++ST A  GI G  +E++V ++  G     +VGL + AV E++ER+ S   ++G   
Sbjct: 1  MIAKVSTAALLGIDGFSIELEVDLARSGMPAFIMVGLAEGAVREAKERVFSALKNSGFK- 59

Query: 60 LVNELPSIYLQLIYQKKDL 78
              LP   + +     D+
Sbjct: 60 ----LPPSRITVNIAPADV 74


>gi|221211123|ref|ZP_03584102.1| putative Mg chelatase homolog [Burkholderia multivorans CGD1]
 gi|221168484|gb|EEE00952.1| putative Mg chelatase homolog [Burkholderia multivorans CGD1]
          Length = 538

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPAAGRAPDVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|190151085|ref|YP_001969610.1| Competence protein comM [Actinobacillus pleuropneumoniae serovar
          7 str. AP76]
 gi|189916216|gb|ACE62468.1| Competence protein comM [Actinobacillus pleuropneumoniae serovar
          7 str. AP76]
          Length = 96

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+ G+ IVGLP+  V E+ +R++S  ++A  ++  
Sbjct: 3  LAIVYSRASIGVEAPLVTIEVHLSNGKPGLTIVGLPETTVKEAGDRVRSALMNANFMY-- 60

Query: 62 NELPSIYLQLIYQKKDLI 79
             P   + +     DL+
Sbjct: 61 ---PPQRITINLAPADLV 75


>gi|149200761|ref|ZP_01877736.1| competence protein ComM [Roseovarius sp. TM1035]
 gi|149145094|gb|EDM33120.1| competence protein ComM [Roseovarius sp. TM1035]
          Length = 504

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R  T+AF+G++   VEVQ  ++PG     +VGLPDKAV E+R+R+++         +
Sbjct: 1  MVARAYTVAFEGVEAKTVEVQCAITPGVPAFSLVGLPDKAVSEARDRVRAALSA-----M 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     D+
Sbjct: 56 AIALPSRRITINLSPADM 73


>gi|257439385|ref|ZP_05615140.1| Mg chelatase-like protein [Faecalibacterium prausnitzii A2-165]
 gi|257198260|gb|EEU96544.1| Mg chelatase-like protein [Faecalibacterium prausnitzii A2-165]
          Length = 513

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S + +    G+ G  V V+  VS G     +VGLPD AV ES +R++S   + G    
Sbjct: 1  MYSVLKSYGLNGLNGFAVAVEADVSGGLPAFSLVGLPDSAVRESGDRVRSAVKNLGYK-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P  ++ +     D+
Sbjct: 59 ---WPDRHITVNLAPADI 73


>gi|323699708|ref|ZP_08111620.1| Mg chelatase, subunit ChlI [Desulfovibrio sp. ND132]
 gi|323459640|gb|EGB15505.1| Mg chelatase, subunit ChlI [Desulfovibrio desulfuricans ND132]
          Length = 511

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 37/79 (46%), Gaps = 6/79 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSP-GRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          MI+ IS  A  GI    V+++V  S  G     +VGL + AV ES+ER+ S   + G   
Sbjct: 1  MIATISCAALMGIDAFKVQLEVDFSRSGMPAFTMVGLAEGAVRESKERVFSALKNCGFK- 59

Query: 60 LVNELPSIYLQLIYQKKDL 78
              +P   + +     D+
Sbjct: 60 ----VPPARITVNLAPADV 74


>gi|221638220|ref|YP_002524482.1| Mg chelatase subunit ChlI [Rhodobacter sphaeroides KD131]
 gi|221159001|gb|ACL99980.1| Mg chelatase, subunit ChlI [Rhodobacter sphaeroides KD131]
          Length = 514

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI+R  T+AF+GI    VEVQ  VSPG     IVGLPDKAV E+RER+++         +
Sbjct: 1  MIARAFTVAFEGIDPRSVEVQCAVSPGLPAFAIVGLPDKAVSEARERVRTALAS-----M 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 56 SIALPSRRITVNLSPADL 73


>gi|78049603|ref|YP_365778.1| putative competence related protein [Xanthomonas campestris pv.
          vesicatoria str. 85-10]
 gi|325927331|ref|ZP_08188585.1| Mg chelatase-related protein [Xanthomonas perforans 91-118]
 gi|78038033|emb|CAJ25778.1| putative competence related protein [Xanthomonas campestris pv.
          vesicatoria str. 85-10]
 gi|325542332|gb|EGD13820.1| Mg chelatase-related protein [Xanthomonas perforans 91-118]
          Length = 506

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V +S G    QIVGLP+ AV ESRER+++  + A      
Sbjct: 3  LALVHSRARVGVHAPEVRVEVHLSGGLPSTQIVGLPEAAVRESRERVRAALLCAQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITINLAPADL 74


>gi|239813235|ref|YP_002942145.1| Mg chelatase, subunit ChlI [Variovorax paradoxus S110]
 gi|239799812|gb|ACS16879.1| Mg chelatase, subunit ChlI [Variovorax paradoxus S110]
          Length = 517

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 4/77 (5%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + + A  G++   V V+V ++ G     +VGL +  V E+RER++S   +AGL F  
Sbjct: 3  LSLVQSRALLGLEAASVTVEVHLANGLPSFTLVGLAETEVKEARERVRSAIQNAGLEFPN 62

Query: 62 NELPSIYLQLIYQKKDL 78
          N      + +     DL
Sbjct: 63 N----KKIVVNLAPADL 75


>gi|188574472|ref|YP_001911401.1| ComM [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188518924|gb|ACD56869.1| ComM [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 506

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V +S G    Q+VGLP+ AV ESRER+++  + A      
Sbjct: 3  LALVHSRARVGVHAPEVRVEVHLSGGLPSTQMVGLPEAAVRESRERVRAALLCAQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITINLAPADL 74


>gi|166713859|ref|ZP_02245066.1| competence related protein [Xanthomonas oryzae pv. oryzicola
          BLS256]
          Length = 506

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V +S G    Q+VGLP+ AV ESRER+++  + A      
Sbjct: 3  LALVHSRARVGVHAPEVRVEVHLSGGLPSTQMVGLPEAAVRESRERVRAALLCAQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITINLAPADL 74


>gi|58579835|ref|YP_198851.1| competence related protein [Xanthomonas oryzae pv. oryzae
          KACC10331]
 gi|84621843|ref|YP_449215.1| competence related protein [Xanthomonas oryzae pv. oryzae MAFF
          311018]
 gi|58424429|gb|AAW73466.1| competence related protein [Xanthomonas oryzae pv. oryzae
          KACC10331]
 gi|84365783|dbj|BAE66941.1| competence related protein [Xanthomonas oryzae pv. oryzae MAFF
          311018]
          Length = 506

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V +S G    Q+VGLP+ AV ESRER+++  + A      
Sbjct: 3  LALVHSRARVGVHAPEVRVEVHLSGGLPSTQMVGLPEAAVRESRERVRAALLCAQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITINLAPADL 74


>gi|94970260|ref|YP_592308.1| Mg chelatase-related protein [Candidatus Koribacter versatilis
          Ellin345]
 gi|94552310|gb|ABF42234.1| Mg chelatase-related protein [Candidatus Koribacter versatilis
          Ellin345]
          Length = 513

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 39/81 (48%), Gaps = 8/81 (9%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGR---VGVQIVGLPDKAVIESRERIQSHFIHAGL 57
          M+ R  + A  GI    ++V+V V+           VGLPD AV ESRER+++   +AG 
Sbjct: 1  MLFRTKSAAVYGIDAHIIDVEVDVAAQLSEKPLFTTVGLPDAAVRESRERVRAALRNAGY 60

Query: 58 LFLVNELPSIYLQLIYQKKDL 78
                +P+  + +     D+
Sbjct: 61 D-----VPNTTITVNLAPADI 76


>gi|294667468|ref|ZP_06732685.1| competence related protein [Xanthomonas fuscans subsp.
          aurantifolii str. ICPB 10535]
 gi|292602801|gb|EFF46235.1| competence related protein [Xanthomonas fuscans subsp.
          aurantifolii str. ICPB 10535]
          Length = 506

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V +S G    QIVGLP+ AV ESRER+++  + A      
Sbjct: 3  LALVHSRARVGVHAPEVRVEVHLSGGLPSTQIVGLPEAAVRESRERVRAALLCAQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITINLAPADL 74


>gi|198284124|ref|YP_002220445.1| magnesium chelatase ChlI subunit [Acidithiobacillus ferrooxidans
          ATCC 53993]
 gi|198248645|gb|ACH84238.1| magnesium chelatase ChlI subunit [Acidithiobacillus ferrooxidans
          ATCC 53993]
          Length = 273

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  + PG     +VGL + AV E+R+R++S   ++G     
Sbjct: 3  LAIVHSRALTGVQAAGVAVECDLGPGLPTFAVVGLAETAVKEARDRVRSAIQNSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRMVVNLAPADL 74


>gi|294624835|ref|ZP_06703494.1| competence related protein [Xanthomonas fuscans subsp.
          aurantifolii str. ICPB 11122]
 gi|292600868|gb|EFF44946.1| competence related protein [Xanthomonas fuscans subsp.
          aurantifolii str. ICPB 11122]
          Length = 506

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V +S G    QIVGLP+ AV ESRER+++  + A      
Sbjct: 3  LALVHSRARVGVHAPEVRVEVHLSGGLPSTQIVGLPEAAVRESRERVRAALLCAQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITINLAPADL 74


>gi|167835287|ref|ZP_02462170.1| Mg chelatase-related protein [Burkholderia thailandensis MSMB43]
          Length = 527

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|295696086|ref|YP_003589324.1| Mg chelatase, subunit ChlI [Bacillus tusciae DSM 2912]
 gi|295411688|gb|ADG06180.1| Mg chelatase, subunit ChlI [Bacillus tusciae DSM 2912]
          Length = 529

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +R+ ++   G+ G  V V+V +S G    +IVGLP   V E++ER+++   ++G  F 
Sbjct: 1  MFARMPSVGLLGVDGKLVHVEVSISSGLPRFEIVGLPGSEVREAKERVRAAIENSGYPF- 59

Query: 61 VNELPSIYLQLIYQKKD 77
              P   +       D
Sbjct: 60 ----PLRRIVANLTPAD 72


>gi|295675343|ref|YP_003603867.1| Mg chelatase, subunit ChlI [Burkholderia sp. CCGE1002]
 gi|295435186|gb|ADG14356.1| Mg chelatase, subunit ChlI [Burkholderia sp. CCGE1002]
          Length = 540

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G  F  
Sbjct: 3  LAVVRSRAPAAGRAPEVTVEVHLANGLPSFAIVGLPDLEVRESRERVRAALQNCGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PVRRITVNLAPADL 74


>gi|134297059|ref|YP_001120794.1| Mg chelatase subunit ChlI [Burkholderia vietnamiensis G4]
 gi|134140216|gb|ABO55959.1| Mg chelatase, subunit ChlI [Burkholderia vietnamiensis G4]
          Length = 566

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G  F  
Sbjct: 3  LAVVRSRAPAAGRAPDVTVEVHLANGLPSFSIVGLPDVEVRESRERVRAALQNCGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PVRRITVNLAPADL 74


>gi|313501214|gb|ADR62580.1| Mg chelatase, subunit ChlI [Pseudomonas putida BIRD-1]
          Length = 523

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2   ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           ++ + + A  G++   V V+  ++ G   + +VGLP+  V ES++R++S  +++GL +  
Sbjct: 30  LALVHSRAQVGVQAPAVSVETHLANGLPHLTLVGLPETTVKESKDRVRSAIVNSGLKY-- 87

Query: 62  NELPSIYLQLIYQKKDL 78
              P   +       DL
Sbjct: 88  ---PQRRITQNLAPADL 101


>gi|110635909|ref|YP_676117.1| Mg chelatase, subunit ChlI [Mesorhizobium sp. BNC1]
 gi|110286893|gb|ABG64952.1| Mg chelatase, subunit ChlI [Chelativorans sp. BNC1]
          Length = 510

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 55/78 (70%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+SR+ TIAF+GI+ +PV+VQVMV+PG++G+QIVGL DKAV ESRER+Q+    +GL   
Sbjct: 1  MVSRVRTIAFEGIEAVPVDVQVMVAPGKMGIQIVGLGDKAVAESRERVQAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     DL
Sbjct: 58 --SMPPKRVTVNLAPADL 73


>gi|160872368|ref|ZP_02062500.1| putative Mg chelatase homolog [Rickettsiella grylli]
 gi|159121167|gb|EDP46505.1| putative Mg chelatase homolog [Rickettsiella grylli]
          Length = 498

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           + + T A  GI+ +PV V+  +S G   + IVGLP+  V  SR R++S  I+A      
Sbjct: 3  FASVQTRANIGIQAVPVSVETHISNGLSSLSIVGLPETTVKGSRGRVRSAIINAQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITINLAPADL 74


>gi|319406441|emb|CBI80081.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 510

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 54/78 (69%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R++T+AF+G++ IPV+VQVM+S G++G+ IVGL DKAV ESRERIQ+     GL   
Sbjct: 1  MVARVTTVAFRGLEAIPVDVQVMISSGKIGMAIVGLADKAVAESRERIQAALHACGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 58 --SMPNKRVTVNLAPADL 73


>gi|168334423|ref|ZP_02692598.1| Mg chelatase, subunit ChlI [Epulopiscium sp. 'N.t. morphotype B']
          Length = 510

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  ++ T   +G+  + V+V+V ++ G  G +IVGLPD +V ES++R+++   ++G  F 
Sbjct: 1  MYYKLITYTLKGLLPVKVDVEVDINTGMPGFEIVGLPDNSVKESKDRMRTAIKNSGYPF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     +L
Sbjct: 60 ----PISKITINLAPANL 73


>gi|325919719|ref|ZP_08181721.1| Mg chelatase-related protein [Xanthomonas gardneri ATCC 19865]
 gi|325549827|gb|EGD20679.1| Mg chelatase-related protein [Xanthomonas gardneri ATCC 19865]
          Length = 506

 Score =  102 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V +S G    QIVGLP+ AV ESRER+++  + A      
Sbjct: 3  LALVHSRARVGVHAPEVRVEVHLSGGLPSTQIVGLPEAAVRESRERVRAALLCAQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITINLAPADL 74


>gi|254796468|ref|YP_003081304.1| putative Mg chelatase-like protein [Neorickettsia risticii str.
          Illinois]
 gi|254589708|gb|ACT69070.1| putative Mg chelatase-like protein [Neorickettsia risticii str.
          Illinois]
          Length = 501

 Score =  102 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 45/81 (55%), Gaps = 5/81 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M + I T++ QGI  + + VQV +SPG     IVGLPDKA+ ES+ERI++  +H GL   
Sbjct: 1  MFTEIHTVSIQGINLVKIGVQVAISPGLPCFNIVGLPDKAISESKERIRAALLHIGL--- 57

Query: 61 VNELPSIYLQLIYQKKDLIMI 81
             LP   + +      L  I
Sbjct: 58 --SLPKKRITVNLSPAGLTKI 76


>gi|210610055|ref|ZP_03288234.1| hypothetical protein CLONEX_00420 [Clostridium nexile DSM 1787]
 gi|210152666|gb|EEA83672.1| hypothetical protein CLONEX_00420 [Clostridium nexile DSM 1787]
          Length = 508

 Score =  102 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S + + A QG++   ++V+  +S G     +VG     V E+ ER+++   ++GL+  
Sbjct: 1  MFSTVLSAALQGLQVEFIDVEADLSNGLPMFHMVGYLSSEVKEAGERVRTAIRNSGLV-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     D+
Sbjct: 59 ---IPAKKIVVNLSPADV 73


>gi|126728089|ref|ZP_01743905.1| competence protein ComM [Sagittula stellata E-37]
 gi|126711054|gb|EBA10104.1| competence protein ComM [Sagittula stellata E-37]
          Length = 319

 Score =  102 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++   T+AF+G++  PV+VQ  V+PG     IVGLPDKAV E+R+R+++         L
Sbjct: 1  MVAVAYTVAFEGVEARPVQVQCAVTPGVPAFSIVGLPDKAVSEARDRVRTALTS-----L 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     D+
Sbjct: 56 SIALPSKRITINLSPADM 73


>gi|154496283|ref|ZP_02034979.1| hypothetical protein BACCAP_00570 [Bacteroides capillosus ATCC
          29799]
 gi|150274366|gb|EDN01443.1| hypothetical protein BACCAP_00570 [Bacteroides capillosus ATCC
          29799]
          Length = 516

 Score =  102 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 35/76 (46%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+  + ++   G+ G  V  +  +S G     IVGLPD AV E+RER+++   + G  F 
Sbjct: 11 MLCEVRSLGLTGVAGYEVRAECDLSGGLPAFDIVGLPDAAVKEARERVRAAVKNCGFTF- 69

Query: 61 VNELPSIYLQLIYQKK 76
              P   + +     
Sbjct: 70 ----PVSRITVNLAPA 81


>gi|167036286|ref|YP_001671517.1| Mg chelatase subunit ChlI [Pseudomonas putida GB-1]
 gi|166862774|gb|ABZ01182.1| Mg chelatase, subunit ChlI [Pseudomonas putida GB-1]
          Length = 496

 Score =  102 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+  V ES++R++S  +++GL +  
Sbjct: 3  LALVHSRAQVGVQAPAVSVETHLANGLPHLTLVGLPETTVKESKDRVRSAIVNSGLNY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   +       DL
Sbjct: 61 ---PQRRITQNLAPADL 74


>gi|240849721|ref|YP_002971109.1| Mg chelatase-related protein [Bartonella grahamii as4aup]
 gi|240266844|gb|ACS50432.1| Mg chelatase-related protein [Bartonella grahamii as4aup]
          Length = 510

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 53/78 (67%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI+ ++T+AF+G++ +PV+VQVM+S G++G+ IVGL DKAV ESRER+Q+     GL   
Sbjct: 1  MIAHVTTVAFRGLEAVPVDVQVMISSGKIGMAIVGLADKAVAESRERVQAALHACGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 58 --SMPTKRITINLAPADL 73


>gi|85704117|ref|ZP_01035220.1| competence protein ComM [Roseovarius sp. 217]
 gi|85671437|gb|EAQ26295.1| competence protein ComM [Roseovarius sp. 217]
          Length = 504

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++   T+AF+G++  PVEVQ  ++ G     +VGLPDKAV E+R+R+++         +
Sbjct: 1  MVAHAYTVAFEGVEARPVEVQCAITAGVPAFSLVGLPDKAVSEARDRVRAALSA-----M 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     D+
Sbjct: 56 AIALPSKRITINLSPADM 73


>gi|225873585|ref|YP_002755044.1| putative Mg chelatase [Acidobacterium capsulatum ATCC 51196]
 gi|225791415|gb|ACO31505.1| putative Mg chelatase [Acidobacterium capsulatum ATCC 51196]
          Length = 531

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 8/81 (9%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPG---RVGVQIVGLPDKAVIESRERIQSHFIHAGL 57
          M+ +  + A  GI    ++V+V  S          +VGLPD AV ESR+R++S   ++G 
Sbjct: 1  MLFKALSAAVYGIDANIIDVEVDFSGVTTLESRFNMVGLPDAAVRESRDRVRSAIKNSGF 60

Query: 58 LFLVNELPSIYLQLIYQKKDL 78
               E+P+  + +     D+
Sbjct: 61 -----EIPTTNITINLAPADM 76


>gi|318040511|ref|ZP_07972467.1| Mg chelatase-like protein [Synechococcus sp. CB0101]
          Length = 547

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R S     G++   V V+V ++PG  G+Q+VGL D AV ESR+R+++   ++ L   
Sbjct: 1  MLARCSGATLVGLEARAVAVEVDIAPGLPGLQVVGLADAAVQESRQRVRAAIRNSQLR-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     DL
Sbjct: 59 ---MPLTRVVVNLAPADL 73


>gi|163735270|ref|ZP_02142705.1| Mg chelatase-related protein [Roseobacter litoralis Och 149]
 gi|161391484|gb|EDQ15818.1| Mg chelatase-related protein [Roseobacter litoralis Och 149]
          Length = 504

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S   ++AF+G++  PVEVQ  ++PG  G  IVGLPDKAV E++ER+++         + 
Sbjct: 6  VSLTYSVAFRGVEACPVEVQCALAPGLPGFSIVGLPDKAVSEAKERVRAALAS-----MA 60

Query: 62 NELPSIYLQLIYQKKDL 78
             PS  + +     DL
Sbjct: 61 IAFPSKKVTINLSPADL 77


>gi|332530422|ref|ZP_08406366.1| Mg chelatase-like protein [Hylemonella gracilis ATCC 19624]
 gi|332040134|gb|EGI76516.1| Mg chelatase-like protein [Hylemonella gracilis ATCC 19624]
          Length = 316

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 42/77 (54%), Gaps = 4/77 (5%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + + A +G++   V V+V ++PG     +VGL +  V E+RER+++  +H+GL+F  
Sbjct: 3  LSLVRSRALRGLEAAAVSVEVHLAPGLPSFTLVGLAETEVKEARERVRAALLHSGLVFPH 62

Query: 62 NELPSIYLQLIYQKKDL 78
                 + +     DL
Sbjct: 63 ----DRRITVNLAPADL 75


>gi|319790913|ref|YP_004152553.1| mg chelatase, subunit chli [Variovorax paradoxus EPS]
 gi|315593376|gb|ADU34442.1| Mg chelatase, subunit ChlI [Variovorax paradoxus EPS]
          Length = 513

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 4/77 (5%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S + + A  G++   V V+V ++ G     +VGL +  V ESR+R++S   +AGL F  
Sbjct: 3  LSLVQSRALLGLEAADVTVEVHLANGLPSFTLVGLAETEVKESRDRVRSAIQNAGLEFPN 62

Query: 62 NELPSIYLQLIYQKKDL 78
          N      + +     DL
Sbjct: 63 N----KKIVVSLAPADL 75


>gi|83313606|ref|YP_423870.1| ATPase with chaperone activity [Magnetospirillum magneticum
          AMB-1]
 gi|82948447|dbj|BAE53311.1| Predicted ATPase with chaperone activity [Magnetospirillum
          magneticum AMB-1]
          Length = 273

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/79 (40%), Positives = 46/79 (58%), Gaps = 5/79 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +R +T+AF GI  + ++VQV V+ G     +VGLPDKAV ESRER+++ F   GL   
Sbjct: 1  MTTRANTVAFSGIDCLDIDVQVQVAAGMPAFTLVGLPDKAVGESRERVRAAFNAIGL--- 57

Query: 61 VNELPSIYLQLIYQKKDLI 79
             LP   + +     DL+
Sbjct: 58 --ALPPKRITVNLAPADLL 74


>gi|26991915|ref|NP_747340.1| magnesium chelatase subunit D/I family protein [Pseudomonas
          putida KT2440]
 gi|24987039|gb|AAN70804.1|AE016724_3 magnesium chelatase, subunit D/I family [Pseudomonas putida
          KT2440]
          Length = 496

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+  V ES++R++S  +++GL +  
Sbjct: 3  LALVHSRAQVGVQAPAVSVETHLANGLPHLTLVGLPETTVKESKDRVRSAIVNSGLKY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   +       DL
Sbjct: 61 ---PQRRITQNLAPADL 74


>gi|161870669|ref|YP_001599842.1| competence protein ComM [Neisseria meningitidis 053442]
 gi|161596222|gb|ABX73882.1| competence protein ComM [Neisseria meningitidis 053442]
          Length = 485

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 5/66 (7%)

Query: 13 IKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSIYLQLI 72
          +    VEV+  ++ G     IVGLPD  V ESR+R+++  I +G      E P+  + + 
Sbjct: 1  MNAPLVEVEAHLANGLPHFNIVGLPDTEVKESRDRVRAAIIQSGF-----EFPAKKITVN 55

Query: 73 YQKKDL 78
              DL
Sbjct: 56 LAPADL 61


>gi|114764202|ref|ZP_01443440.1| competence protein ComM [Pelagibaca bermudensis HTCC2601]
 gi|114543354|gb|EAU46370.1| competence protein ComM [Roseovarius sp. HTCC2601]
          Length = 504

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +   T+AF+G++  PVEVQ  VS G     IVGLPDKAV E+RER+++         +
Sbjct: 1  MTAHAYTVAFEGVEARPVEVQCAVSAGVPAFAIVGLPDKAVSEARERVRAALTA-----M 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 56 AIALPSKRITVNLSPADL 73


>gi|49474869|ref|YP_032910.1| competence protein comM [Bartonella henselae str. Houston-1]
 gi|49237674|emb|CAF26860.1| Competence protein comM [Bartonella henselae str. Houston-1]
          Length = 510

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 55/78 (70%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI+ ++T+AF+G++ +PV+VQVM+S G++G+ IVGLPDKA+ ESRER+Q+ F   GL   
Sbjct: 1  MIACVTTVAFRGLEAVPVDVQVMISSGKIGMAIVGLPDKAIAESRERVQAAFHACGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 58 --SMPNKRVTINLAPADL 73


>gi|148550349|ref|YP_001270451.1| Mg chelatase subunit ChlI [Pseudomonas putida F1]
 gi|148514407|gb|ABQ81267.1| Mg chelatase, subunit ChlI [Pseudomonas putida F1]
          Length = 496

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+  V ES++R++S  +++GL +  
Sbjct: 3  LALVHSRAQVGVQAPAVSVETHLANGLPHLTLVGLPETTVKESKDRVRSAIVNSGLKY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   +       DL
Sbjct: 61 ---PQRRITQNLAPADL 74


>gi|104784286|ref|YP_610784.1| magnesium chelatase subunit D [Pseudomonas entomophila L48]
 gi|95113273|emb|CAK18001.1| putative magnesium chelatase subunit D [Pseudomonas entomophila
          L48]
          Length = 495

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+   PV V+  ++ G   + +VGLP+  V ES++R++S  +++GL +  
Sbjct: 3  LALVHSRAQVGVLAPPVSVETHLANGLPTLTLVGLPEATVKESKDRVRSAIVNSGLDY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  +       DL
Sbjct: 61 ---PARRITQNLAPADL 74


>gi|146279086|ref|YP_001169245.1| Mg chelatase, subunit ChlI [Rhodobacter sphaeroides ATCC 17025]
 gi|145557327|gb|ABP71940.1| Mg chelatase, subunit ChlI [Rhodobacter sphaeroides ATCC 17025]
          Length = 509

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI+R  T+AF+G+    VEVQ  VSPG     IVGL DKAV E+RER+++         +
Sbjct: 1  MIARAFTVAFEGVDPRSVEVQCAVSPGLPAFAIVGLADKAVSEARERVRTALAA-----M 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LPS  + +     DL
Sbjct: 56 SIALPSRRITVNLSPADL 73


>gi|170719422|ref|YP_001747110.1| Mg chelatase subunit ChlI [Pseudomonas putida W619]
 gi|169757425|gb|ACA70741.1| Mg chelatase, subunit ChlI [Pseudomonas putida W619]
          Length = 496

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+  V ES++R++S  +++GL +  
Sbjct: 3  LALVHSRAQVGVQAPAVSVETHLANGLPHLTLVGLPETTVKESKDRVRSAIVNSGLNY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   +       DL
Sbjct: 61 ---PQRRITQNLAPADL 74


>gi|282898311|ref|ZP_06306302.1| Mg chelatase-related protein [Raphidiopsis brookii D9]
 gi|281196842|gb|EFA71747.1| Mg chelatase-related protein [Raphidiopsis brookii D9]
          Length = 511

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 45/79 (56%), Gaps = 6/79 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPG-RVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M+SR+ + +  GI  + V V+V +S G   G+ I+GLPD A+ ES+ER+++   +AG   
Sbjct: 1  MLSRVWSASIVGIDAVKVGVEVDISGGGLPGIIILGLPDSAIQESKERVKATLRNAGFN- 59

Query: 60 LVNELPSIYLQLIYQKKDL 78
              +P+  + +     DL
Sbjct: 60 ----VPARKIVINLTPADL 74


>gi|319407913|emb|CBI81567.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 510

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 55/78 (70%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R++TIAF+G++ IPV+VQVM++PGR+G+ IVGL DKA+ ESRER+Q+     GL   
Sbjct: 1  MVARVTTIAFRGLEAIPVDVQVMIAPGRIGMAIVGLADKAIAESRERVQAALHACGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 58 --SMPNKRVTINLAPADL 73


>gi|323138791|ref|ZP_08073855.1| Mg chelatase, subunit ChlI [Methylocystis sp. ATCC 49242]
 gi|322395939|gb|EFX98476.1| Mg chelatase, subunit ChlI [Methylocystis sp. ATCC 49242]
          Length = 512

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 49/78 (62%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  R++T+AF+G++  PV+VQV ++ G V   +VGL DKAV ESRER+++  I +GL   
Sbjct: 1  MAVRVATVAFEGVEARPVDVQVQITSGSVVFNVVGLGDKAVAESRERVRAALIASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     D+
Sbjct: 58 --ALPAKRITVNLAPADM 73


>gi|268610489|ref|ZP_06144216.1| ATPase with chaperone activity [Ruminococcus flavefaciens FD-1]
          Length = 510

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +++S++   G+    V+V++ +S G     IVGLPD  V ESRERI+S      + F 
Sbjct: 1  MFAKVSSLGLFGLNAFQVDVEIDISRGNPQFDIVGLPDTVVRESRERIRSALRSCNINF- 59

Query: 61 VNELPSIYLQLIYQKKD 77
              P   + +     D
Sbjct: 60 ----PVAQVMVNLAPAD 72


>gi|94496285|ref|ZP_01302863.1| Mg chelatase-related protein [Sphingomonas sp. SKA58]
 gi|94424464|gb|EAT09487.1| Mg chelatase-related protein [Sphingomonas sp. SKA58]
          Length = 502

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ +ST+A+ G++   VEVQ  + PG     +VGLPDKAV ESRER+++     GL   
Sbjct: 1  MVATVSTVAYLGLEARAVEVQCQLVPGLPNFILVGLPDKAVAESRERVRNAIAAIGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 58 --SLPPKRITVNLSPADL 73


>gi|258542286|ref|YP_003187719.1| magnesium chelatase-related protein [Acetobacter pasteurianus IFO
          3283-01]
 gi|256633364|dbj|BAH99339.1| magnesium chelatase-related protein [Acetobacter pasteurianus IFO
          3283-01]
 gi|256636423|dbj|BAI02392.1| magnesium chelatase-related protein [Acetobacter pasteurianus IFO
          3283-03]
 gi|256639476|dbj|BAI05438.1| magnesium chelatase-related protein [Acetobacter pasteurianus IFO
          3283-07]
 gi|256642532|dbj|BAI08487.1| magnesium chelatase-related protein [Acetobacter pasteurianus IFO
          3283-22]
 gi|256645587|dbj|BAI11535.1| magnesium chelatase-related protein [Acetobacter pasteurianus IFO
          3283-26]
 gi|256648640|dbj|BAI14581.1| magnesium chelatase-related protein [Acetobacter pasteurianus IFO
          3283-32]
 gi|256651693|dbj|BAI17627.1| magnesium chelatase-related protein [Acetobacter pasteurianus IFO
          3283-01-42C]
 gi|256654684|dbj|BAI20611.1| magnesium chelatase-related protein [Acetobacter pasteurianus IFO
          3283-12]
          Length = 503

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 43/76 (56%), Gaps = 5/76 (6%)

Query: 3  SRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVN 62
          SRI + AF GI+  PV V+V +S G     +VGLPDKAV E+RER+++     GL     
Sbjct: 10 SRIRSFAFCGIEARPVWVEVQISSGLPAFLMVGLPDKAVAEARERVRAALTSIGL----- 64

Query: 63 ELPSIYLQLIYQKKDL 78
           LP+  + +     D+
Sbjct: 65 ALPAKRILVNLVPADI 80


>gi|113460477|ref|YP_718539.1| competence-like protein [Haemophilus somnus 129PT]
 gi|170718322|ref|YP_001783553.1| Mg chelatase, subunit ChlI [Haemophilus somnus 2336]
 gi|112822520|gb|ABI24609.1| competence-related protein [Haemophilus somnus 129PT]
 gi|168826451|gb|ACA31822.1| Mg chelatase, subunit ChlI [Haemophilus somnus 2336]
          Length = 509

 Score =  101 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V ++V +S G+    +VGLP+K V E++ R++S  ++A   +  
Sbjct: 3  LAVVYSRASMGVQAPLVTIEVHLSNGKPAFTLVGLPEKTVTEAQGRVRSALLNAQFKY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PAKRITVNLAPADL 74


>gi|21244650|ref|NP_644232.1| competence-like protein [Xanthomonas axonopodis pv. citri str.
          306]
 gi|21110335|gb|AAM38768.1| competence related protein [Xanthomonas axonopodis pv. citri str.
          306]
          Length = 356

 Score =  101 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V +S G    QIVGLP+ AV ESRER+++  + A      
Sbjct: 3  LALVHSRARVGVHAPEVRVEVHLSGGLPSTQIVGLPEAAVRESRERVRAALLCAQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EFPARRITINLAPADL 74


>gi|78067666|ref|YP_370435.1| magnesium chelatase, ChlI subunit [Burkholderia sp. 383]
 gi|77968411|gb|ABB09791.1| Magnesium chelatase, ChlI subunit [Burkholderia sp. 383]
          Length = 349

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPASGRAPDVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|167917371|ref|ZP_02504462.1| Mg chelatase, subunit D/I family protein [Burkholderia
          pseudomallei BCC215]
          Length = 155

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|110678522|ref|YP_681529.1| Mg chelatase-related protein [Roseobacter denitrificans OCh 114]
 gi|109454638|gb|ABG30843.1| Mg chelatase-related protein [Roseobacter denitrificans OCh 114]
          Length = 499

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 42/74 (56%), Gaps = 5/74 (6%)

Query: 5  ISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNEL 64
            ++AF+G++  PVEVQ  ++PG  G  IVGLPDKAV E++ER+++         +    
Sbjct: 4  TYSVAFRGVEACPVEVQCALAPGLPGFSIVGLPDKAVSEAKERVRAALAS-----MAIAF 58

Query: 65 PSIYLQLIYQKKDL 78
          PS  + +     DL
Sbjct: 59 PSKKVTINLSPADL 72


>gi|329113450|ref|ZP_08242231.1| Putative protein YifB [Acetobacter pomorum DM001]
 gi|326697275|gb|EGE48935.1| Putative protein YifB [Acetobacter pomorum DM001]
          Length = 503

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 43/76 (56%), Gaps = 5/76 (6%)

Query: 3  SRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVN 62
          SRI + AF GI+  PV V+V +S G     +VGLPDKAV E+RER+++     GL     
Sbjct: 10 SRIRSFAFCGIEARPVWVEVQISSGLPAFLMVGLPDKAVAEARERVRAALTSIGL----- 64

Query: 63 ELPSIYLQLIYQKKDL 78
           LP+  + +     D+
Sbjct: 65 ALPAKRILVNLVPADI 80


>gi|145220223|ref|YP_001130932.1| Mg chelatase, subunit ChlI [Prosthecochloris vibrioformis DSM
          265]
 gi|145206387|gb|ABP37430.1| Mg chelatase, subunit ChlI [Chlorobium phaeovibrioides DSM 265]
          Length = 515

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ +   A  GI  + V V++ V+ G     +VGLPD A+ ESRERI +   ++G    
Sbjct: 1  MLTTLFAAALIGIDAMKVTVEINVAAGLPSFTVVGLPDSAIRESRERILTAIRNSGFRPK 60

Query: 61 VNELPSIYLQLIYQKKDL 78
                  + +     D+
Sbjct: 61 -----PKKITINLAPADI 73


>gi|260425258|ref|ZP_05779238.1| putative Mg chelatase family protein [Citreicella sp. SE45]
 gi|260423198|gb|EEX16448.1| putative Mg chelatase family protein [Citreicella sp. SE45]
          Length = 508

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 29/77 (37%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++   T+AF+G+   PVEVQ  V+ G  G  IVGLPDKAV E+RER+++   +     + 
Sbjct: 6  VAHAYTVAFEGVDARPVEVQCAVTAGVPGFAIVGLPDKAVSEARERVRAALSN-----MS 60

Query: 62 NELPSIYLQLIYQKKDL 78
            +PS  + +     DL
Sbjct: 61 IAMPSKRITVNLSPADL 77


>gi|160933811|ref|ZP_02081199.1| hypothetical protein CLOLEP_02672 [Clostridium leptum DSM 753]
 gi|156867688|gb|EDO61060.1| hypothetical protein CLOLEP_02672 [Clostridium leptum DSM 753]
          Length = 505

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 5/71 (7%)

Query: 8  IAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSI 67
          +   G +   VEV+  +        +VGLPD AV ESRER+++   + G  +     P+ 
Sbjct: 1  MGLYGAEAFLVEVECDIGRSLPAFDLVGLPDAAVKESRERVRAALKNCGFDY-----PTG 55

Query: 68 YLQLIYQKKDL 78
           + +     D+
Sbjct: 56 RITVNLAPADI 66


>gi|291533376|emb|CBL06489.1| hypothetical protein MHY_17030 [Megamonas hypermegale ART12/1]
          Length = 172

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M ++       GI G+ +EV+  V+ G    +IVGL D AV E++ER++    +      
Sbjct: 1  MFAKTYGATTLGIDGVLIEVEADVANGLPKFEIVGLADVAVKEAKERVRPAIRNT----- 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             L    + +     DL
Sbjct: 56 NVNLVPKKVTINLAPADL 73


>gi|212704107|ref|ZP_03312235.1| hypothetical protein DESPIG_02162 [Desulfovibrio piger ATCC
          29098]
 gi|212672467|gb|EEB32950.1| hypothetical protein DESPIG_02162 [Desulfovibrio piger ATCC
          29098]
          Length = 526

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 6/77 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSP-GRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M+ R+ +   +G+   PV+V+V +   G  G  +VGL + AV E+RER+ S     G   
Sbjct: 19 MVIRLYSAGLEGVDAFPVDVEVDLVRQGLPGFTLVGLAEAAVREARERVFSALRACGFR- 77

Query: 60 LVNELPSIYLQLIYQKK 76
              LP   + +     
Sbjct: 78 ----LPPSRITVNLAPA 90


>gi|144897969|emb|CAM74833.1| Mg chelatase-related protein [Magnetospirillum gryphiswaldense
          MSR-1]
          Length = 503

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 32/79 (40%), Positives = 44/79 (55%), Gaps = 5/79 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +   TIAF GI  + ++VQV ++ G     IVGLPDKAV ESRER+++ F   GL   
Sbjct: 1  MTAHAPTIAFAGIDCLDIDVQVQIANGLPAFTIVGLPDKAVGESRERVRAAFNSLGL--- 57

Query: 61 VNELPSIYLQLIYQKKDLI 79
             LP   + +     DL+
Sbjct: 58 --SLPPKRITVNLAPADLL 74


>gi|215428338|ref|ZP_03426257.1| magnesium chelatase, putative [Mycobacterium tuberculosis T92]
 gi|289751562|ref|ZP_06510940.1| conserved hypothetical protein [Mycobacterium tuberculosis T92]
 gi|289692149|gb|EFD59578.1| conserved hypothetical protein [Mycobacterium tuberculosis T92]
          Length = 224

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  ++A +G+ G  VE++  ++ G  GV +VGLPD A+ ESR+R+++   + G     
Sbjct: 3  LGRAFSVAVRGLDGEIVEIEADITSGLPGVHLVGLPDAALQESRDRVRAAVTNCG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
          N  P   L L      L
Sbjct: 58 NSWPMARLTLALSPATL 74


>gi|17988278|ref|NP_540912.1| Mg(2+) chelatase family protein [Brucella melitensis bv. 1 str.
          16M]
 gi|256045739|ref|ZP_05448617.1| Mg chelatase-related protein [Brucella melitensis bv. 1 str.
          Rev.1]
 gi|17984048|gb|AAL53176.1| mg(2+) chelatase family protein [Brucella melitensis bv. 1 str.
          16M]
          Length = 151

 Score =  101 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 55/78 (70%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AF GI+ +PV+VQVM++PG++G+ IVGLPDKAV ESRER+Q+    +GL   
Sbjct: 12 MVARVGTVAFHGIEAVPVDVQVMIAPGKMGMSIVGLPDKAVAESRERVQAALHASGL--- 68

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 69 --SMPAKRVTVNLAPADL 84


>gi|291544236|emb|CBL17345.1| Mg chelatase-related protein [Ruminococcus sp. 18P13]
          Length = 509

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M ++++++   G+    V+V++ +S G+   ++VGLPD AV ESRERI+S     G+ F 
Sbjct: 1  MFAQVNSLGLFGMNAFAVQVEIDISRGQPMFEVVGLPDAAVRESRERIKSALRACGVAF- 59

Query: 61 VNELPSIYLQLIYQKKD 77
              P   + +     +
Sbjct: 60 ----PVARVMVNLAPAN 72


>gi|254522041|ref|ZP_05134096.1| putative Mg chelatase [Stenotrophomonas sp. SKA14]
 gi|219719632|gb|EED38157.1| putative Mg chelatase [Stenotrophomonas sp. SKA14]
          Length = 499

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V +S G    QIVGL + +V ESRER+++  + A   F  
Sbjct: 3  LALVYSRARAGVDAPLVRVEVHLSGGLPATQIVGLAETSVRESRERVRAALLCARFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + L     DL
Sbjct: 61 ---PQRRITLNLAPADL 74


>gi|254295444|ref|YP_003061467.1| Mg chelatase, subunit ChlI [Hirschia baltica ATCC 49814]
 gi|254043975|gb|ACT60770.1| Mg chelatase, subunit ChlI [Hirschia baltica ATCC 49814]
          Length = 512

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+SR +T AF+G+   PV+VQV +  G+    IVGL DKAV ES+ER+++ F   GL F 
Sbjct: 1  MVSRTTTFAFEGVTANPVDVQVQLFNGQPHFAIVGLADKAVAESKERVRAAFAALGLSF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PPKRIVVNLAPADL 73


>gi|326386345|ref|ZP_08207968.1| Mg chelatase-related protein [Novosphingobium nitrogenifigens DSM
          19370]
 gi|326209006|gb|EGD59800.1| Mg chelatase-related protein [Novosphingobium nitrogenifigens DSM
          19370]
          Length = 501

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ ++T+A+ G+    VEVQ  +S G    ++VGLPDKAV ESRER+ S     GL   
Sbjct: 1  MVAVVATVAYLGLDARSVEVQCQLSAGLPSFRVVGLPDKAVGESRERVHSALAAMGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 58 --SLPPKRITVNLSPADL 73


>gi|254491929|ref|ZP_05105108.1| Mg chelatase family protein [Methylophaga thiooxidans DMS010]
 gi|224463407|gb|EEF79677.1| Mg chelatase family protein [Methylophaga thiooxydans DMS010]
          Length = 493

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 35/69 (50%), Gaps = 5/69 (7%)

Query: 10 FQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSIYL 69
            G++   V V+V +S G   + IVG+ + AV ES++R++S  +++   F     P   +
Sbjct: 1  MTGVEAQAVTVEVHLSNGLPSLSIVGMAETAVKESKDRVRSALLNSHFTF-----PQQRI 55

Query: 70 QLIYQKKDL 78
           +     DL
Sbjct: 56 TINLAPADL 64


>gi|149190462|ref|ZP_01868733.1| ComM-related protein [Vibrio shilonii AK1]
 gi|148835716|gb|EDL52682.1| ComM-related protein [Vibrio shilonii AK1]
          Length = 101

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 5/72 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S I + A  G++   V V+V +S G  G  +VGLP+  V ES++R++S  I++      
Sbjct: 3  LSIIYSRASVGVEAPLVTVEVHISNGMPGFTLVGLPETTVKESKDRVRSAIINSRF---- 58

Query: 62 NELPSIYLQLIY 73
           E P+  +    
Sbjct: 59 -EFPAKRITDNL 69


>gi|260886410|ref|ZP_05897673.1| Mg chelatase-like protein [Selenomonas sputigena ATCC 35185]
 gi|330838824|ref|YP_004413404.1| Mg chelatase, subunit ChlI [Selenomonas sputigena ATCC 35185]
 gi|260863857|gb|EEX78357.1| Mg chelatase-like protein [Selenomonas sputigena ATCC 35185]
 gi|329746588|gb|AEB99944.1| Mg chelatase, subunit ChlI [Selenomonas sputigena ATCC 35185]
          Length = 509

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M ++       G+ G  ++V+V VS G     IVGL D AV ESRER+++   + G    
Sbjct: 1  MFAKSYGAVTFGVDGRIIDVEVDVSYGFPAFDIVGLLDTAVKESRERVRTAIKNTG---- 56

Query: 61 VNELPSIYLQLIYQKKDL 78
            +L    + +     D+
Sbjct: 57 -VKLKPARVTINLAPADI 73


>gi|224373736|ref|YP_002608108.1| putative Mg chelatase homolog [Nautilia profundicola AmH]
 gi|223588671|gb|ACM92407.1| putative Mg chelatase homolog [Nautilia profundicola AmH]
          Length = 491

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 5/74 (6%)

Query: 5  ISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNEL 64
          I++   +G +   VEV+   + G  G  IVGL  +A+ ES+ERI+S  ++        E 
Sbjct: 12 INSATLEGFEAQKVEVESSFTKGLPGFAIVGLGSQAIQESKERIKSALLNNDF-----EF 66

Query: 65 PSIYLQLIYQKKDL 78
          P + + +     DL
Sbjct: 67 PPLKITINLAPADL 80


>gi|294085195|ref|YP_003551955.1| Mg chelatase-like protein [Candidatus Puniceispirillum marinum
          IMCC1322]
 gi|292664770|gb|ADE39871.1| Mg chelatase-related protein [Candidatus Puniceispirillum marinum
          IMCC1322]
          Length = 512

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 45/79 (56%), Gaps = 5/79 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M + I T+AF+GI  I V+VQV ++ G   + IVGL DK+V ES+ER+++     GL   
Sbjct: 11 MHAHIQTVAFRGIDTIAVDVQVHIANGLPAMAIVGLADKSVAESKERVRAALSSIGL--- 67

Query: 61 VNELPSIYLQLIYQKKDLI 79
             LP   + +     D++
Sbjct: 68 --SLPPKRIAINLAPADVL 84


>gi|319404953|emb|CBI78555.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 510

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 53/78 (67%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ I+T+AF+G++ IPV+VQVM+S G++G+ IVGL DKAV ESRERIQ+     GL   
Sbjct: 1  MVAHITTVAFRGLEAIPVDVQVMISSGKIGMAIVGLADKAVAESRERIQAALHACGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 58 --SMPNKRVTVNLAPADL 73


>gi|313672191|ref|YP_004050302.1| mg chelatase, subunit chli [Calditerrivibrio nitroreducens DSM
          19672]
 gi|312938947|gb|ADR18139.1| Mg chelatase, subunit ChlI [Calditerrivibrio nitroreducens DSM
          19672]
          Length = 511

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 23/79 (29%), Positives = 37/79 (46%), Gaps = 6/79 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSP-GRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M S++ T    GI  + V+V+V +   G     +VGL + AV ES+ER++S   +    F
Sbjct: 1  MFSKVLTFHLVGIDAVLVDVEVDIREMGLPSFTVVGLAEGAVKESKERVKSALKNLNFNF 60

Query: 60 LVNELPSIYLQLIYQKKDL 78
                S  + L     D+
Sbjct: 61 F-----SKPITLNLAPADI 74


>gi|319403527|emb|CBI77108.1| conserved hypothetical protein [Bartonella rochalimae ATCC
          BAA-1498]
          Length = 510

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 53/78 (67%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ ++T+AF+G++ IPV+VQVM+S G++G+ IVGL DKAV ESRERIQ+     GL   
Sbjct: 1  MVAHVTTVAFRGLEAIPVDVQVMISSGKIGMAIVGLADKAVAESRERIQAALHACGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 58 --SMPNKRVTVNLAPADL 73


>gi|194367554|ref|YP_002030164.1| Mg chelatase subunit ChlI [Stenotrophomonas maltophilia R551-3]
 gi|194350358|gb|ACF53481.1| Mg chelatase, subunit ChlI [Stenotrophomonas maltophilia R551-3]
          Length = 499

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V +S G    QIVGL + +V ESRER+++  + A   F  
Sbjct: 3  LALVHSRARAGVDAPLVRVEVHLSGGLPATQIVGLAETSVRESRERVRAALLCARFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + L     DL
Sbjct: 61 ---PQRRITLNLAPADL 74


>gi|121999182|ref|YP_001003969.1| Mg chelatase subunit ChlI [Halorhodospira halophila SL1]
 gi|121590587|gb|ABM63167.1| Mg chelatase, subunit ChlI [Halorhodospira halophila SL1]
          Length = 503

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++     A  G+    V+V+V ++PG     +VGLP   V E+R+R++S  I++GL    
Sbjct: 3  LAVTRARAALGVAAPEVQVEVHLAPGLPAFSLVGLPQAEVREARDRVRSAIINSGL---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVGRVTVNLAPADL 74


>gi|157827341|ref|YP_001496405.1| Mg chelatase-related protein [Rickettsia bellii OSU 85-389]
 gi|157802645|gb|ABV79368.1| Mg chelatase-related protein [Rickettsia bellii OSU 85-389]
          Length = 504

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 43/79 (54%), Gaps = 5/79 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI  I+++ F GI    V+VQV +SPG     IVGL DK + ES+ER+++     GL   
Sbjct: 1  MIIHIASLTFNGIDITDVDVQVQISPGIPAFTIVGLADKTIAESKERVKAALSSIGL--- 57

Query: 61 VNELPSIYLQLIYQKKDLI 79
             LP+  + +     DL+
Sbjct: 58 --ALPTKKILINLAPADLV 74


>gi|108798954|ref|YP_639151.1| Mg chelatase-related protein [Mycobacterium sp. MCS]
 gi|119868069|ref|YP_938021.1| Mg chelatase, subunit ChlI [Mycobacterium sp. KMS]
 gi|126434554|ref|YP_001070245.1| Mg chelatase, subunit ChlI [Mycobacterium sp. JLS]
 gi|108769373|gb|ABG08095.1| Mg chelatase-related protein [Mycobacterium sp. MCS]
 gi|119694158|gb|ABL91231.1| Mg chelatase, subunit ChlI [Mycobacterium sp. KMS]
 gi|126234354|gb|ABN97754.1| Mg chelatase, subunit ChlI [Mycobacterium sp. JLS]
          Length = 503

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  ++A  G+ G+ VE++  +S G  GV +VGLPD A+ ESR+R+++   + G     
Sbjct: 3  LGRAFSVAVLGLDGVIVEIEADISSGLPGVHLVGLPDAALQESRDRVRAAITNCG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   L L      L
Sbjct: 58 AEWPMSRLTLALSPATL 74


>gi|87198301|ref|YP_495558.1| Mg chelatase-related protein [Novosphingobium aromaticivorans DSM
          12444]
 gi|87133982|gb|ABD24724.1| Mg chelatase-related protein [Novosphingobium aromaticivorans DSM
          12444]
          Length = 502

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ +ST+A+ G++   VEVQ  V+PG    ++VGLPDKAV ESRER+ S     GL   
Sbjct: 1  MVALVSTVAYLGLEARGVEVQCQVAPGLPAFRVVGLPDKAVGESRERVSSALSALGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 58 --ALPPKRITVNLSPADL 73


>gi|167585344|ref|ZP_02377732.1| Mg chelatase, subunit ChlI [Burkholderia ubonensis Bu]
          Length = 194

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPAAGRAPDVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|91205630|ref|YP_537985.1| Mg chelatase-related protein [Rickettsia bellii RML369-C]
 gi|91069174|gb|ABE04896.1| Mg chelatase-related protein [Rickettsia bellii RML369-C]
          Length = 502

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 43/79 (54%), Gaps = 5/79 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI  I+++ F GI    V+VQV +SPG     IVGL DK + ES+ER+++     GL   
Sbjct: 1  MIIHIASLTFNGIDITDVDVQVQISPGIPAFTIVGLADKTIAESKERVKAALSSIGL--- 57

Query: 61 VNELPSIYLQLIYQKKDLI 79
             LP+  + +     DL+
Sbjct: 58 --ALPTKKILINLAPADLV 74


>gi|119386668|ref|YP_917723.1| Mg chelatase, subunit ChlI [Paracoccus denitrificans PD1222]
 gi|119377263|gb|ABL72027.1| Mg chelatase, subunit ChlI [Paracoccus denitrificans PD1222]
          Length = 510

 Score =  100 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +   T+AF G++   VEVQ  VSPG  G  IVGLPDK+V E+RER+++         L
Sbjct: 7  MAAIAYTVAFDGVEARLVEVQCSVSPGLPGFGIVGLPDKSVSEARERVKAA-----FGAL 61

Query: 61 VNELPSIYLQLIYQKKDL 78
             +PS  + +     DL
Sbjct: 62 SIAMPSRRVTVNLSPADL 79


>gi|167717896|ref|ZP_02401132.1| Mg chelatase-related protein [Burkholderia pseudomallei DM98]
          Length = 136

 Score =  100 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|285017176|ref|YP_003374887.1| competence related protein [Xanthomonas albilineans GPE PC73]
 gi|283472394|emb|CBA14899.1| hypothetical competence related protein [Xanthomonas albilineans]
          Length = 518

 Score =  100 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+   PV V+V +S G    QIVGLP+ AV ESR+R+++  + A   F  
Sbjct: 3  LALVHSRARAGVLAPPVRVEVHLSGGLPATQIVGLPEAAVRESRDRVRAAILCAQYAF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PARRITVNLAPADL 74


>gi|307609385|emb|CBW98873.1| hypothetical protein LPW_06611 [Legionella pneumophila 130b]
          Length = 503

 Score =  100 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++   T +  GI   P  V+V +S G     +VGL + AV ES++R++S  I++      
Sbjct: 3  LAFTKTRSTIGIVAQPASVEVHLSNGLPSFTMVGLAETAVKESKDRVRSAIINSQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     +L
Sbjct: 59 -EFPCRKITVNLGPANL 74


>gi|218680983|ref|ZP_03528880.1| putative Mg2+ chelatase family protein [Rhizobium etli CIAT 894]
          Length = 134

 Score =  100 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 59/78 (75%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ST+AFQGI+G+PVEVQVMV+PG++G+QIVGLPDKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVSTVAFQGIEGVPVEVQVMVAPGKIGMQIVGLPDKAVAESRERVQAALHASGLT-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 59 ---LPAKRVTVNLAPADL 73


>gi|187922530|ref|YP_001894172.1| Mg chelatase, subunit ChlI [Burkholderia phytofirmans PsJN]
 gi|187713724|gb|ACD14948.1| Mg chelatase, subunit ChlI [Burkholderia phytofirmans PsJN]
          Length = 532

 Score =  100 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   +    F  
Sbjct: 3  LAVVRSRAPASGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCNFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PVRRITVNLAPADL 74


>gi|296116222|ref|ZP_06834840.1| Mg chelatase, subunit ChlI [Gluconacetobacter hansenii ATCC
          23769]
 gi|295977328|gb|EFG84088.1| Mg chelatase, subunit ChlI [Gluconacetobacter hansenii ATCC
          23769]
          Length = 504

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I   AF GI   PV+V+V +S G     IVGLPDKAV ESRER+++     GL    
Sbjct: 6  LACIHGFAFCGIDATPVKVEVQLSTGLPSFLIVGLPDKAVAESRERVRAALSAMGL---- 61

Query: 62 NELPSIYLQLIYQKKDL 78
            LP+  + +     +L
Sbjct: 62 -ALPAKRIVVNLAPANL 77


>gi|307728328|ref|YP_003905552.1| Mg chelatase subunit ChlI [Burkholderia sp. CCGE1003]
 gi|307582863|gb|ADN56261.1| Mg chelatase, subunit ChlI [Burkholderia sp. CCGE1003]
          Length = 580

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   +    F  
Sbjct: 3  LAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCNFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PVRRITVNLAPADL 74


>gi|190576200|ref|YP_001974045.1| putative magnesium chelatase [Stenotrophomonas maltophilia K279a]
 gi|190014122|emb|CAQ47761.1| putative magnesium chelatase [Stenotrophomonas maltophilia K279a]
          Length = 499

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V +S G    QIVGL + +V ESRER+++  + A   F  
Sbjct: 3  LALVHSRARAGVDAPLVRVEVHLSGGLPVTQIVGLAETSVRESRERVRAALLCARFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + L     DL
Sbjct: 61 ---PQRRITLNLAPADL 74


>gi|307294966|ref|ZP_07574808.1| Mg chelatase, subunit ChlI [Sphingobium chlorophenolicum L-1]
 gi|306879440|gb|EFN10658.1| Mg chelatase, subunit ChlI [Sphingobium chlorophenolicum L-1]
          Length = 502

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S +ST+A+ G++   VEVQ  + PG     +VGLPDKAV ESRER+++     GL   
Sbjct: 1  MVSTVSTVAYLGLEARGVEVQCQLVPGLPNFIVVGLPDKAVAESRERVRNAIAAIGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 58 --SLPPKRITVNLSPADL 73


>gi|167568613|ref|ZP_02361487.1| Mg chelatase-related protein [Burkholderia oklahomensis C6786]
          Length = 179

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|303247967|ref|ZP_07334234.1| Mg chelatase, subunit ChlI [Desulfovibrio fructosovorans JJ]
 gi|302490691|gb|EFL50594.1| Mg chelatase, subunit ChlI [Desulfovibrio fructosovorans JJ]
          Length = 512

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 39/78 (50%), Gaps = 6/78 (7%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSP-GRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          +S I T A  G+   PV ++V ++  G     +VGL + AV ES+ER+ +   +AGL   
Sbjct: 3  LSTIRTAALLGVDAYPVTLEVDLARQGMPSFTMVGLAEGAVRESKERVFAALKNAGLR-- 60

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     D+
Sbjct: 61 ---LPPARITVNLAPADM 75


>gi|103485519|ref|YP_615080.1| Mg chelatase-related protein [Sphingopyxis alaskensis RB2256]
 gi|98975596|gb|ABF51747.1| Mg chelatase-related protein [Sphingopyxis alaskensis RB2256]
          Length = 502

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ +ST A+ GI+   VEVQ  ++PG     +VGLPDKAV ESRER+++     GL   
Sbjct: 1  MVAIVSTAAYLGIEARGVEVQCQITPGVPRFVLVGLPDKAVGESRERVRAAIAAIGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 58 --SLPPKVITVNLSPADL 73


>gi|148241449|ref|YP_001226606.1| ATPase with chaperone activity [Synechococcus sp. RCC307]
 gi|147849759|emb|CAK27253.1| Predicted ATPase with chaperone activity [Synechococcus sp.
          RCC307]
          Length = 521

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++     A  G++  PV V+V ++PG  G Q+VGL D +  ++RER++S   ++G    
Sbjct: 1  MLAFCGAAALLGLEAHPVAVEVDLAPGLPGFQLVGLSDASGRDARERVRSALRNSGFRP- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PQSRVVVSLAPADL 73


>gi|91781654|ref|YP_556860.1| Mg chelatase-related protein [Burkholderia xenovorans LB400]
 gi|91685608|gb|ABE28808.1| Mg chelatase-related protein [Burkholderia xenovorans LB400]
          Length = 529

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   +    F  
Sbjct: 3  LAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCNFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PVRRITVNLAPADL 74


>gi|167561385|ref|ZP_02354301.1| Mg chelatase-related protein [Burkholderia oklahomensis EO147]
          Length = 168

 Score =  100 bits (250), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|121602697|ref|YP_989592.1| Mg chelatase-like protein [Bartonella bacilliformis KC583]
 gi|120614874|gb|ABM45475.1| Mg chelatase homolog [Bartonella bacilliformis KC583]
          Length = 510

 Score =  100 bits (250), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 53/78 (67%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI+ ++T+AF+G++ IPV+VQVM+S G++G+ IVGL DKA+ ESRER+Q+     GL   
Sbjct: 1  MIACVTTVAFRGLEAIPVDVQVMISSGKIGMAIVGLADKAIAESRERVQAALYACGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 58 --SMPNKRVTINLAPADL 73


>gi|282899606|ref|ZP_06307570.1| Mg chelatase-related protein [Cylindrospermopsis raciborskii
          CS-505]
 gi|281195485|gb|EFA70418.1| Mg chelatase-related protein [Cylindrospermopsis raciborskii
          CS-505]
          Length = 511

 Score =  100 bits (250), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 44/79 (55%), Gaps = 6/79 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPG-RVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M+SR+ + +  GI  + V V+V +S G   G+ I+GLPD A+ ES+ER+++   +AG   
Sbjct: 1  MLSRVWSASIVGIDAVKVGVEVDISGGGLPGIIILGLPDSAIQESKERVKATLRNAGFN- 59

Query: 60 LVNELPSIYLQLIYQKKDL 78
              +P   + +     DL
Sbjct: 60 ----VPVRKIVINLTPADL 74


>gi|294010579|ref|YP_003544039.1| magnesium chelatase family protein [Sphingobium japonicum UT26S]
 gi|292673909|dbj|BAI95427.1| magnesium chelatase family protein [Sphingobium japonicum UT26S]
          Length = 502

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S +ST+A+ G++   VEVQ  + PG     +VGLPDKAV ESRER+++     GL   
Sbjct: 1  MVSTVSTVAYLGLEARGVEVQCQLVPGLPNFIVVGLPDKAVAESRERVRNAIAAIGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 58 --SLPPKRITVNLSPADL 73


>gi|254694755|ref|ZP_05156583.1| Mg chelatase-related protein [Brucella abortus bv. 3 str. Tulya]
 gi|261215081|ref|ZP_05929362.1| Mg chelatase [Brucella abortus bv. 3 str. Tulya]
 gi|260916688|gb|EEX83549.1| Mg chelatase [Brucella abortus bv. 3 str. Tulya]
          Length = 510

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 55/78 (70%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AF+GI+ +PV+VQVM++PG++G+ IV LPDKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVGTVAFRGIEAVPVDVQVMIAPGKMGMSIVRLPDKAVAESRERVQAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 58 --SMPAKRVTVNLAPADL 73


>gi|225574887|ref|ZP_03783497.1| hypothetical protein RUMHYD_02965 [Blautia hydrogenotrophica DSM
          10507]
 gi|225037910|gb|EEG48156.1| hypothetical protein RUMHYD_02965 [Blautia hydrogenotrophica DSM
          10507]
          Length = 174

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S + + + QG++  P++V+  +S G     +VG     V E++ER+++   + GL   
Sbjct: 1  MFSSVLSASIQGMEICPIQVEADLSDGLPSFSMVGYVSSQVKEAQERVRTAMKNTGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     D+
Sbjct: 58 --SLPPKRITVNLAPADI 73


>gi|283851327|ref|ZP_06368609.1| Mg chelatase, subunit ChlI [Desulfovibrio sp. FW1012B]
 gi|283573277|gb|EFC21255.1| Mg chelatase, subunit ChlI [Desulfovibrio sp. FW1012B]
          Length = 511

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 6/78 (7%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSP-GRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          +S IST A  GI+  PV ++V ++  G     +VGL + AV ES+ER+ +   +AGL   
Sbjct: 3  LSTISTAALLGIEAYPVTLEVDLARQGLPSFTMVGLAEGAVRESKERVFAALRNAGLK-- 60

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     D+
Sbjct: 61 ---LPPARITVNLAPADV 75


>gi|297247359|ref|ZP_06931077.1| magnesium-chelatase [Brucella abortus bv. 5 str. B3196]
 gi|297174528|gb|EFH33875.1| magnesium-chelatase [Brucella abortus bv. 5 str. B3196]
          Length = 518

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 55/78 (70%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AF+GI+ +PV+VQVM++PG++G+ IV LPDKAV ESRER+Q+    +GL   
Sbjct: 9  MVARVGTVAFRGIEAVPVDVQVMIAPGKMGMSIVRLPDKAVAESRERVQAALHASGL--- 65

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 66 --SMPAKRVTVNLAPADL 81


>gi|296171472|ref|ZP_06852758.1| competence protein ComM [Mycobacterium parascrofulaceum ATCC
          BAA-614]
 gi|295894158|gb|EFG73918.1| competence protein ComM [Mycobacterium parascrofulaceum ATCC
          BAA-614]
          Length = 503

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  ++A +G+ G  VE++  +S G  GV +VGLPD A+ ESR+R+++   + G     
Sbjct: 3  LGRAFSVAVRGVDGQIVEIEADISSGLPGVHLVGLPDAALQESRDRVRAAVANCG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
          N  P   L L      L
Sbjct: 58 NSWPQTRLTLALSPATL 74


>gi|254690268|ref|ZP_05153522.1| Mg chelatase-related protein [Brucella abortus bv. 6 str. 870]
 gi|256258521|ref|ZP_05464057.1| Mg chelatase-related protein [Brucella abortus bv. 9 str. C68]
 gi|260755806|ref|ZP_05868154.1| Mg chelatase [Brucella abortus bv. 6 str. 870]
 gi|260884831|ref|ZP_05896445.1| Mg chelatase [Brucella abortus bv. 9 str. C68]
 gi|260675914|gb|EEX62735.1| Mg chelatase [Brucella abortus bv. 6 str. 870]
 gi|260874359|gb|EEX81428.1| Mg chelatase [Brucella abortus bv. 9 str. C68]
          Length = 510

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 55/78 (70%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ T+AF+GI+ +PV+VQVM++PG++G+ IV LPDKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVGTVAFRGIEAVPVDVQVMIAPGKMGMSIVRLPDKAVAESRERVQAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     DL
Sbjct: 58 --SMPAKRVTVNLAPADL 73


>gi|227824333|ref|ZP_03989165.1| magnisium chelatase [Acidaminococcus sp. D21]
 gi|226904832|gb|EEH90750.1| magnisium chelatase [Acidaminococcus sp. D21]
          Length = 508

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +R       GI G  + V+V V+ G+   +IVGL D AV ESRER++S   ++   F 
Sbjct: 1  MYARTWGETTCGINGEMIVVEVDVANGKFNFEIVGLADTAVKESRERVRSAIKNSSCKF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P  ++ +     DL
Sbjct: 60 ----PDQHITVNLAPADL 73


>gi|325271619|ref|ZP_08138122.1| magnesium chelatase subunit D/I family protein [Pseudomonas sp.
          TJI-51]
 gi|324103246|gb|EGC00590.1| magnesium chelatase subunit D/I family protein [Pseudomonas sp.
          TJI-51]
          Length = 223

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+  V ES++R++S  +++GL +  
Sbjct: 3  LALVHSRAQVGVQAPAVSVETHLTNGLPHLTLVGLPETTVKESKDRVRSAIVNSGLNY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   +       DL
Sbjct: 61 ---PQRRITQNLAPADL 74


>gi|167736913|ref|ZP_02409687.1| Mg chelatase-related protein [Burkholderia pseudomallei 14]
          Length = 122

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|120403194|ref|YP_953023.1| Mg chelatase subunit ChlI [Mycobacterium vanbaalenii PYR-1]
 gi|119956012|gb|ABM13017.1| Mg chelatase, subunit ChlI [Mycobacterium vanbaalenii PYR-1]
          Length = 503

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  ++A +G++G  VE++  +S G  GV +VGL D A+ ESR+R+++   +       
Sbjct: 4  LGRAFSVAVRGVEGEIVEIEADISSGLPGVYLVGLADAALRESRDRVRAAISNCDF---- 59

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   L L      L
Sbjct: 60 -EWPMTRLTLALSPATL 75


>gi|254282019|ref|ZP_04956987.1| putative Mg chelatase [gamma proteobacterium NOR51-B]
 gi|219678222|gb|EED34571.1| putative Mg chelatase [gamma proteobacterium NOR51-B]
          Length = 503

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 5/76 (6%)

Query: 3  SRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVN 62
          + I T    G+    V +QV ++ G     +VGLP+  V ESRER++S  +++       
Sbjct: 4  ATIFTRGSAGLAAPAVAIQVHITNGLPAFTVVGLPESTVRESRERVRSALLNSFF----- 58

Query: 63 ELPSIYLQLIYQKKDL 78
          E P   + +     DL
Sbjct: 59 EWPDTRITVNLAPADL 74


>gi|167892626|ref|ZP_02480028.1| Mg chelatase-related protein [Burkholderia pseudomallei 7894]
          Length = 124

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|302671368|ref|YP_003831328.1| Mg chelatase-like protein [Butyrivibrio proteoclasticus B316]
 gi|302395841|gb|ADL34746.1| Mg chelatase-like protein [Butyrivibrio proteoclasticus B316]
          Length = 522

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 36/78 (46%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S + + A  GI    ++V+V VS G  G  +VG     V E+ ER++    + G +  
Sbjct: 1  MFSSVVSGAVHGISSYLMQVEVDVSSGLPGFNMVGFMSGEVREAGERVRVALKNMGYV-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P+  + +     D+
Sbjct: 59 ---IPASKITINLSPADI 73


>gi|229826295|ref|ZP_04452364.1| hypothetical protein GCWU000182_01667 [Abiotrophia defectiva ATCC
          49176]
 gi|229789165|gb|EEP25279.1| hypothetical protein GCWU000182_01667 [Abiotrophia defectiva ATCC
          49176]
          Length = 509

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 34/78 (43%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S + ++A  GI GI   V+  +  G     +VG     V ES ER+++  +++G    
Sbjct: 1  MFSSVKSVALSGINGIITNVEADIRNGLPAFNMVGFLSTQVRESGERVRAAILNSGFY-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             L    + +     D+
Sbjct: 59 ---LEPKRILVNISPADI 73


>gi|90408701|ref|ZP_01216850.1| hypothetical protein PCNPT3_03775 [Psychromonas sp. CNPT3]
 gi|90310183|gb|EAS38319.1| hypothetical protein PCNPT3_03775 [Psychromonas sp. CNPT3]
          Length = 506

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 39/77 (50%), Gaps = 4/77 (5%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I+ +   +  GI    V V+V +S G     +VGLP+ +V E++ER++S  I++  ++  
Sbjct: 3  IATLYCRSVLGIDAKQVLVEVHLSRGLPTFALVGLPETSVKEAKERVRSAIINSHFMWPH 62

Query: 62 NELPSIYLQLIYQKKDL 78
          N      + +     +L
Sbjct: 63 N----KRIIVNLAPANL 75


>gi|257126667|ref|YP_003164781.1| Mg chelatase, subunit ChlI [Leptotrichia buccalis C-1013-b]
 gi|257050606|gb|ACV39790.1| Mg chelatase, subunit ChlI [Leptotrichia buccalis C-1013-b]
          Length = 506

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M   + + ++ G+    VEV+V +S G     IVG+ D+A+ ES+ERI+S F + G    
Sbjct: 1  MAISLFSCSYMGVDTYVVEVEVDLSRGLPVFNIVGMGDQAISESKERIRSCFKNMGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     ++
Sbjct: 58 --EFPVRRVLVNLSPANI 73


>gi|225027212|ref|ZP_03716404.1| hypothetical protein EUBHAL_01468 [Eubacterium hallii DSM 3353]
 gi|224955441|gb|EEG36650.1| hypothetical protein EUBHAL_01468 [Eubacterium hallii DSM 3353]
          Length = 550

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ + +   QGI+G  V++QV +S G     ++G     V ES+ER+++   + G    
Sbjct: 1  MVAEVFSAMIQGIEGQIVKIQVDISNGLPNFNMIGYLSNEVKESKERVRTALNNIG---- 56

Query: 61 VNELPSIYLQLIYQKKD 77
             LP   + + +   D
Sbjct: 57 -VLLPPKRISVNFAPAD 72


>gi|167844122|ref|ZP_02469630.1| Mg chelatase-related protein [Burkholderia pseudomallei B7210]
          Length = 125

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|218672213|ref|ZP_03521882.1| Mg chelatase, subunit ChlI [Rhizobium etli GR56]
          Length = 122

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 58/78 (74%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ST+AFQGI+G+PVEVQVMV+PG++G+QIVGLPDKAV ESRER+Q+    +GL   
Sbjct: 1  MVARVSTVAFQGIEGVPVEVQVMVAPGKIGMQIVGLPDKAVAESRERVQAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 58 --SLPGKRVTVNLAPADL 73


>gi|72161074|ref|YP_288731.1| Mg chelatase-like protein [Thermobifida fusca YX]
 gi|71914806|gb|AAZ54708.1| Mg chelatase-related protein [Thermobifida fusca YX]
          Length = 514

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++R  ++A  G++G  ++V+  +  G+ G+ +VGLPD A+ E+R+RI++  +++G     
Sbjct: 3  LARTRSVALLGVEGYGIDVEAHIGTGKPGLTLVGLPDAALREARDRIRAAIVNSG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
             P  ++ +      L
Sbjct: 58 EHWPETHITVSLSPASL 74


>gi|254821957|ref|ZP_05226958.1| Mg-chelatase subunits D/I family protein, ComM subfamily protein
          [Mycobacterium intracellulare ATCC 13950]
          Length = 502

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  ++A +G+ G  VE++  ++ G  GV +VGLPD A+ ESR+R+++   + G     
Sbjct: 3  LGRAFSVAVRGVDGEIVEIEADITSGLPGVHLVGLPDAALQESRDRVRAAVTNCG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
          N+ P   L L      L
Sbjct: 58 NDWPMARLTLALSPATL 74


>gi|227497672|ref|ZP_03927885.1| ATPase [Actinomyces urogenitalis DSM 15434]
 gi|226832880|gb|EEH65263.1| ATPase [Actinomyces urogenitalis DSM 15434]
          Length = 437

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++R   +   G++G  V+V+   S G  G  +VGLPD AV ESRER+++     G     
Sbjct: 4  LARTLAVTLTGLQGHLVQVEAHASQGLPGFTLVGLPDAAVRESRERVRAALSTCG----- 58

Query: 62 NELPSIYLQLIYQKKDL 78
                 +       DL
Sbjct: 59 TAWGERRVTANLSPADL 75


>gi|167822540|ref|ZP_02454011.1| Mg chelatase-related protein [Burkholderia pseudomallei 9]
          Length = 126

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|30271877|gb|AAP29974.1| hypothetical protein [Pseudomonas putida]
          Length = 195

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+  V ES++R++S  +++GL +  
Sbjct: 3  LALVHSRAQVGVQAPAVSVETHLANGLPHLTLVGLPETTVKESKDRVRSAIVNSGLNY-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   +       DL
Sbjct: 61 ---PQRRITQNLAPADL 74


>gi|304436562|ref|ZP_07396532.1| competence protein ComM [Selenomonas sp. oral taxon 149 str.
          67H29BP]
 gi|304370432|gb|EFM24087.1| competence protein ComM [Selenomonas sp. oral taxon 149 str.
          67H29BP]
          Length = 149

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M ++   +   G  G  ++V+V VSPG  G ++VGLPD++  ES+ER+++   ++G    
Sbjct: 1  MFAKTYGVTTLGNDGRMIDVEVDVSPGLPGFELVGLPDRSAKESKERVRTAIRNSG---- 56

Query: 61 VNELPSIYLQLIYQKKDL 78
            +L    + +     D+
Sbjct: 57 -IQLRQERVTVNLAPADV 73


>gi|326405092|ref|YP_004285174.1| hypothetical protein ACMV_29450 [Acidiphilium multivorum AIU301]
 gi|325051954|dbj|BAJ82292.1| hypothetical protein ACMV_29450 [Acidiphilium multivorum AIU301]
          Length = 510

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/77 (41%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I+RI + AF GI+  PVEVQV ++ G     +VGL DKAV ESRER+++     GL    
Sbjct: 3  ITRIQSFAFAGIEAQPVEVQVQIAAGLPVFLVVGLADKAVAESRERVRAALTAMGL---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
            LP+  + +     DL
Sbjct: 59 -ALPAKRILVNLAPADL 74


>gi|148261603|ref|YP_001235730.1| Mg chelatase, subunit ChlI [Acidiphilium cryptum JF-5]
 gi|146403284|gb|ABQ31811.1| Mg chelatase, subunit ChlI [Acidiphilium cryptum JF-5]
          Length = 510

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/77 (41%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I+RI + AF GI+  PVEVQV ++ G     +VGL DKAV ESRER+++     GL    
Sbjct: 3  ITRIQSFAFAGIEAQPVEVQVQIAAGLPVFLVVGLADKAVAESRERVRAALTAMGL---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
            LP+  + +     DL
Sbjct: 59 -ALPAKRILVNLAPADL 74


>gi|296535312|ref|ZP_06897517.1| Mg chelatase-like protein [Roseomonas cervicalis ATCC 49957]
 gi|296264363|gb|EFH10783.1| Mg chelatase-like protein [Roseomonas cervicalis ATCC 49957]
          Length = 507

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 45/77 (58%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I+R+++ AF GI+ +PVE+QV ++ G     +VGLPDKAV ESRER+++     GL    
Sbjct: 3  IARVASFAFAGIEALPVEIQVQIASGLPAFTLVGLPDKAVAESRERVRAALNGLGL---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
            LP   + +      L
Sbjct: 59 -SLPPKRILVNLAPAGL 74


>gi|88608871|ref|YP_505969.1| Mg chelatase-related protein [Neorickettsia sennetsu str.
          Miyayama]
 gi|88601040|gb|ABD46508.1| Mg chelatase-related protein [Neorickettsia sennetsu str.
          Miyayama]
          Length = 501

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 45/81 (55%), Gaps = 5/81 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M + I TI+ QG+  + + VQV +SPG     IVGLPDK++ ES+ERI++  +H GL   
Sbjct: 1  MFTEIHTISIQGLSLVKIGVQVAISPGLPCFNIVGLPDKSISESKERIRAALLHIGL--- 57

Query: 61 VNELPSIYLQLIYQKKDLIMI 81
             LP   + +      L  I
Sbjct: 58 --SLPKKRITVNLSPAGLTKI 76


>gi|329947874|ref|ZP_08294806.1| Mg chelatase-like protein [Actinomyces sp. oral taxon 170 str.
          F0386]
 gi|328523498|gb|EGF50596.1| Mg chelatase-like protein [Actinomyces sp. oral taxon 170 str.
          F0386]
          Length = 522

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++R   +   G+ G  V+V+   + G  G  +VGLPD AV ESRER+++     G+    
Sbjct: 3  LARTLAVTLTGLAGHIVDVEAHATQGLPGFTLVGLPDTAVRESRERVRAALSTCGVT--- 59

Query: 62 NELPSIYLQLIYQKKDL 78
                 L +     DL
Sbjct: 60 --WGEQRLTVNLSPADL 74


>gi|325523888|gb|EGD02108.1| Mg chelatase, subunit ChlI [Burkholderia sp. TJI49]
          Length = 78

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G     
Sbjct: 3  LAVVRSRAPAAGRAPDVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EFPVRRITVNLAPADL 74


>gi|291524906|emb|CBK90493.1| Mg chelatase-related protein [Eubacterium rectale DSM 17629]
          Length = 511

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S + T    GI  IPV+V+V +S G     +VG     V E++ER+++     G++  
Sbjct: 1  MYSTVRTAVLDGISAIPVQVEVDISTGMPVFDMVGNLTSEVREAKERVKTALHSVGIV-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     ++
Sbjct: 59 ---LPAKRITVNLSPANI 73


>gi|28198380|ref|NP_778694.1| competence-related protein [Xylella fastidiosa Temecula1]
 gi|182681021|ref|YP_001829181.1| Mg chelatase, subunit ChlI [Xylella fastidiosa M23]
 gi|28056450|gb|AAO28343.1| competence-related protein [Xylella fastidiosa Temecula1]
 gi|182631131|gb|ACB91907.1| Mg chelatase, subunit ChlI [Xylella fastidiosa M23]
 gi|307579490|gb|ADN63459.1| Mg chelatase, subunit ChlI [Xylella fastidiosa subsp. fastidiosa
          GB514]
          Length = 506

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V +S G    QIVGLP+ AV ESR+R+++  + A      
Sbjct: 3  LALVHSRARAGVFAPSVRVEVHLSGGLPATQIVGLPEAAVRESRDRVRAALLCACF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPARRITINLAPADL 74


>gi|239908541|ref|YP_002955283.1| competence protein ComM [Desulfovibrio magneticus RS-1]
 gi|239798408|dbj|BAH77397.1| competence protein ComM [Desulfovibrio magneticus RS-1]
          Length = 511

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 6/78 (7%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSP-GRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          +S I T A  G++  PV ++V +S  G     +VGL + AV ES+ER+ +   +AGL   
Sbjct: 3  LSSIRTAALLGVEAYPVSLEVDLSRQGMPSFSMVGLAEGAVRESKERVLAALRNAGLK-- 60

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     D+
Sbjct: 61 ---LPPARITVNLAPADM 75


>gi|71276507|ref|ZP_00652782.1| Mg chelatase-related protein [Xylella fastidiosa Dixon]
 gi|71900582|ref|ZP_00682709.1| Mg chelatase-related protein [Xylella fastidiosa Ann-1]
 gi|170729727|ref|YP_001775160.1| competence-related protein [Xylella fastidiosa M12]
 gi|71162684|gb|EAO12411.1| Mg chelatase-related protein [Xylella fastidiosa Dixon]
 gi|71729639|gb|EAO31743.1| Mg chelatase-related protein [Xylella fastidiosa Ann-1]
 gi|167964520|gb|ACA11530.1| competence-related protein [Xylella fastidiosa M12]
          Length = 506

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V +S G    QIVGLP+ AV ESR+R+++  + A      
Sbjct: 3  LALVHSRARAGVFAPSVRVEVHLSGGLPATQIVGLPEAAVRESRDRVRAALLCACF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPARRITINLAPADL 74


>gi|71901059|ref|ZP_00683169.1| Mg chelatase-related protein [Xylella fastidiosa Ann-1]
 gi|71729186|gb|EAO31307.1| Mg chelatase-related protein [Xylella fastidiosa Ann-1]
          Length = 506

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V +S G    QIVGLP+ AV ESR+R+++  + A      
Sbjct: 3  LALVHSRARAGVFAPSVRVEVHLSGGLPATQIVGLPEAAVRESRDRVRAALLCACF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPARRITINLAPADL 74


>gi|152965376|ref|YP_001361160.1| Mg chelatase, subunit ChlI [Kineococcus radiotolerans SRS30216]
 gi|151359893|gb|ABS02896.1| Mg chelatase, subunit ChlI [Kineococcus radiotolerans SRS30216]
          Length = 517

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++R   +   G+ G  VEV+  +S G     +VGLPD ++ E+++R+++   ++G     
Sbjct: 3  LARSLAVGLVGLDGHLVEVEADISTGLPAFVLVGLPDASLHEAKDRVRAAAANSGFP--- 59

Query: 62 NELPSIYLQLIYQKKDL 78
            LP   + +      L
Sbjct: 60 --LPQQRITVNLSPATL 74


>gi|291529047|emb|CBK94633.1| Mg chelatase-related protein [Eubacterium rectale M104/1]
          Length = 511

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S + T    GI  IPV+V+V +S G     +VG     V E++ER+++     G++  
Sbjct: 1  MYSTVRTAVLDGISAIPVQVEVDISTGMPVFDMVGNLTSEVREAKERVKTALHSVGIV-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     ++
Sbjct: 59 ---LPAKRITVNLSPANI 73


>gi|238924177|ref|YP_002937693.1| putative ATPase with chaperone activity [Eubacterium rectale ATCC
          33656]
 gi|238875852|gb|ACR75559.1| predicted ATPase with chaperone activity [Eubacterium rectale
          ATCC 33656]
          Length = 511

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S + T    GI  IPV+V+V +S G     +VG     V E++ER+++     G++  
Sbjct: 1  MYSTVRTAVLDGISAIPVQVEVDISTGMPVFDMVGNLTSEVREAKERVKTALHSVGIV-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     ++
Sbjct: 59 ---LPAKRITVNLSPANI 73


>gi|237737576|ref|ZP_04568057.1| Mg(2+) chelatase [Fusobacterium mortiferum ATCC 9817]
 gi|229419456|gb|EEO34503.1| Mg(2+) chelatase [Fusobacterium mortiferum ATCC 9817]
          Length = 500

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  R+ + ++ G++   V+V+V +S G     I+GL D A+ ES++RI++   ++G    
Sbjct: 1  MNKRVLSSSYIGVESFLVDVEVDISNGLPNFSIIGLGDTAISESKDRIRTALKNSGFK-- 58

Query: 61 VNELPSIYLQLIYQKK 76
             L    + +     
Sbjct: 59 ---LEPKKIIVNLSPA 71


>gi|325673467|ref|ZP_08153158.1| competence protein ComM [Rhodococcus equi ATCC 33707]
 gi|325555488|gb|EGD25159.1| competence protein ComM [Rhodococcus equi ATCC 33707]
          Length = 502

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  ++A  G+ G  VE++  +  G  GV +VGLPD A+ ESR+R+++   ++G     
Sbjct: 3  LGRAHSVAVTGVDGQIVEIEADIGRGLPGVHLVGLPDTALQESRDRVRAAVTNSG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
           + P   + L      L
Sbjct: 58 AKWPESRVTLALSPATL 74


>gi|91202729|emb|CAJ72368.1| similar to ATP-dependent protease Lon [Candidatus Kuenenia
          stuttgartiensis]
          Length = 510

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 7/78 (8%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPG-RVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M++ + +++  GI+G  VEV++ +  G      IVGLPD AV ESR+R+++   ++G  F
Sbjct: 1  MLANVKSVSVYGIEGYLVEVEICIVKGEMPSTIIVGLPDTAVKESRDRVKAALNNSGYRF 60

Query: 60 LVNELPSIYLQLIYQKKD 77
            N      + +     D
Sbjct: 61 PSN------VIINLAPAD 72


>gi|312797414|ref|YP_004030336.1| ATPase related to magnesium chelatase subunit ChlI [Burkholderia
          rhizoxinica HKI 454]
 gi|312169189|emb|CBW76192.1| ATPase related to magnesium chelatase subunit ChlI [Burkholderia
          rhizoxinica HKI 454]
          Length = 516

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A        V V+V ++ G     IVGLPD  V ESRER+++   H G     
Sbjct: 9  LAVVRSRAPLHALAPEVTVEVHLANGLPSFAIVGLPDLEVRESRERVRAALAHCGFD--- 65

Query: 62 NELPSIYLQLIYQKKDL 78
            +P   + +     DL
Sbjct: 66 --VPVRRITVNLAPADL 80


>gi|15837781|ref|NP_298469.1| competence related protein [Xylella fastidiosa 9a5c]
 gi|9106145|gb|AAF83989.1|AE003951_14 competence related protein [Xylella fastidiosa 9a5c]
          Length = 506

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V +S G    QIVGLP+ AV ESR+R+++  + A      
Sbjct: 3  LALVHSRARAGVFAPSVRVEVHLSGGLPATQIVGLPEAAVRESRDRVRAALLCACF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +     DL
Sbjct: 59 -EYPARRITINLAPADL 74


>gi|183981826|ref|YP_001850117.1| hypothetical protein MMAR_1813 [Mycobacterium marinum M]
 gi|183175152|gb|ACC40262.1| conserved hypothetical protein [Mycobacterium marinum M]
          Length = 503

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  ++A  G+ G  VE++  +S G  GV +VGLPD A+ ESR+R+++   + G     
Sbjct: 3  LGRAFSVAVCGLDGEIVEIEADISSGLPGVHLVGLPDAALQESRDRVRAAVTNCG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
          N  P   L L      L
Sbjct: 58 NSWPMARLTLALSPATL 74


>gi|260914708|ref|ZP_05921173.1| competence protein ComM [Pasteurella dagmatis ATCC 43325]
 gi|260631212|gb|EEX49398.1| competence protein ComM [Pasteurella dagmatis ATCC 43325]
          Length = 498

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 38/67 (56%), Gaps = 5/67 (7%)

Query: 12 GIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSIYLQL 71
          G++   V ++V +S G+ G  +VGLP+K V E+++R++S  ++A   +     P+  + +
Sbjct: 2  GVQAPLVTIEVHLSNGKPGFTLVGLPEKTVKEAQDRVRSALLNAQFKY-----PAKRITV 56

Query: 72 IYQKKDL 78
               DL
Sbjct: 57 NLAPADL 63


>gi|312139228|ref|YP_004006564.1| magnesium chelatase [Rhodococcus equi 103S]
 gi|311888567|emb|CBH47879.1| magnesium chelatase [Rhodococcus equi 103S]
          Length = 502

 Score = 98.5 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  ++A  G+ G  VE++  +  G  GV +VGLPD A+ ESR+R+++   ++G     
Sbjct: 3  LGRAHSVAVTGVDGQIVEIEADIGRGLPGVHLVGLPDTALQESRDRVRAAVTNSG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
           + P   + L      L
Sbjct: 58 AKWPESRVTLALSPATL 74


>gi|160939768|ref|ZP_02087115.1| hypothetical protein CLOBOL_04659 [Clostridium bolteae ATCC
          BAA-613]
 gi|158437202|gb|EDP14967.1| hypothetical protein CLOBOL_04659 [Clostridium bolteae ATCC
          BAA-613]
          Length = 526

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 36/76 (47%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +RI++     ++G+ V V+  VS G  G  I G     V ES++R+++   ++G    
Sbjct: 16 MFTRINSGGIWAVEGVLVSVEADVSDGLPGFSISGQLASEVRESQDRVRTALKNSGFR-- 73

Query: 61 VNELPSIYLQLIYQKK 76
             LP+  + +     
Sbjct: 74 ---LPAKKITVNLSPA 86


>gi|294054983|ref|YP_003548641.1| Mg chelatase, subunit ChlI [Coraliomargarita akajimensis DSM
          45221]
 gi|293614316|gb|ADE54471.1| Mg chelatase, subunit ChlI [Coraliomargarita akajimensis DSM
          45221]
          Length = 515

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVS-PGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M++   + A  G+   PV+V+V     G + + +VGLPD AV ES++R+ S   ++G   
Sbjct: 1  MLAISQSAALHGVDAHPVQVEVNTGERGELKLILVGLPDAAVKESQDRVFSAIANSGFR- 59

Query: 60 LVNELPSIYLQLIYQKKDL 78
              LP+    +     DL
Sbjct: 60 ----LPATRTTINLAPGDL 74


>gi|319785762|ref|YP_004145237.1| Mg chelatase, subunit ChlI [Pseudoxanthomonas suwonensis 11-1]
 gi|317464274|gb|ADV26006.1| Mg chelatase, subunit ChlI [Pseudoxanthomonas suwonensis 11-1]
          Length = 508

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V+V+V +S G    QIVGLP  AV ESR+R+++  + A      
Sbjct: 3  LALVHSRARAGVAAPAVQVEVHLSGGLPCTQIVGLPAAAVRESRDRVRAAILCAQF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +     DL
Sbjct: 59 -EYPQRRITINLAPADL 74


>gi|227872633|ref|ZP_03990965.1| ATPase [Oribacterium sinus F0268]
 gi|227841520|gb|EEJ51818.1| ATPase [Oribacterium sinus F0268]
          Length = 526

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 35/78 (44%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S++ + A  G+    V VQV  S G      +G    +V E+ ER+     + GL   
Sbjct: 1  MLSKVYSAAIHGLNAYVVSVQVDESNGLPRSMTLGNVSASVKEAIERVSIALKNLGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            ELP   + +  Q  DL
Sbjct: 58 --ELPPKKITINLQPADL 73


>gi|160947177|ref|ZP_02094344.1| hypothetical protein PEPMIC_01110 [Parvimonas micra ATCC 33270]
 gi|158446311|gb|EDP23306.1| hypothetical protein PEPMIC_01110 [Parvimonas micra ATCC 33270]
          Length = 500

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 35/69 (50%), Gaps = 5/69 (7%)

Query: 10 FQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSIYL 69
            G+ G  ++V+  +S G     IVGLPD ++ ES+ER++S   ++G       +P   +
Sbjct: 2  LNGLNGYDIDVEADLSSGLQAFNIVGLPDLSIKESKERVKSAISNSGF-----SIPPGRV 56

Query: 70 QLIYQKKDL 78
           +     +L
Sbjct: 57 TINLAPANL 65


>gi|306819649|ref|ZP_07453312.1| Mg chelatase-like protein [Eubacterium yurii subsp. margaretiae
          ATCC 43715]
 gi|304552294|gb|EFM40222.1| Mg chelatase-like protein [Eubacterium yurii subsp. margaretiae
          ATCC 43715]
          Length = 511

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S I T    GI G  V V+  +S G  G+ IVGLP  AV ES++RI+S   ++   + 
Sbjct: 1  MFSEIITAGTYGIDGFKVSVESDISKGMPGITIVGLPAVAVKESKDRIKSAITNSFFNYP 60

Query: 61 VNELPSIYLQLIYQKKDL 78
          +    +  + +     D+
Sbjct: 61 I----TKKIVINLSPADI 74


>gi|300741392|ref|ZP_07071413.1| Mg chelatase-like protein [Rothia dentocariosa M567]
 gi|300380577|gb|EFJ77139.1| Mg chelatase-like protein [Rothia dentocariosa M567]
          Length = 514

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           +R  ++A  G+ G  V+V+  VS G  G  ++GLPD A+ ES+ER++S   ++G+    
Sbjct: 3  FARTYSVALVGLHGHIVDVEADVSQGLPGFVLLGLPDTALNESKERVRSAAKNSGISLTQ 62

Query: 62 NELPSIYLQLIYQKKDL 78
          +      L +      L
Sbjct: 63 H-----RLTINLTPATL 74


>gi|89053393|ref|YP_508844.1| Mg chelatase-related protein [Jannaschia sp. CCS1]
 gi|88862942|gb|ABD53819.1| Mg chelatase-related protein [Jannaschia sp. CCS1]
          Length = 513

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++   T+AF+G+    VEVQ  V+ G  G  IVGLPDKAV E+RER+++         + 
Sbjct: 10 LALTHTVAFEGLDARRVEVQCAVTAGLPGFAIVGLPDKAVSEARERVRTALQA-----MA 64

Query: 62 NELPSIYLQLIYQKKDL 78
            LPS  + +     D+
Sbjct: 65 IALPSRRITVNLSPADI 81


>gi|260187916|ref|ZP_05765390.1| Mg chelatase [Mycobacterium tuberculosis CPHL_A]
          Length = 549

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  ++A +G+ G  VE++  ++ G  GV +VGLPD A+ ESR+R+++   + G     
Sbjct: 3  LGRAFSVAVRGLDGEIVEIEADITSGLPGVHLVGLPDAALQESRDRVRAAVTNCG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
          N  P   L L      L
Sbjct: 58 NSWPMARLTLALSPATL 74


>gi|223940112|ref|ZP_03631975.1| Mg chelatase, subunit ChlI [bacterium Ellin514]
 gi|223891214|gb|EEF57712.1| Mg chelatase, subunit ChlI [bacterium Ellin514]
          Length = 508

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + A  GI+  PVEV+V    G   + IVGLPD AV ES +R+ +   ++G  F 
Sbjct: 1  MLARVCSAAVNGIEAFPVEVEVNDGYGDSKIVIVGLPDAAVRESIDRVSTALQNSGFKFT 60

Query: 61 VNELPSIYLQLIYQKKDL 78
                    +     D+
Sbjct: 61 FG-----KTTINLAPADV 73


>gi|296160404|ref|ZP_06843221.1| magnesium chelatase ChlI subunit [Burkholderia sp. Ch1-1]
 gi|295889385|gb|EFG69186.1| magnesium chelatase ChlI subunit [Burkholderia sp. Ch1-1]
          Length = 335

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   +    F  
Sbjct: 3  LAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCNFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     DL
Sbjct: 61 ---PVRRITVNLAPADL 74


>gi|289644812|ref|ZP_06476865.1| Mg chelatase, subunit ChlI [Frankia symbiont of Datisca
          glomerata]
 gi|289505368|gb|EFD26414.1| Mg chelatase, subunit ChlI [Frankia symbiont of Datisca
          glomerata]
          Length = 513

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++R  ++A  G+ G  VEV+  ++ G   + +VGLPD ++ E+R+RI++  +++G     
Sbjct: 3  LARAFSVAVVGVHGHLVEVEADLANGLPDITLVGLPDTSLHEARDRIRAAIVNSG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
           + PS  + +      L
Sbjct: 58 QQWPSQRITVGLFPATL 74


>gi|120603299|ref|YP_967699.1| Mg chelatase, subunit ChlI [Desulfovibrio vulgaris DP4]
 gi|120563528|gb|ABM29272.1| Mg chelatase, subunit ChlI [Desulfovibrio vulgaris DP4]
          Length = 554

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSP-GRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          MI+R++  A QG+    V+++V  +  G     +VGL + AV E+RER+ +     GL  
Sbjct: 1  MIARVACAALQGVDATRVDLEVDFARQGMPAFTLVGLAEGAVREARERVMAALRAVGLR- 59

Query: 60 LVNELPSIYLQLIYQKKD 77
              LP   + +     D
Sbjct: 60 ----LPPARITVNLAPAD 73


>gi|311113474|ref|YP_003984696.1| Mg chelatase-like protein [Rothia dentocariosa ATCC 17931]
 gi|310944968|gb|ADP41262.1| Mg chelatase-like protein [Rothia dentocariosa ATCC 17931]
          Length = 514

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           +R  ++A  G+ G  V+V+  VS G  G  ++GLPD A+ ES+ER++S   ++G+    
Sbjct: 3  FARTYSVALVGLHGHIVDVEADVSQGLPGFVLLGLPDTALNESKERVRSAAKNSGISLTQ 62

Query: 62 NELPSIYLQLIYQKKDL 78
          +      L +      L
Sbjct: 63 H-----RLTINLTPATL 74


>gi|167909341|ref|ZP_02496432.1| Mg chelatase-related protein [Burkholderia pseudomallei 112]
          Length = 129

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 34/74 (45%), Gaps = 5/74 (6%)

Query: 5  ISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNEL 64
          + + A    +   V V+V ++ G     IVGLPD  V ESRER+++   + G      E 
Sbjct: 2  VRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCGF-----EF 56

Query: 65 PSIYLQLIYQKKDL 78
          P   + +     DL
Sbjct: 57 PVRRITVNLAPADL 70


>gi|145224719|ref|YP_001135397.1| Mg chelatase, subunit ChlI [Mycobacterium gilvum PYR-GCK]
 gi|315445049|ref|YP_004077928.1| Mg chelatase-related protein [Mycobacterium sp. Spyr1]
 gi|145217205|gb|ABP46609.1| Mg chelatase, subunit ChlI [Mycobacterium gilvum PYR-GCK]
 gi|315263352|gb|ADU00094.1| Mg chelatase-related protein [Mycobacterium sp. Spyr1]
          Length = 502

 Score = 98.1 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  ++A +G+ G  VE++  +S G  GV +VGL D A+ ESR+R+++   +       
Sbjct: 3  LGRAFSVAVRGVDGEIVEIEADISNGLPGVHLVGLGDAALRESRDRVRAAITNCKFD--- 59

Query: 62 NELPSIYLQLIYQKKDL 78
             P   L L      L
Sbjct: 60 --WPQARLTLALSPATL 74


>gi|322434648|ref|YP_004216860.1| magnesium chelatase ChlI subunit [Acidobacterium sp. MP5ACTX9]
 gi|321162375|gb|ADW68080.1| magnesium chelatase ChlI subunit [Acidobacterium sp. MP5ACTX9]
          Length = 315

 Score = 98.1 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 8/81 (9%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGR---VGVQIVGLPDKAVIESRERIQSHFIHAGL 57
          M+ +  + A  GI    ++V+V  S           VGLPD AV ESR+R++S   ++G 
Sbjct: 1  MLFKALSAAVYGIDAHIIDVEVDYSGTIQEKAEFSTVGLPDAAVRESRDRVRSAIRNSGF 60

Query: 58 LFLVNELPSIYLQLIYQKKDL 78
                LP+  + +     D+
Sbjct: 61 D-----LPTTRIIINLAPADI 76


>gi|289448562|ref|ZP_06438306.1| LOW QUALITY PROTEIN: Mg chelatase [Mycobacterium tuberculosis
          CPHL_A]
 gi|289421520|gb|EFD18721.1| LOW QUALITY PROTEIN: Mg chelatase [Mycobacterium tuberculosis
          CPHL_A]
          Length = 501

 Score = 98.1 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  ++A +G+ G  VE++  ++ G  GV +VGLPD A+ ESR+R+++   + G     
Sbjct: 3  LGRAFSVAVRGLDGEIVEIEADITSGLPGVHLVGLPDAALQESRDRVRAAVTNCG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
          N  P   L L      L
Sbjct: 58 NSWPMARLTLALSPATL 74


>gi|58617236|ref|YP_196435.1| hypothetical protein ERGA_CDS_05090 [Ehrlichia ruminantium str.
          Gardel]
 gi|58416848|emb|CAI27961.1| Conserved hypothetical protein, similar to Haemophilus competence
          protein comM [Ehrlichia ruminantium str. Gardel]
          Length = 492

 Score = 98.1 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 44/79 (55%), Gaps = 6/79 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI ++ ++AF GI  I V VQ+ V+ G     IVGLP+KAV ESRERI++      L   
Sbjct: 1  MI-QVKSVAFYGINTINVNVQIHVAKGIPAFNIVGLPNKAVAESRERIRAALHSINL--- 56

Query: 61 VNELPSIYLQLIYQKKDLI 79
             LP+  + +     D+I
Sbjct: 57 --SLPTQRITINLSPADII 73


>gi|15610034|ref|NP_217413.1| hypothetical protein Rv2897c [Mycobacterium tuberculosis H37Rv]
 gi|31794073|ref|NP_856566.1| hypothetical protein Mb2921c [Mycobacterium bovis AF2122/97]
 gi|121638778|ref|YP_979002.1| hypothetical protein BCG_2918c [Mycobacterium bovis BCG str.
          Pasteur 1173P2]
 gi|148662741|ref|YP_001284264.1| putative magnesium chelatase [Mycobacterium tuberculosis H37Ra]
 gi|148824086|ref|YP_001288840.1| hypothetical protein TBFG_12911 [Mycobacterium tuberculosis F11]
 gi|167969526|ref|ZP_02551803.1| hypothetical protein MtubH3_16476 [Mycobacterium tuberculosis
          H37Ra]
 gi|215404871|ref|ZP_03417052.1| hypothetical protein Mtub0_14513 [Mycobacterium tuberculosis
          02_1987]
 gi|215412740|ref|ZP_03421452.1| hypothetical protein Mtub9_15290 [Mycobacterium tuberculosis
          94_M4241A]
 gi|215431845|ref|ZP_03429764.1| hypothetical protein MtubE_14491 [Mycobacterium tuberculosis
          EAS054]
 gi|215447159|ref|ZP_03433911.1| hypothetical protein MtubT_14927 [Mycobacterium tuberculosis T85]
 gi|224991270|ref|YP_002645959.1| hypothetical protein JTY_2913 [Mycobacterium bovis BCG str. Tokyo
          172]
 gi|253798015|ref|YP_003031016.1| Mg chelatase [Mycobacterium tuberculosis KZN 1435]
 gi|254365537|ref|ZP_04981582.1| conserved hypothetical protein [Mycobacterium tuberculosis str.
          Haarlem]
 gi|260202032|ref|ZP_05769523.1| Mg chelatase [Mycobacterium tuberculosis T46]
 gi|260206215|ref|ZP_05773706.1| Mg chelatase [Mycobacterium tuberculosis K85]
 gi|289444452|ref|ZP_06434196.1| Mg chelatase [Mycobacterium tuberculosis T46]
 gi|289553314|ref|ZP_06442524.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN
          605]
 gi|289575602|ref|ZP_06455829.1| Mg chelatase [Mycobacterium tuberculosis K85]
 gi|289746696|ref|ZP_06506074.1| conserved hypothetical protein [Mycobacterium tuberculosis
          02_1987]
 gi|289755009|ref|ZP_06514387.1| conserved hypothetical protein [Mycobacterium tuberculosis
          EAS054]
 gi|289759017|ref|ZP_06518395.1| conserved hypothetical protein [Mycobacterium tuberculosis T85]
 gi|294994007|ref|ZP_06799698.1| Mg chelatase [Mycobacterium tuberculosis 210]
 gi|297635515|ref|ZP_06953295.1| Mg chelatase [Mycobacterium tuberculosis KZN 4207]
 gi|297732514|ref|ZP_06961632.1| Mg chelatase [Mycobacterium tuberculosis KZN R506]
 gi|298526366|ref|ZP_07013775.1| conserved hypothetical protein [Mycobacterium tuberculosis
          94_M4241A]
 gi|306777185|ref|ZP_07415522.1| hypothetical protein TMAG_01098 [Mycobacterium tuberculosis
          SUMu001]
 gi|306781092|ref|ZP_07419429.1| hypothetical protein TMBG_03041 [Mycobacterium tuberculosis
          SUMu002]
 gi|306785732|ref|ZP_07424054.1| hypothetical protein TMCG_02147 [Mycobacterium tuberculosis
          SUMu003]
 gi|306789771|ref|ZP_07428093.1| hypothetical protein TMDG_00089 [Mycobacterium tuberculosis
          SUMu004]
 gi|306794585|ref|ZP_07432887.1| hypothetical protein TMEG_02164 [Mycobacterium tuberculosis
          SUMu005]
 gi|306798828|ref|ZP_07437130.1| hypothetical protein TMFG_00095 [Mycobacterium tuberculosis
          SUMu006]
 gi|306804674|ref|ZP_07441342.1| hypothetical protein TMHG_02102 [Mycobacterium tuberculosis
          SUMu008]
 gi|306808866|ref|ZP_07445534.1| hypothetical protein TMGG_02431 [Mycobacterium tuberculosis
          SUMu007]
 gi|306968965|ref|ZP_07481626.1| hypothetical protein TMIG_02399 [Mycobacterium tuberculosis
          SUMu009]
 gi|306973302|ref|ZP_07485963.1| hypothetical protein TMJG_01889 [Mycobacterium tuberculosis
          SUMu010]
 gi|307081010|ref|ZP_07490180.1| hypothetical protein TMKG_03331 [Mycobacterium tuberculosis
          SUMu011]
 gi|307085609|ref|ZP_07494722.1| hypothetical protein TMLG_01389 [Mycobacterium tuberculosis
          SUMu012]
 gi|313659846|ref|ZP_07816726.1| Mg chelatase [Mycobacterium tuberculosis KZN V2475]
 gi|110826535|sp|P68908|Y2921_MYCBO RecName: Full=Uncharacterized protein Mb2921c
 gi|115311217|sp|P68909|Y2897_MYCTU RecName: Full=Uncharacterized protein Rv2897c/MT2965
 gi|1403418|emb|CAA98370.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium tuberculosis H37Rv]
 gi|31619668|emb|CAD96608.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium bovis AF2122/97]
 gi|121494426|emb|CAL72907.1| Conserved hypothetical protein [Mycobacterium bovis BCG str.
          Pasteur 1173P2]
 gi|134151050|gb|EBA43095.1| conserved hypothetical protein [Mycobacterium tuberculosis str.
          Haarlem]
 gi|148506893|gb|ABQ74702.1| putative magnesium chelatase [Mycobacterium tuberculosis H37Ra]
 gi|148722613|gb|ABR07238.1| conserved hypothetical protein [Mycobacterium tuberculosis F11]
 gi|224774385|dbj|BAH27191.1| hypothetical protein JTY_2913 [Mycobacterium bovis BCG str. Tokyo
          172]
 gi|253319518|gb|ACT24121.1| Mg chelatase [Mycobacterium tuberculosis KZN 1435]
 gi|289417371|gb|EFD14611.1| Mg chelatase [Mycobacterium tuberculosis T46]
 gi|289437946|gb|EFD20439.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN
          605]
 gi|289540033|gb|EFD44611.1| Mg chelatase [Mycobacterium tuberculosis K85]
 gi|289687224|gb|EFD54712.1| conserved hypothetical protein [Mycobacterium tuberculosis
          02_1987]
 gi|289695596|gb|EFD63025.1| conserved hypothetical protein [Mycobacterium tuberculosis
          EAS054]
 gi|289714581|gb|EFD78593.1| conserved hypothetical protein [Mycobacterium tuberculosis T85]
 gi|298496160|gb|EFI31454.1| conserved hypothetical protein [Mycobacterium tuberculosis
          94_M4241A]
 gi|308214467|gb|EFO73866.1| hypothetical protein TMAG_01098 [Mycobacterium tuberculosis
          SUMu001]
 gi|308326078|gb|EFP14929.1| hypothetical protein TMBG_03041 [Mycobacterium tuberculosis
          SUMu002]
 gi|308329642|gb|EFP18493.1| hypothetical protein TMCG_02147 [Mycobacterium tuberculosis
          SUMu003]
 gi|308333781|gb|EFP22632.1| hypothetical protein TMDG_00089 [Mycobacterium tuberculosis
          SUMu004]
 gi|308337175|gb|EFP26026.1| hypothetical protein TMEG_02164 [Mycobacterium tuberculosis
          SUMu005]
 gi|308340906|gb|EFP29757.1| hypothetical protein TMFG_00095 [Mycobacterium tuberculosis
          SUMu006]
 gi|308344818|gb|EFP33669.1| hypothetical protein TMGG_02431 [Mycobacterium tuberculosis
          SUMu007]
 gi|308348766|gb|EFP37617.1| hypothetical protein TMHG_02102 [Mycobacterium tuberculosis
          SUMu008]
 gi|308353467|gb|EFP42318.1| hypothetical protein TMIG_02399 [Mycobacterium tuberculosis
          SUMu009]
 gi|308357332|gb|EFP46183.1| hypothetical protein TMJG_01889 [Mycobacterium tuberculosis
          SUMu010]
 gi|308361216|gb|EFP50067.1| hypothetical protein TMKG_03331 [Mycobacterium tuberculosis
          SUMu011]
 gi|308364836|gb|EFP53687.1| hypothetical protein TMLG_01389 [Mycobacterium tuberculosis
          SUMu012]
 gi|326904511|gb|EGE51444.1| hypothetical protein TBPG_02418 [Mycobacterium tuberculosis
          W-148]
 gi|328457789|gb|AEB03212.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN
          4207]
          Length = 503

 Score = 97.7 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  ++A +G+ G  VE++  ++ G  GV +VGLPD A+ ESR+R+++   + G     
Sbjct: 3  LGRAFSVAVRGLDGEIVEIEADITSGLPGVHLVGLPDAALQESRDRVRAAVTNCG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
          N  P   L L      L
Sbjct: 58 NSWPMARLTLALSPATL 74


>gi|254551969|ref|ZP_05142416.1| Mg chelatase [Mycobacterium tuberculosis '98-R604 INH-RIF-EM']
          Length = 503

 Score = 97.7 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  ++A +G+ G  VE++  ++ G  GV +VGLPD A+ ESR+R+++   + G     
Sbjct: 3  LGRAFSVAVRGLDGEIVEIEADITSGLPGVHLVGLPDAALQESRDRVRAAVTNCG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
          N  P   L L      L
Sbjct: 58 NSWPMARLTLALSPATL 74


>gi|57239222|ref|YP_180358.1| putative competence protein [Ehrlichia ruminantium str.
          Welgevonden]
 gi|58579182|ref|YP_197394.1| hypothetical protein ERWE_CDS_05180 [Ehrlichia ruminantium str.
          Welgevonden]
 gi|57161301|emb|CAH58224.1| putative competence protein [Ehrlichia ruminantium str.
          Welgevonden]
 gi|58417808|emb|CAI27012.1| Conserved hypothetical protein, similar to Haemophilus competence
          protein comM [Ehrlichia ruminantium str. Welgevonden]
          Length = 492

 Score = 97.7 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 44/79 (55%), Gaps = 6/79 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI ++ ++AF GI  I V VQ+ V+ G     IVGLP+KAV ESRERI++      L   
Sbjct: 1  MI-QVKSVAFYGINTINVNVQIHVAKGIPAFNIVGLPNKAVAESRERIRAALHSINL--- 56

Query: 61 VNELPSIYLQLIYQKKDLI 79
             LP+  + +     D+I
Sbjct: 57 --SLPTQRITINLSPADII 73


>gi|15842440|ref|NP_337477.1| magnesium chelatase, putative [Mycobacterium tuberculosis
          CDC1551]
 gi|13882743|gb|AAK47291.1| magnesium chelatase, putative [Mycobacterium tuberculosis
          CDC1551]
 gi|323718507|gb|EGB27678.1| hypothetical protein TMMG_03770 [Mycobacterium tuberculosis
          CDC1551A]
          Length = 503

 Score = 97.7 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  ++A +G+ G  VE++  ++ G  GV +VGLPD A+ ESR+R+++   + G     
Sbjct: 3  LGRAFSVAVRGLDGEIVEIEADITSGLPGVHLVGLPDAALQESRDRVRAAVTNCG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
          N  P   L L      L
Sbjct: 58 NSWPMARLTLALSPATL 74


>gi|46579123|ref|YP_009931.1| competence protein comM [Desulfovibrio vulgaris str.
          Hildenborough]
 gi|46448536|gb|AAS95190.1| competence protein comM, putative [Desulfovibrio vulgaris str.
          Hildenborough]
 gi|311232964|gb|ADP85818.1| Mg chelatase, subunit ChlI [Desulfovibrio vulgaris RCH1]
          Length = 554

 Score = 97.7 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSP-GRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          MI+R++  A QG+    V+++V  +  G     +VGL + AV E+RER+ +     GL  
Sbjct: 1  MIARVACAALQGVDATRVDLEVDFARQGMPAFTLVGLAEGAVREARERVMAALRAVGLR- 59

Query: 60 LVNELPSIYLQLIYQKKD 77
              LP   + +     D
Sbjct: 60 ----LPPARITVNLAPAD 73


>gi|332186292|ref|ZP_08388037.1| magnesium chelatase, subunit ChlI family protein [Sphingomonas
          sp. S17]
 gi|332013660|gb|EGI55720.1| magnesium chelatase, subunit ChlI family protein [Sphingomonas
          sp. S17]
          Length = 504

 Score = 97.7 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M + +ST+A+ G++   VEVQV +  G     +VGL DKAV ESRER+++     GL   
Sbjct: 1  MATIVSTVAYLGLEARAVEVQVQLIAGLPAFNLVGLADKAVGESRERVRAAIAAMGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 58 --ALPPKRIAVNLSPADL 73


>gi|260062782|ref|YP_003195862.1| magnesium chelatase subunit ChlI [Robiginitalea biformata
          HTCC2501]
 gi|88784350|gb|EAR15520.1| magnesium chelatase, subunit ChlI [Robiginitalea biformata
          HTCC2501]
          Length = 512

 Score = 97.7 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++   A  GI  +PV ++V ++PG  G  +VGLPD A+ ES  RI +   + G    
Sbjct: 1  MLAKVYGCAVLGIDALPVTIEVNINPGI-GYHLVGLPDSAIRESNYRIAAALGNHGFR-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     DL
Sbjct: 58 ---IPGKKITINMAPADL 72


>gi|269127620|ref|YP_003300990.1| Mg chelatase subunit ChlI [Thermomonospora curvata DSM 43183]
 gi|268312578|gb|ACY98952.1| Mg chelatase, subunit ChlI [Thermomonospora curvata DSM 43183]
          Length = 519

 Score = 97.4 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +++  ++A  G++G  V+V+  ++ G  G+ +VGLPD A+ E+R+R+++   ++G     
Sbjct: 3  LAKTRSVALVGVEGFVVDVEASITSGVPGLHLVGLPDAALNEARDRVRAAIFNSG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
             P+ ++ +      L
Sbjct: 58 ESWPNRHVTISLFPASL 74


>gi|196232823|ref|ZP_03131673.1| Mg chelatase, subunit ChlI [Chthoniobacter flavus Ellin428]
 gi|196223022|gb|EDY17542.1| Mg chelatase, subunit ChlI [Chthoniobacter flavus Ellin428]
          Length = 516

 Score = 97.4 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++ + A  G+    VE++V  + G   + +VGLPD AV ES++R+ +   ++G    
Sbjct: 1  MLAKVYSAAVYGVDAFEVEIEVNGASGNGVIVVVGLPDVAVKESKDRVTTAIQNSGYR-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P     +     D+
Sbjct: 59 ---WPRGRTTINLAPADV 73


>gi|85710879|ref|ZP_01041940.1| Competence related ATPase with chaperone activity [Idiomarina
          baltica OS145]
 gi|85695283|gb|EAQ33220.1| Competence related ATPase with chaperone activity [Idiomarina
          baltica OS145]
          Length = 297

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 39/76 (51%), Gaps = 4/76 (5%)

Query: 3  SRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVN 62
          + + T A  GI+   V V+V ++ G     IVG+P  +V E+R+R++S  ++ GL F   
Sbjct: 4  ATVFTRASIGIEAPEVRVEVDLARGLPSFTIVGMPATSVREARDRVKSAILNVGLEFPA- 62

Query: 63 ELPSIYLQLIYQKKDL 78
             +  + +     ++
Sbjct: 63 ---ATRIIVNLAPAEI 75


>gi|218754650|ref|ZP_03533446.1| hypothetical protein MtubG1_14959 [Mycobacterium tuberculosis GM
          1503]
          Length = 362

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  ++A +G+ G  VE++  ++ G  GV +VGLPD A+ ESR+R+++   + G     
Sbjct: 3  LGRAFSVAVRGLDGEIVEIEADITSGLPGVHLVGLPDAALQESRDRVRAAVTNCG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
          N  P   L L      L
Sbjct: 58 NSWPMARLTLALSPATL 74


>gi|83945040|ref|ZP_00957406.1| Mg chelatase-related protein [Oceanicaulis alexandrii HTCC2633]
 gi|83851822|gb|EAP89677.1| Mg chelatase-related protein [Oceanicaulis alexandrii HTCC2633]
          Length = 517

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  R  + AF G +   V+VQV ++ G     IVGL DKAV ESRER+++ F   GL   
Sbjct: 1  MGIRTFSAAFDGAQARLVDVQVQIAGGLPNFVIVGLADKAVAESRERVRAAFAAVGL--- 57

Query: 61 VNELPSIYLQLIYQKKD 77
             LPS  L +     D
Sbjct: 58 --SLPSKRLIVNLAPAD 72


>gi|296273944|ref|YP_003656575.1| sigma 54 interacting domain-containing protein [Arcobacter
          nitrofigilis DSM 7299]
 gi|296098118|gb|ADG94068.1| Sigma 54 interacting domain protein [Arcobacter nitrofigilis DSM
          7299]
          Length = 502

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 17/74 (22%), Positives = 32/74 (43%), Gaps = 5/74 (6%)

Query: 5  ISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNEL 64
          I +   + +  I V+V+   + G     IVGL   A+ ES++R++S  +     F     
Sbjct: 4  IKSATLESLDAICVDVEATFTKGLPSFSIVGLASSAIQESKDRVKSALLTNDFKF----- 58

Query: 65 PSIYLQLIYQKKDL 78
          P   + +     D+
Sbjct: 59 PPKKITINLSPSDI 72


>gi|262038686|ref|ZP_06012046.1| Mg chelatase-like protein [Leptotrichia goodfellowii F0264]
 gi|261747238|gb|EEY34717.1| Mg chelatase-like protein [Leptotrichia goodfellowii F0264]
          Length = 506

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M   + + ++ GI+   VE +V +S G     IVG+ D A+IES+ERI+S F + GL   
Sbjct: 1  MAISVLSCSYLGIESYIVEAEVDISNGLPIFNIVGMGDLAIIESKERIRSCFKNIGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P   + +     D+
Sbjct: 58 --EFPVKRVLVNLSPADI 73


>gi|190570987|ref|YP_001975345.1| Mg chelatase-related protein [Wolbachia endosymbiont of Culex
          quinquefasciatus Pel]
 gi|213019504|ref|ZP_03335310.1| Mg chelatase-related protein [Wolbachia endosymbiont of Culex
          quinquefasciatus JHB]
 gi|190357259|emb|CAQ54683.1| Mg chelatase-related protein [Wolbachia endosymbiont of Culex
          quinquefasciatus Pel]
 gi|212994926|gb|EEB55568.1| Mg chelatase-related protein [Wolbachia endosymbiont of Culex
          quinquefasciatus JHB]
          Length = 503

 Score = 97.4 bits (242), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 43/79 (54%), Gaps = 5/79 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI+ I+T+A QG   + V  Q+ ++ G     IVGLPDK V ESRERI++      LL  
Sbjct: 1  MIANINTVALQGTSTVNVNAQIHMANGIPAFNIVGLPDKTVAESRERIRAALNSINLL-- 58

Query: 61 VNELPSIYLQLIYQKKDLI 79
             LP+  + +     DL+
Sbjct: 59 ---LPTKRITVNLSPADLL 74


>gi|149194677|ref|ZP_01871772.1| Mg chelatase-related protein [Caminibacter mediatlanticus TB-2]
 gi|149135100|gb|EDM23581.1| Mg chelatase-related protein [Caminibacter mediatlanticus TB-2]
          Length = 325

 Score = 97.4 bits (242), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 5/75 (6%)

Query: 4  RISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNE 63
          +I++    G +   VEV+   +    G  IVGL  +++ ES+ER++S  ++        E
Sbjct: 10 KINSATLNGFEAKKVEVESSFTKALPGFSIVGLGSQSIQESKERVKSALLNNDF-----E 64

Query: 64 LPSIYLQLIYQKKDL 78
           P + + +     DL
Sbjct: 65 FPPLKITISLSPADL 79


>gi|313202244|ref|YP_004040902.1| mg chelatase subunit chli [Methylovorus sp. MP688]
 gi|312441560|gb|ADQ85666.1| Mg chelatase, subunit ChlI [Methylovorus sp. MP688]
          Length = 483

 Score = 97.4 bits (242), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 5/66 (7%)

Query: 13 IKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSIYLQLI 72
          +   PV+V+V ++ G     IVGLP+  V ES++R+++    A       E P+  + + 
Sbjct: 1  MDAPPVDVEVHLANGFPSFTIVGLPEAEVKESKDRVRAALQTAQF-----EFPARRITVN 55

Query: 73 YQKKDL 78
              DL
Sbjct: 56 LAPADL 61


>gi|289610181|emb|CBI60306.1| unnamed protein product [Sordaria macrospora]
          Length = 94

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ +ST A+ G++   VEVQV ++PG     +VGL DKAV ESRER+++     GL   
Sbjct: 1  MVAIVSTAAYLGLEARRVEVQVQLAPGVPAFVVVGLADKAVGESRERVRAAIAAIGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 58 --SLPPKRITVNLSPADL 73


>gi|332670024|ref|YP_004453032.1| Mg chelatase, subunit ChlI [Cellulomonas fimi ATCC 484]
 gi|332339062|gb|AEE45645.1| Mg chelatase, subunit ChlI [Cellulomonas fimi ATCC 484]
          Length = 507

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R   +A  G+    VEV+  ++P      +VGLPD A+ E+R+R+++    +GL    
Sbjct: 3  LGRSWAVALVGLAAHVVEVEAHLAPSLPAFTLVGLPDAALAEARDRVRAAVTSSGLP--- 59

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +      L
Sbjct: 60 --WPNRRITVNLSPAAL 74


>gi|148284869|ref|YP_001248959.1| Mg chelatase-related protein [Orientia tsutsugamushi str.
          Boryong]
 gi|146740308|emb|CAM80700.1| Mg chelatase-related protein [Orientia tsutsugamushi str.
          Boryong]
          Length = 503

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 45/79 (56%), Gaps = 5/79 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++RIS++ + GI  + V++QV +S G     IVGL DK V E+RER+++     GL   
Sbjct: 1  MVTRISSVTWSGINVLDVDIQVKISTGIPCFTIVGLADKTVTEARERVKAALSSIGL--- 57

Query: 61 VNELPSIYLQLIYQKKDLI 79
             LP+  + +     DL+
Sbjct: 58 --ALPAKKILVNLAPADLV 74


>gi|146299899|ref|YP_001194490.1| Mg chelatase, subunit ChlI [Flavobacterium johnsoniae UW101]
 gi|146154317|gb|ABQ05171.1| Mg chelatase, subunit ChlI [Flavobacterium johnsoniae UW101]
          Length = 511

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ ++   A  G++   + ++V +  G  G  +VGLPD A+ ES  RI +   + GL F 
Sbjct: 1  MLVKVYGSAVFGVEATTITIEVHMDKGI-GYHLVGLPDNAIKESSYRIAAALKNNGLSF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 59 ----PGKKITINMAPADL 72


>gi|304392332|ref|ZP_07374273.1| putative Mg chelatase family protein [Ahrensia sp. R2A130]
 gi|303295436|gb|EFL89795.1| putative Mg chelatase family protein [Ahrensia sp. R2A130]
          Length = 509

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 48/78 (61%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++  +T+AFQGI  +PV+VQVM+ PG+  + IVGL DKAV ESRERI +    +GL   
Sbjct: 1  MVAHCATVAFQGITAVPVDVQVMIGPGKHAMHIVGLADKAVAESRERIGAALHASGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     DL
Sbjct: 58 --AMPHKKITVNLAPADL 73


>gi|313905319|ref|ZP_07838685.1| Mg chelatase, subunit ChlI [Eubacterium cellulosolvens 6]
 gi|313469789|gb|EFR65125.1| Mg chelatase, subunit ChlI [Eubacterium cellulosolvens 6]
          Length = 513

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M   + +    G+  +PV V+  VS G  G  IVG     + E+R+RI++  I+     +
Sbjct: 1  MYCSVISAGISGVDAVPVYVEADVSRGMPGFSIVGYVSSQIREARDRIRAALIN-----M 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 56 DISLPVNRITVNLAPGDL 73


>gi|189183512|ref|YP_001937297.1| hypothetical protein OTT_0605 [Orientia tsutsugamushi str. Ikeda]
 gi|189180283|dbj|BAG40063.1| hypothetical protein OTT_0605 [Orientia tsutsugamushi str. Ikeda]
          Length = 503

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 45/79 (56%), Gaps = 5/79 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++RIS++ + GI  + V++QV +S G     IVGL DK V E+RER+++     GL   
Sbjct: 1  MVTRISSVTWSGINVLDVDIQVKISTGIPCFTIVGLADKTVTEARERVKAALSSIGL--- 57

Query: 61 VNELPSIYLQLIYQKKDLI 79
             LP+  + +     DL+
Sbjct: 58 --ALPAKKILVNLAPADLV 74


>gi|291277233|ref|YP_003517005.1| Mg-chetalase related protein [Helicobacter mustelae 12198]
 gi|290964427|emb|CBG40277.1| Putative Mg-chetalase related protein [Helicobacter mustelae
          12198]
          Length = 503

 Score = 97.0 bits (241), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 33/78 (42%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +I      G+    VEV+   +       I GL   A+ ES++R+QS  +  G  F 
Sbjct: 1  MVHKIYCATRFGLYASIVEVEASFTRALPAFVISGLASNAIQESKQRVQSALVACGFSF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P + + +     DL
Sbjct: 60 ----PPLKITINLSPSDL 73


>gi|283458212|ref|YP_003362830.1| putative ATPase [Rothia mucilaginosa DY-18]
 gi|283134245|dbj|BAI65010.1| predicted ATPase with chaperone activity [Rothia mucilaginosa
          DY-18]
          Length = 512

 Score = 96.6 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           +R  ++A  G++G  V+V+  +S G  G  ++GLPD A+ ES+ER++S   + G+    
Sbjct: 3  FARTYSVALVGLRGHIVDVEADISQGLPGFVLLGLPDTALNESKERVRSAAKNTGITLTQ 62

Query: 62 NELPSIYLQLIYQKKDL 78
          +      L +      L
Sbjct: 63 H-----RLTVNLTPATL 74


>gi|78357849|ref|YP_389298.1| competence protein ComM [Desulfovibrio desulfuricans subsp.
          desulfuricans str. G20]
 gi|78220254|gb|ABB39603.1| competence protein ComM, putative [Desulfovibrio desulfuricans
          subsp. desulfuricans str. G20]
          Length = 228

 Score = 96.6 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 18/79 (22%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSP-GRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M++ I++ A  G+    V++++ ++  G     +VGL + AV E++ER+ +   + G   
Sbjct: 1  MLAGIASAALLGVDAFRVDIEIDLARQGMPSFSMVGLAEGAVREAKERVFAALRNTG--- 57

Query: 60 LVNELPSIYLQLIYQKKDL 78
            ++LP   + +      L
Sbjct: 58 --HKLPPSRITVNLAPASL 74


>gi|114566969|ref|YP_754123.1| Mg chelatase-like protein [Syntrophomonas wolfei subsp. wolfei
          str. Goettingen]
 gi|114337904|gb|ABI68752.1| Mg chelatase-related protein [Syntrophomonas wolfei subsp. wolfei
          str. Goettingen]
          Length = 511

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPG-RVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M++   T+   GI    V+V+V +  G     +IVGL   +V ESRER++S   ++G  F
Sbjct: 1  MLASFYTLVTAGIDAKSVKVEVDIQSGALPSFEIVGLAQTSVKESRERVRSAIKNSGYKF 60

Query: 60 LVNELPSIYLQLIYQKKD 77
               P+  + +     +
Sbjct: 61 -----PNRKIIINLAPAN 73


>gi|302865903|ref|YP_003834540.1| Mg chelatase subunit ChlI [Micromonospora aurantiaca ATCC 27029]
 gi|302568762|gb|ADL44964.1| Mg chelatase, subunit ChlI [Micromonospora aurantiaca ATCC 27029]
          Length = 506

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           +++ ++   G+ G  VEV+  ++PG   V I GLPD A+ E+R+R+++  +++G     
Sbjct: 3  YAKVLSVGLAGVAGHLVEVEADLAPGLPAVIISGLPDTALHEARDRVRAAIVNSG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
           + P+  + L      L
Sbjct: 58 QKWPNRRITLNLLPATL 74


>gi|296129326|ref|YP_003636576.1| Mg chelatase, subunit ChlI [Cellulomonas flavigena DSM 20109]
 gi|296021141|gb|ADG74377.1| Mg chelatase, subunit ChlI [Cellulomonas flavigena DSM 20109]
          Length = 505

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ R   +A  G+ G  V+V+  ++       +VGLPD ++ E+R+R+++     G+   
Sbjct: 1  MLGRTRAVALVGLVGHLVDVESHLAASLPAFTLVGLPDASLAEARDRVRAAVTSCGMT-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +      L
Sbjct: 59 ---WPNRRITVNLSPATL 73


>gi|169630294|ref|YP_001703943.1| putative magnesium chelatase [Mycobacterium abscessus ATCC 19977]
 gi|169242261|emb|CAM63289.1| Putative magnesium chelatase [Mycobacterium abscessus]
          Length = 499

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  ++A + + G  VE++  +S G  GV +VGLPD A+ ESR+R+++   + G     
Sbjct: 3  LGRAYSVAVKAVTGQTVEIEADISAGLPGVHLVGLPDAALQESRDRVRAAITNCGFT--- 59

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  L L      L
Sbjct: 60 --WPASRLTLALSPATL 74


>gi|255326006|ref|ZP_05367094.1| putative Mg chelatase [Rothia mucilaginosa ATCC 25296]
 gi|255296897|gb|EET76226.1| putative Mg chelatase [Rothia mucilaginosa ATCC 25296]
          Length = 512

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           +R  ++A  G++G  V+V+  +S G  G  ++GLPD A+ ES+ER++S   + G+    
Sbjct: 3  FARTYSVALVGLRGHIVDVEADISQGLPGFVLLGLPDTALNESKERVRSAAKNTGITLTQ 62

Query: 62 NELPSIYLQLIYQKKDL 78
          +      L +      L
Sbjct: 63 H-----RLTVNLTPATL 74


>gi|291542178|emb|CBL15288.1| Mg chelatase-related protein [Ruminococcus bromii L2-63]
          Length = 509

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+   ++    G+ G  VE++  +  G     +VGLPD AV ES++R+ S   + G  + 
Sbjct: 1  MVVTCNSFGVSGMDGYKVELEASMYNGTREFDMVGLPDAAVRESKDRVLSALKNCGFRY- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+ ++ +     D+
Sbjct: 60 ----PAAHMTVNLAPADI 73


>gi|163755202|ref|ZP_02162322.1| magnesium chelatase, subunit ChlI [Kordia algicida OT-1]
 gi|161324622|gb|EDP95951.1| magnesium chelatase, subunit ChlI [Kordia algicida OT-1]
          Length = 512

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ ++   A  GI+   + V+V ++ G  G  +VGLPD A+ ES  RI S   + G    
Sbjct: 1  MLKKVYGSAVFGIEATTITVEVNIAKGI-GYHLVGLPDNAIRESNYRIASALQNNGYK-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     DL
Sbjct: 58 ---IPGKKITINMAPADL 72


>gi|331085947|ref|ZP_08335030.1| Mg chelatase [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|330406870|gb|EGG86375.1| Mg chelatase [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 517

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 35/78 (44%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S + + + QG++   + V+  V  G     +VG     V ES ER+++   ++G    
Sbjct: 1  MFSTVLSASLQGMQAEFIHVEADVGNGLPFFHMVGHLASEVKESAERVRTAVKNSG---- 56

Query: 61 VNELPSIYLQLIYQKKDL 78
            ++P   + +     ++
Sbjct: 57 -IQIPPRKVVINLSPANV 73


>gi|149186354|ref|ZP_01864667.1| Mg chelatase-related protein [Erythrobacter sp. SD-21]
 gi|148829943|gb|EDL48381.1| Mg chelatase-related protein [Erythrobacter sp. SD-21]
          Length = 495

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 38/71 (53%), Gaps = 5/71 (7%)

Query: 8  IAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSI 67
          +A+ G++   VEVQ  ++PG     IVGL DKAV ES+ER+++     GL      LP  
Sbjct: 1  MAYLGLEARRVEVQCSLAPGLPNFNIVGLADKAVGESKERVRAALSSMGL-----ALPPK 55

Query: 68 YLQLIYQKKDL 78
           + +     DL
Sbjct: 56 RITINLSPADL 66


>gi|257463860|ref|ZP_05628246.1| Mg(2+) chelatase family protein [Fusobacterium sp. D12]
          Length = 500

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M   I + A+ G+    +EV+V +  G     IVGL D A++ESR R+++   ++G    
Sbjct: 1  MNFCIYSSAYLGVTPYVIEVEVDIGRGLPTFSIVGLGDTAILESRYRVKTALKNSGYP-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             L    + +      L
Sbjct: 59 ---LSPQRIIINLSPAGL 73


>gi|320532030|ref|ZP_08032921.1| conserved domain protein [Actinomyces sp. oral taxon 171 str.
          F0337]
 gi|320135756|gb|EFW27813.1| conserved domain protein [Actinomyces sp. oral taxon 171 str.
          F0337]
          Length = 150

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++R   +   G+ G  V+V+     G  G  +VGLPD AV ESRER+++     G+    
Sbjct: 3  LARTLAVTLTGLAGHIVDVEAHSVQGLPGFTLVGLPDTAVRESRERVRAALSTCGVT--- 59

Query: 62 NELPSIYLQLIYQKKDL 78
                 L +     DL
Sbjct: 60 --WGEQRLTVNLSPADL 74


>gi|118464223|ref|YP_882923.1| Mg-chelatase subunits D/I family protein, ComM subfamily protein
          [Mycobacterium avium 104]
 gi|118165510|gb|ABK66407.1| Mg-chelatase subunits D/I family protein, ComM subfamily protein
          [Mycobacterium avium 104]
          Length = 503

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  ++A +G+ G  VE++  ++ G  GV +VGLPD A+ ESR+R+++   +       
Sbjct: 3  LGRAFSVAVRGVDGQIVEIEADITSGLPGVHLVGLPDAALQESRDRVRAAVSNC-----T 57

Query: 62 NELPSIYLQLIYQKKDL 78
          N  P   L L      L
Sbjct: 58 NNWPQARLTLALSPATL 74


>gi|315502460|ref|YP_004081347.1| mg chelatase, subunit chli [Micromonospora sp. L5]
 gi|315409079|gb|ADU07196.1| Mg chelatase, subunit ChlI [Micromonospora sp. L5]
          Length = 506

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           +++ ++   G+ G  VEV+  ++PG   V I GLPD A+ E+R+R+++  +++G     
Sbjct: 3  YAKVLSVGLAGVAGHLVEVEADLAPGLPAVIISGLPDTALHEARDRVRAAIVNSG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
           + P+  + L      L
Sbjct: 58 QKWPNRRITLNLLPATL 74


>gi|209966220|ref|YP_002299135.1| Mg chelatase related protein [Rhodospirillum centenum SW]
 gi|209959686|gb|ACJ00323.1| Mg chelatase related protein [Rhodospirillum centenum SW]
          Length = 521

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 32/79 (40%), Positives = 49/79 (62%), Gaps = 5/79 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ST+AFQGI  + ++VQV +S G +   +VGLPDKAV ESRER+++     GL   
Sbjct: 1  MVARVSTVAFQGIDVLDIDVQVQMSGGELAFIVVGLPDKAVAESRERVRAALHALGL--- 57

Query: 61 VNELPSIYLQLIYQKKDLI 79
             LP   + +     D++
Sbjct: 58 --SLPPRRIAVNLAPADVL 74


>gi|88606720|ref|YP_505333.1| magnesium chelatase subunit D/I family protein [Anaplasma
          phagocytophilum HZ]
 gi|88597783|gb|ABD43253.1| magnesium chelatase, subunit D/I family, ComM subfamily
          [Anaplasma phagocytophilum HZ]
          Length = 517

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ ++T+AF G+  + V VQV ++ G     IVG+PDK V ESRERI++          
Sbjct: 1  MLADVNTVAFVGVCTVDVIVQVHIANGIPSFHIVGMPDKVVAESRERIRAALTSI----- 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +      L
Sbjct: 56 KAPLPLKRITVNLSPASL 73


>gi|226226570|ref|YP_002760676.1| hypothetical protein GAU_1164 [Gemmatimonas aurantiaca T-27]
 gi|226089761|dbj|BAH38206.1| hypothetical protein [Gemmatimonas aurantiaca T-27]
          Length = 518

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++   + A  GI  + V V+V V+ G     +VGL   AV ESR+R+ +  +++G    
Sbjct: 1  MLAAAPSAAVLGIDALDVLVEVHVANGLPQWTLVGLAATAVKESRDRVHAALVNSGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
              PS  + +     D+
Sbjct: 58 --AAPSKRITISLTPGDV 73


>gi|257452278|ref|ZP_05617577.1| Mg(2+) chelatase family protein [Fusobacterium sp. 3_1_5R]
          Length = 499

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M   I + A+ G+    +EV+V +S G     IVGL D A++ESR R+++   ++G L  
Sbjct: 1  MNFCIYSSAYLGVTPYVIEVEVDISAGLPTFSIVGLGDTAILESRYRVKTALKNSGYL-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             L    + +      L
Sbjct: 59 ---LSPKRIVINLSPAGL 73


>gi|317061391|ref|ZP_07925876.1| Mg(2+) chelatase [Fusobacterium sp. D12]
 gi|313687067|gb|EFS23902.1| Mg(2+) chelatase [Fusobacterium sp. D12]
          Length = 503

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M   I + A+ G+    +EV+V +  G     IVGL D A++ESR R+++   ++G    
Sbjct: 4  MNFCIYSSAYLGVTPYVIEVEVDIGRGLPTFSIVGLGDTAILESRYRVKTALKNSGYP-- 61

Query: 61 VNELPSIYLQLIYQKKDL 78
             L    + +      L
Sbjct: 62 ---LSPQRIIINLSPAGL 76


>gi|257465922|ref|ZP_05630233.1| Mg(2+) chelatase family protein [Fusobacterium gonidiaformans
          ATCC 25563]
          Length = 500

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M   I + A+ G+    +EV+V +S G     IVGL D A++ESR R+++   ++G L  
Sbjct: 1  MNFCIYSSAYLGVTPYVIEVEVDISAGLPTFSIVGLGDTAILESRYRVKTALKNSGYL-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             L    + +      L
Sbjct: 59 ---LSPKRIVINLSPAGL 73


>gi|41409060|ref|NP_961896.1| hypothetical protein MAP2962c [Mycobacterium avium subsp.
          paratuberculosis K-10]
 gi|41397419|gb|AAS05279.1| hypothetical protein MAP_2962c [Mycobacterium avium subsp.
          paratuberculosis K-10]
          Length = 503

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  ++A +G+ G  VE++  ++ G  GV +VGLPD A+ ESR+R+++   +       
Sbjct: 3  LGRAFSVAVRGVDGQIVEIEADITSGLPGVHLVGLPDAALQESRDRVRAAVSNC-----T 57

Query: 62 NELPSIYLQLIYQKKDL 78
          N  P   L L      L
Sbjct: 58 NNWPQARLTLALSPATL 74


>gi|162147756|ref|YP_001602217.1| Mg chelatase-like protein [Gluconacetobacter diazotrophicus PAl
          5]
 gi|161786333|emb|CAP55915.1| putative Mg chelatase-related protein [Gluconacetobacter
          diazotrophicus PAl 5]
          Length = 522

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          IS +   AF GI  IPV V+V ++ G     IVGL DKAV E+RER+++     GL    
Sbjct: 22 ISCVLGFAFSGIDAIPVRVEVQLASGLPSFLIVGLADKAVAEARERVRAALSAMGLT--- 78

Query: 62 NELPSIYLQLIYQKKDLI 79
            LP+  + +     +++
Sbjct: 79 --LPAKRIVVNLAPANIV 94


>gi|295134651|ref|YP_003585327.1| magnesium chelatase, subunit ChlI [Zunongwangia profunda SM-A87]
 gi|294982666|gb|ADF53131.1| magnesium chelatase, subunit ChlI [Zunongwangia profunda SM-A87]
          Length = 511

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ ++   A  G++   + V+V +  G  G  +VGLPD AV ES  RI +   + G  F 
Sbjct: 1  MLVKVYGSAVFGVEATTIAVEVNIDKGI-GYHLVGLPDNAVKESSFRIAAALQNNGFKF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 59 ----PGKKIIVNMAPADL 72


>gi|254776196|ref|ZP_05217712.1| hypothetical protein MaviaA2_16208 [Mycobacterium avium subsp.
          avium ATCC 25291]
          Length = 503

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  ++A +G+ G  VE++  ++ G  GV +VGLPD A+ ESR+R+++   +       
Sbjct: 3  LGRAFSVAVRGVDGQIVEIEADITSGLPGVHLVGLPDAALQESRDRVRAAVSNC-----T 57

Query: 62 NELPSIYLQLIYQKKDL 78
          N  P   L L      L
Sbjct: 58 NNWPQARLTLALSPATL 74


>gi|288942033|ref|YP_003444273.1| Mg chelatase subunit ChlI [Allochromatium vinosum DSM 180]
 gi|288897405|gb|ADC63241.1| Mg chelatase, subunit ChlI [Allochromatium vinosum DSM 180]
          Length = 508

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +  + +    GI+  PV V+V +S G   + IVGLP+ AV ES++R+    ++    F  
Sbjct: 3  LCILHSRGRLGIEAPPVTVEVQLSGGLPAMSIVGLPEMAVRESKDRVHGALVNNSFQF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +     DL
Sbjct: 61 ---PNGRVTINLAPADL 74


>gi|284032636|ref|YP_003382567.1| Mg chelatase subunit ChlI [Kribbella flavida DSM 17836]
 gi|283811929|gb|ADB33768.1| Mg chelatase, subunit ChlI [Kribbella flavida DSM 17836]
          Length = 526

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 16/77 (20%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +++  ++A  G++G  VE++  ++ G     ++GLPD ++ E+R+R+++  +++G     
Sbjct: 3  LAQAWSVALVGLEGHLVEIEADIAQGLPKTTLIGLPDASLSEARDRVRAAVVNSG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +      L
Sbjct: 58 ERFPDRKVTIGLSPATL 74


>gi|258645676|ref|ZP_05733145.1| Mg chelatase-like protein [Dialister invisus DSM 15470]
 gi|260403043|gb|EEW96590.1| Mg chelatase-like protein [Dialister invisus DSM 15470]
          Length = 505

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +++      G+ G  + V+V +S       IVGLP  +V ES+ER+QS   ++G  F 
Sbjct: 1  MFAQVFGTCTFGLNGHVITVEVDISRASPAFDIVGLPAVSVKESKERVQSAIRNSGYFF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PIEKVTVNLAPADL 73


>gi|300024717|ref|YP_003757328.1| Mg chelatase, subunit ChlI [Hyphomicrobium denitrificans ATCC
          51888]
 gi|299526538|gb|ADJ25007.1| Mg chelatase, subunit ChlI [Hyphomicrobium denitrificans ATCC
          51888]
          Length = 509

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 47/78 (60%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  +IST+AF GI+  PVEVQV V+PG     IVGLPDKAV ESRER+++     GL   
Sbjct: 1  MYGQISTLAFIGIEARPVEVQVRVTPGAAAFAIVGLPDKAVAESRERVRNALHAVGLG-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP  ++ +     DL
Sbjct: 59 ---LPFKHITVNLAPADL 73


>gi|119503721|ref|ZP_01625803.1| competence related protein [marine gamma proteobacterium
          HTCC2080]
 gi|119460229|gb|EAW41322.1| competence related protein [marine gamma proteobacterium
          HTCC2080]
          Length = 495

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 5/76 (6%)

Query: 3  SRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVN 62
          S + + A  G+K   V+V+  +S G     +VGLP+ +V ESRER++S  I +       
Sbjct: 4  SVVLSRAGIGLKAPLVKVEAHLSTGLPAFSVVGLPESSVRESRERVRSALICSHFK---- 59

Query: 63 ELPSIYLQLIYQKKDL 78
            P   + +     +L
Sbjct: 60 -WPDRRITVSLAPAEL 74


>gi|317057554|ref|YP_004106021.1| Mg chelatase subunit ChlI [Ruminococcus albus 7]
 gi|315449823|gb|ADU23387.1| Mg chelatase, subunit ChlI [Ruminococcus albus 7]
          Length = 509

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +RI+++   G+    V V++  S G     IVG+ D +V ESRERI+S F  +G+ F 
Sbjct: 1  MYARINSLGLLGLNAFDVTVEIESSEGLESFDIVGMADISVKESRERIRSAFRSSGINF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 60 ----PQARVLVNLAPADV 73


>gi|88797190|ref|ZP_01112780.1| Mg chelatase-related protein [Reinekea sp. MED297]
 gi|88780059|gb|EAR11244.1| Mg chelatase-related protein [Reinekea sp. MED297]
          Length = 487

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 5/66 (7%)

Query: 13 IKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSIYLQLI 72
          +    V ++V +S G     IVGLP+ AV E+++R++S  ++        E P+  L + 
Sbjct: 1  MDAPLVTIEVHLSSGLPAFNIVGLPEAAVREAKDRVRSAILN-----GQLEFPNGRLTVN 55

Query: 73 YQKKDL 78
              DL
Sbjct: 56 MAPADL 61


>gi|28572468|ref|NP_789248.1| hypothetical protein TW313 [Tropheryma whipplei TW08/27]
 gi|28410600|emb|CAD66986.1| conserved hypothetical protein [Tropheryma whipplei TW08/27]
          Length = 511

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI++  ++A  G++   VE++  +  G     +VGLPD A++E+RERI++   ++ L   
Sbjct: 1  MIAKTYSVALNGLQSSMVELEADIGNGLPIFTLVGLPDAALLEARERIRAACKNSDLP-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             L +  + +      +
Sbjct: 59 ---LSNRKITVNLSPASI 73


>gi|237785756|ref|YP_002906461.1| hypothetical protein ckrop_1173 [Corynebacterium kroppenstedtii
          DSM 44385]
 gi|237758668|gb|ACR17918.1| hypothetical protein ckrop_1173 [Corynebacterium kroppenstedtii
          DSM 44385]
          Length = 557

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  ++A QGI GIP+ ++    PG  G+ +VGL D AV E+R+RI+S   ++GL    
Sbjct: 3  VGRTYSVALQGISGIPISIEADSGPGLPGMNVVGLGDTAVSEARDRIRSAARNSGL---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +      L
Sbjct: 59 -EWPKTKIVVSLSPASL 74


>gi|28493421|ref|NP_787582.1| competence protein ComM [Tropheryma whipplei str. Twist]
 gi|28476462|gb|AAO44551.1| competence protein ComM [Tropheryma whipplei str. Twist]
          Length = 511

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI++  ++A  G++   VE++  +  G     +VGLPD A++E+RERI++   ++ L   
Sbjct: 1  MIAKTYSVALNGLQSSMVELEADIGNGLPIFTLVGLPDAALLEARERIRAACKNSDLP-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             L +  + +      +
Sbjct: 59 ---LSNRKITVNLSPASI 73


>gi|303325757|ref|ZP_07356200.1| Mg chelatase-like protein [Desulfovibrio sp. 3_1_syn3]
 gi|302863673|gb|EFL86604.1| Mg chelatase-like protein [Desulfovibrio sp. 3_1_syn3]
          Length = 511

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 34/77 (44%), Gaps = 6/77 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVM-VSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M+ R+ +   +G+   PVEV+V  V  G  G  +VGL +  V E+R+R+ +         
Sbjct: 1  MVIRLYSGGLEGVDAFPVEVEVDYVRRGLPGFSLVGLAETEVREARDRVFAALRACNFR- 59

Query: 60 LVNELPSIYLQLIYQKK 76
              LP   + +     
Sbjct: 60 ----LPPARITVNLAPA 72


>gi|302525182|ref|ZP_07277524.1| magnesium chelatase [Streptomyces sp. AA4]
 gi|302434077|gb|EFL05893.1| magnesium chelatase [Streptomyces sp. AA4]
          Length = 503

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 39/76 (51%), Gaps = 5/76 (6%)

Query: 3  SRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVN 62
          ++  ++A  GI+G  VE++  +  G   V +VGLPD  + E+++R++S   ++G      
Sbjct: 4  AKTWSVALLGIEGRVVEIEADLGGGLSRVTLVGLPDAGLREAKDRVRSAVRNSG-----Q 58

Query: 63 ELPSIYLQLIYQKKDL 78
            P   + L     +L
Sbjct: 59 SWPDGKITLALSPANL 74


>gi|329121226|ref|ZP_08249853.1| competence protein ComM [Dialister micraerophilus DSM 19965]
 gi|327470160|gb|EGF15623.1| competence protein ComM [Dialister micraerophilus DSM 19965]
          Length = 505

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +++      G+ G  + V+  ++       IVGLP  +V ES+ER+ S   ++G  F 
Sbjct: 1  MFAQVYGTTTYGLNGHVIIVETDINRAAPSFDIVGLPATSVKESKERVYSAIKNSGYHF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PINKVTVNLAPADL 73


>gi|313892574|ref|ZP_07826161.1| Mg chelatase-like protein [Dialister microaerophilus UPII 345-E]
 gi|313118971|gb|EFR42176.1| Mg chelatase-like protein [Dialister microaerophilus UPII 345-E]
          Length = 506

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +++      G+ G  + V+  ++       IVGLP  +V ES+ER+ S   ++G  F 
Sbjct: 1  MFAQVYGTTTYGLNGHVIIVETDINRAAPSFDIVGLPATSVKESKERVYSAIKNSGYHF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 60 ----PINKVTVNLAPADL 73


>gi|295093366|emb|CBK82457.1| Predicted ATPase with chaperone activity [Coprococcus sp.
          ART55/1]
          Length = 244

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 35/78 (44%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S++ +   QGI G  + V+  +  G   + +VG     V E+ ER+++   ++G    
Sbjct: 1  MYSKVLSGLVQGIDGTLISVETDIHDGLPVMNMVGYLSSCVKEAGERVRTALRNSGFN-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     D+
Sbjct: 59 ---IPPKRITINLFPADI 73


>gi|300780926|ref|ZP_07090780.1| Mg chelatase-like protein [Corynebacterium genitalium ATCC 33030]
 gi|300532633|gb|EFK53694.1| Mg chelatase-like protein [Corynebacterium genitalium ATCC 33030]
          Length = 510

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++   +   +G+    V V+  V PG  G+ IVGL DKAV ESR+RI++   ++GL    
Sbjct: 3  LASTYSATVEGVTAHSVTVEANVGPGLPGMHIVGLGDKAVGESRDRIRTAVANSGLP--- 59

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +     +L
Sbjct: 60 --WPRTKIMVSLSPANL 74


>gi|311744112|ref|ZP_07717918.1| Mg chelatase-like protein [Aeromicrobium marinum DSM 15272]
 gi|311313242|gb|EFQ83153.1| Mg chelatase-like protein [Aeromicrobium marinum DSM 15272]
          Length = 527

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 36/76 (47%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +   ++   G+ G P+E++V +S G     +VGLPD  V E+R+R ++   ++G    
Sbjct: 1  MAASTRSVTLDGLTGRPIEIEVDISGGLPTTVLVGLPDATVNEARDRCRAAVSNSG---- 56

Query: 61 VNELPSIYLQLIYQKK 76
              P   + +     
Sbjct: 57 -TSWPDQRVTINLAPS 71


>gi|255505126|ref|ZP_05344618.3| Mg chelatase-like protein [Bryantella formatexigens DSM 14469]
 gi|255269154|gb|EET62359.1| Mg chelatase-like protein [Bryantella formatexigens DSM 14469]
          Length = 504

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 33/72 (45%), Gaps = 5/72 (6%)

Query: 7  TIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPS 66
          + +  G++  PV V+  ++ G     +VG     V E++ER+++   ++GL      +  
Sbjct: 2  SASVLGVESRPVNVEADITDGLPSFTMVGFLSTQVREAQERVRTALKNSGLR-----MEP 56

Query: 67 IYLQLIYQKKDL 78
            + +     D+
Sbjct: 57 KKITVNLSPADV 68


>gi|209542380|ref|YP_002274609.1| Mg chelatase subunit ChlI [Gluconacetobacter diazotrophicus PAl
          5]
 gi|209530057|gb|ACI49994.1| Mg chelatase, subunit ChlI [Gluconacetobacter diazotrophicus PAl
          5]
          Length = 503

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          IS +   AF GI  IPV V+V ++ G     IVGL DKAV E+RER+++     GL    
Sbjct: 3  ISCVLGFAFSGIDAIPVRVEVQLASGLPSFLIVGLADKAVAEARERVRAALSAMGLT--- 59

Query: 62 NELPSIYLQLIYQKKDLI 79
            LP+  + +     +++
Sbjct: 60 --LPAKRIVVNLAPANIV 75


>gi|330466301|ref|YP_004404044.1| Mg chelatase subunit ChlI [Verrucosispora maris AB-18-032]
 gi|328809272|gb|AEB43444.1| Mg chelatase subunit ChlI [Verrucosispora maris AB-18-032]
          Length = 505

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           +R+  +   G+ G  VEV+  ++PG   V I GLPD A+ E+R+R+++  +++G     
Sbjct: 3  YARVLCVGLVGVTGHLVEVEADLAPGLPAVVISGLPDTALHEARDRVRAAVVNSG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L      L
Sbjct: 58 QRWPNRRITLNLLPATL 74


>gi|237749812|ref|ZP_04580292.1| DNA transformation competence protein [Helicobacter bilis ATCC
          43879]
 gi|229374562|gb|EEO24953.1| DNA transformation competence protein [Helicobacter bilis ATCC
          43879]
          Length = 510

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 33/78 (42%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++RI      G+    +EV+   + G     I GL   ++ ES+ R+ S   +     L
Sbjct: 1  MVNRIYCATQDGLNSKIIEVEATFTRGLPTFNITGLASSSIKESQHRVTSALAN-----L 55

Query: 61 VNELPSIYLQLIYQKKDL 78
            + P + L +     DL
Sbjct: 56 SIDFPPLKLTINLSPSDL 73


>gi|332297104|ref|YP_004439026.1| Mg chelatase, subunit ChlI [Treponema brennaborense DSM 12168]
 gi|332180207|gb|AEE15895.1| Mg chelatase, subunit ChlI [Treponema brennaborense DSM 12168]
          Length = 511

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 5/74 (6%)

Query: 5  ISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNEL 64
          I + +  G +G  V V+V +  G   + +VGL D AV ESRER+++   +AG      E 
Sbjct: 3  IFSFSPFGYEGSLVTVEVDLRRGIPAIDMVGLADGAVRESRERMRAAVRNAGF-----EF 57

Query: 65 PSIYLQLIYQKKDL 78
          P   + +     D+
Sbjct: 58 PPERILISLSPADI 71


>gi|150025660|ref|YP_001296486.1| hypothetical protein FP1610 [Flavobacterium psychrophilum
          JIP02/86]
 gi|149772201|emb|CAL43677.1| Protein of unknown function [Flavobacterium psychrophilum
          JIP02/86]
          Length = 511

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ ++   A  G++   + V+V +  G  G  +VGLPD A+ ES  RI +   + G    
Sbjct: 1  MLVKVFGSAVFGVEATTITVEVNIDKGV-GYHLVGLPDNAIKESSYRIAAALKNNGYN-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 58 ---LPVKKITINMAPADL 72


>gi|319955135|ref|YP_004166402.1| mg chelatase, subunit chli [Cellulophaga algicola DSM 14237]
 gi|319423795|gb|ADV50904.1| Mg chelatase, subunit ChlI [Cellulophaga algicola DSM 14237]
          Length = 511

 Score = 95.4 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++   A  G++   + V+V V  G  G  +VGLPD A+ ES  RI +   + G    
Sbjct: 1  MLTKVYGSAVFGVEATTITVEVNVDKGI-GYHLVGLPDNAIKESNYRIAAALQNNGYK-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   L +     DL
Sbjct: 58 ---IPGKKLTINMAPADL 72


>gi|317058821|ref|ZP_07923306.1| Mg(2+) chelatase [Fusobacterium sp. 3_1_5R]
 gi|313684497|gb|EFS21332.1| Mg(2+) chelatase [Fusobacterium sp. 3_1_5R]
          Length = 502

 Score = 95.0 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 8/81 (9%)

Query: 1  MIS---RISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGL 57
          MIS    I + A+ G+    +EV+V +S G     IVGL D A++ESR R+++   ++G 
Sbjct: 1  MISVNFCIYSSAYLGVTPYVIEVEVDISAGLPTFSIVGLGDTAILESRYRVKTALKNSGY 60

Query: 58 LFLVNELPSIYLQLIYQKKDL 78
          L     L    + +      L
Sbjct: 61 L-----LSPKRIVINLSPAGL 76


>gi|325681140|ref|ZP_08160670.1| Mg chelatase-like protein [Ruminococcus albus 8]
 gi|324107062|gb|EGC01348.1| Mg chelatase-like protein [Ruminococcus albus 8]
          Length = 509

 Score = 95.0 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +RI+++   G+   PV  ++  S G     IVGL D +V ESRERI+S F   G+ F 
Sbjct: 1  MYARINSLGLLGLNAFPVTCEIECSEGMDSFDIVGLADISVKESRERIRSAFRSCGMNF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 60 ----PEARVLVNLAPADV 73


>gi|315917078|ref|ZP_07913318.1| Mg(2+) chelatase [Fusobacterium gonidiaformans ATCC 25563]
 gi|313690953|gb|EFS27788.1| Mg(2+) chelatase [Fusobacterium gonidiaformans ATCC 25563]
          Length = 503

 Score = 95.0 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 8/81 (9%)

Query: 1  MIS---RISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGL 57
          MIS    I + A+ G+    +EV+V +S G     IVGL D A++ESR R+++   ++G 
Sbjct: 1  MISVNFCIYSSAYLGVTPYVIEVEVDISAGLPTFSIVGLGDTAILESRYRVKTALKNSGY 60

Query: 58 LFLVNELPSIYLQLIYQKKDL 78
          L     L    + +      L
Sbjct: 61 L-----LSPKRIVINLSPAGL 76


>gi|304320166|ref|YP_003853809.1| ComM protein [Parvularcula bermudensis HTCC2503]
 gi|303299069|gb|ADM08668.1| ComM protein [Parvularcula bermudensis HTCC2503]
          Length = 519

 Score = 95.0 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ +++ AF GI+  PV VQ  ++ G     IVG+ +K+V E+RERI + F   GL   
Sbjct: 1  MVTEVTSFAFDGIEARPVTVQAQITGGNPKFFIVGMAEKSVSEARERIWAAFSAIGLG-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     DL
Sbjct: 59 ---VPPKRITINLAPADL 73


>gi|325287913|ref|YP_004263703.1| Mg chelatase subunit ChlI [Cellulophaga lytica DSM 7489]
 gi|324323367|gb|ADY30832.1| Mg chelatase, subunit ChlI [Cellulophaga lytica DSM 7489]
          Length = 511

 Score = 95.0 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 38/78 (48%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++   A  G++   + V+V ++ G  G  +VGLPD A+ ES  RI +   + G    
Sbjct: 1  MLTKVFGSAVFGVEATTITVEVNINKGI-GYHLVGLPDNAIKESNYRIAAALQNNGYK-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     DL
Sbjct: 58 ---IPGKKITINMAPADL 72


>gi|42520564|ref|NP_966479.1| Mg chelatase-related protein [Wolbachia endosymbiont of
          Drosophila melanogaster]
 gi|42410303|gb|AAS14413.1| Mg chelatase-related protein [Wolbachia endosymbiont of
          Drosophila melanogaster]
          Length = 502

 Score = 95.0 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 43/79 (54%), Gaps = 5/79 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI+ I+T+  QGI  + V  Q+ ++ G     IVGLPDK V ES+ERI++      LL  
Sbjct: 1  MIANINTVVLQGISTVNVNAQIHMANGIPAFNIVGLPDKTVAESKERIRAALNSINLL-- 58

Query: 61 VNELPSIYLQLIYQKKDLI 79
             LP   + +    +DL+
Sbjct: 59 ---LPPKRITVNLSPEDLL 74


>gi|126663895|ref|ZP_01734890.1| magnesium chelatase subunit ChlI [Flavobacteria bacterium BAL38]
 gi|126624159|gb|EAZ94852.1| magnesium chelatase subunit ChlI [Flavobacteria bacterium BAL38]
          Length = 511

 Score = 95.0 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ ++   A  G++   + V+V +  G  G  +VGLPD A+ ES  RI +   +    F 
Sbjct: 1  MLVKVFGSAVFGVEATTITVEVNIDKGI-GYHLVGLPDSAIKESSYRIAAALKNNNYNF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 59 ----PGKKITVNMAPADL 72


>gi|297559214|ref|YP_003678188.1| Mg chelatase, subunit ChlI [Nocardiopsis dassonvillei subsp.
          dassonvillei DSM 43111]
 gi|296843662|gb|ADH65682.1| Mg chelatase, subunit ChlI [Nocardiopsis dassonvillei subsp.
          dassonvillei DSM 43111]
          Length = 507

 Score = 95.0 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++R   IA  G++G  VEV+V +  G  GV +VGLPD A+ E+R+RI++  +++G     
Sbjct: 3  LARTRCIALLGVQGHIVEVEVHLGGGDFGVTLVGLPDAALREARDRIRAAVVNSG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
           E PS  + +      L
Sbjct: 58 EEWPSGQIVISLSPASL 74


>gi|153006589|ref|YP_001380914.1| Mg chelatase, subunit ChlI [Anaeromyxobacter sp. Fw109-5]
 gi|152030162|gb|ABS27930.1| Mg chelatase, subunit ChlI [Anaeromyxobacter sp. Fw109-5]
          Length = 506

 Score = 95.0 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ RI + A  G++ IPV+V+V  + G  G  +VGL   AV E++ R+ +   + G+   
Sbjct: 1  MLVRIRSGAVLGVQAIPVDVEVESTVGMPGFHLVGLATGAVQEAKVRVAAAVRNLGVT-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 59 ---LPQKRITVNLAPADL 73


>gi|291280461|ref|YP_003497296.1| Mg chelatase-related protein [Deferribacter desulfuricans SSM1]
 gi|290755163|dbj|BAI81540.1| Mg chelatase-related protein [Deferribacter desulfuricans SSM1]
          Length = 508

 Score = 95.0 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 39/78 (50%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSP-GRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M ++++T   +GI+ + VEV+  +S  G     +VGL + ++ ES+ER++S   + G   
Sbjct: 1  MFAKVTTAHLEGIEPVLVEVEANISSMGLPSFSVVGLAETSIKESKERVKSALKNFGFNI 60

Query: 60 LVNELPSIYLQLIYQKKD 77
                +  + +     D
Sbjct: 61 F-----AKPIIINLAPAD 73


>gi|291087723|ref|ZP_06347291.2| Mg chelatase-like protein [Clostridium sp. M62/1]
 gi|291074117|gb|EFE11481.1| Mg chelatase-like protein [Clostridium sp. M62/1]
          Length = 570

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 15/75 (20%), Positives = 34/75 (45%), Gaps = 5/75 (6%)

Query: 2   ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
            S+  +   +G++G  V ++  +S G     +VG   + V E++ER+++   ++G     
Sbjct: 51  FSKTVSCGIRGVEGYLVAIETDMSSGIPSFNMVGYLSEEVREAQERVRTALRNSG----- 105

Query: 62  NELPSIYLQLIYQKK 76
             LP   + +     
Sbjct: 106 VLLPPRRITVNLSPA 120


>gi|238916739|ref|YP_002930256.1| magnesium chelatase family protein [Eubacterium eligens ATCC
          27750]
 gi|238872099|gb|ACR71809.1| magnesium chelatase family protein [Eubacterium eligens ATCC
          27750]
          Length = 510

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 19/72 (26%), Positives = 30/72 (41%), Gaps = 5/72 (6%)

Query: 7  TIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPS 66
          +    GIK   V V+V V  G     + G     V E+RER++    ++G      ELP 
Sbjct: 2  SGVLHGIKAQIVRVEVDVGNGIPSFDMSGFLSNEVKEARERVRVAIRNSGY-----ELPP 56

Query: 67 IYLQLIYQKKDL 78
            + +     D+
Sbjct: 57 QRIAVNISPADI 68


>gi|296139359|ref|YP_003646602.1| Mg chelatase, subunit ChlI [Tsukamurella paurometabola DSM 20162]
 gi|296027493|gb|ADG78263.1| Mg chelatase, subunit ChlI [Tsukamurella paurometabola DSM 20162]
          Length = 506

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +S++ ++A  GI G  VE++  +  G   V +VGLPD  + ESR+R+++  ++ GL F  
Sbjct: 4  LSKVHSVAITGIDGAVVEIEGCIGGGLPAVHLVGLPDTVLQESRDRVRAAIVNIGLKF-- 61

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + L      L
Sbjct: 62 ---PDTRVTLALSPATL 75


>gi|114571556|ref|YP_758236.1| Mg chelatase ChlI [Maricaulis maris MCS10]
 gi|114342018|gb|ABI67298.1| Mg chelatase, subunit ChlI [Maricaulis maris MCS10]
          Length = 509

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 44/78 (56%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPG-RVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M +R +++AF G +   V+VQV V+ G +    IVGL DKAV ESRER+++ F   GL  
Sbjct: 1  MAARTASVAFHGSEARLVDVQVQVAGGSQPIFSIVGLADKAVAESRERVRAAFSALGL-- 58

Query: 60 LVNELPSIYLQLIYQKKD 77
              LPS  L +     D
Sbjct: 59 ---SLPSKRLIVNLAPAD 73


>gi|328948909|ref|YP_004366246.1| Mg chelatase, subunit ChlI [Treponema succinifaciens DSM 2489]
 gi|328449233|gb|AEB14949.1| Mg chelatase, subunit ChlI [Treponema succinifaciens DSM 2489]
          Length = 521

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 40/75 (53%), Gaps = 5/75 (6%)

Query: 4  RISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNE 63
          RI   +  G +G  V V+V +  G   V IVGL D AV ESRER++S  I++GLLF    
Sbjct: 2  RIFCFSPFGYEGNLVTVEVDLRRGIPAVDIVGLADNAVKESRERMKSAIINSGLLF---- 57

Query: 64 LPSIYLQLIYQKKDL 78
           P   + +     DL
Sbjct: 58 -PPERVLISLSPADL 71


>gi|256827136|ref|YP_003151095.1| Mg chelatase-related protein [Cryptobacterium curtum DSM 15641]
 gi|256583279|gb|ACU94413.1| Mg chelatase-related protein [Cryptobacterium curtum DSM 15641]
          Length = 507

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 5/75 (6%)

Query: 4  RISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNE 63
           +      G+   PV V+V ++ G  G  IVG+PD A+ E+RERI++     G       
Sbjct: 7  SVRCATITGVDAQPVMVEVAITTGLPGFSIVGMPDAAIQEARERIRAAIKACGF-----S 61

Query: 64 LPSIYLQLIYQKKDL 78
          +P   + +      L
Sbjct: 62 MPPDKVVVNLAPGSL 76


>gi|226366013|ref|YP_002783796.1| hypothetical protein ROP_66040 [Rhodococcus opacus B4]
 gi|226244503|dbj|BAH54851.1| hypothetical protein [Rhodococcus opacus B4]
          Length = 502

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  ++A  G+ G  VE++  +  G   V +VGLPD A+ E+R+RI++   ++G     
Sbjct: 3  LGRAHSVAVTGVDGQLVEIEADIGRGLPAVHLVGLPDTALSEARDRIRAAVANSG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + L      L
Sbjct: 58 EEWPDSKVILALSPATL 74


>gi|331698495|ref|YP_004334734.1| Mg chelatase subunit ChlI [Pseudonocardia dioxanivorans CB1190]
 gi|326953184|gb|AEA26881.1| Mg chelatase, subunit ChlI [Pseudonocardia dioxanivorans CB1190]
          Length = 503

 Score = 94.3 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++R  ++A QG+ G  VE++  +  G  G+ +VGLPD A+ ESR+R+++  +++G     
Sbjct: 4  LARSWSVALQGVDGTVVEIEAAIGGGLPGIHLVGLPDAALHESRDRVRAAVVNSG----- 58

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L      L
Sbjct: 59 RHWPNERIVLALSPATL 75


>gi|213027993|ref|ZP_03342440.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Typhi str. 404ty]
 gi|213051671|ref|ZP_03344549.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Typhi str. E00-7866]
 gi|213417895|ref|ZP_03350991.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Typhi str. E01-6750]
 gi|213580193|ref|ZP_03362019.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Typhi str. E98-0664]
 gi|213610008|ref|ZP_03369834.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Typhi str. E98-2068]
 gi|213646694|ref|ZP_03376747.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Typhi str. J185]
 gi|289810497|ref|ZP_06541126.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Typhi str. AG3]
 gi|289825756|ref|ZP_06544924.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Typhi str. E98-3139]
          Length = 77

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 40/70 (57%), Gaps = 5/70 (7%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  G+   P+ ++V +S G  G+ +VGLP+  V E R+R++S  I++G     
Sbjct: 3  LAIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEVRDRVRSAIINSGY---- 58

Query: 62 NELPSIYLQL 71
           E P+  + +
Sbjct: 59 -EFPAKKITI 67


>gi|291549899|emb|CBL26161.1| Mg chelatase-related protein [Ruminococcus torques L2-14]
          Length = 522

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 34/77 (44%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           S + + A +G+    V V+  VS G     +VG     V E+ ER++S   ++GL    
Sbjct: 3  FSTVKSAAMEGLAVEMVYVEADVSNGLPIFHMVGYLSSEVKEAAERVRSAVRNSGL---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+  + +      +
Sbjct: 59 -EFPAKRVVINLSPATM 74


>gi|262199122|ref|YP_003270331.1| Mg chelatase, subunit ChlI [Haliangium ochraceum DSM 14365]
 gi|262082469|gb|ACY18438.1| Mg chelatase, subunit ChlI [Haliangium ochraceum DSM 14365]
          Length = 525

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ + + A  GI    V V+V V+ G  G  +VGLP+ +V E   RI++   H G    
Sbjct: 5  MLASVPSCALLGIDAYRVAVEVAVASGLPGYHVVGLPETSVKEGAVRIRAALEHVG---- 60

Query: 61 VNELPSIYLQLIYQKKD 77
             +PS  + +     D
Sbjct: 61 -QGMPSKKITVNLAPAD 76


>gi|167957096|ref|ZP_02544170.1| Mg chelatase, subunit ChlI [candidate division TM7 single-cell
          isolate TM7c]
          Length = 507

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+SR+ +    G  G  +EV+  +S G   +QIVG+ +KA+ ESR+R++S   ++ L F 
Sbjct: 1  MVSRVVSATPYGFTGKIIEVEGDMSKGLPSLQIVGMGNKAIDESRDRVRSAIKNSSLDF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   L +     +L
Sbjct: 60 ----PKGKLIVNLAPAEL 73


>gi|229829216|ref|ZP_04455285.1| hypothetical protein GCWU000342_01303 [Shuttleworthia satelles
          DSM 14600]
 gi|229792379|gb|EEP28493.1| hypothetical protein GCWU000342_01303 [Shuttleworthia satelles
          DSM 14600]
          Length = 518

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 36/78 (46%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S+++T   +GI    V V+  VS G    ++VG     V E+RER+++   + G    
Sbjct: 1  MYSQVNTAIIRGIDSQLVLVEADVSDGMPLFEMVGFLSAEVKEARERVRTSLRNIGF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            +LP   + +      +
Sbjct: 58 --QLPIKRITVNISPASI 73


>gi|294676017|ref|YP_003576632.1| competence protein ComM [Rhodobacter capsulatus SB 1003]
 gi|294474837|gb|ADE84225.1| competence protein ComM [Rhodobacter capsulatus SB 1003]
          Length = 504

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R  T+AF+G++   VEVQ  ++ G     IVGLPDKAV E+R+R+++         L
Sbjct: 1  MVARTYTVAFEGVEARIVEVQCALAAGMPAFSIVGLPDKAVSEARDRVRAAL-----AAL 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 56 SIALPMRRITVNLSPADL 73


>gi|184200718|ref|YP_001854925.1| putative magnesium chelatase [Kocuria rhizophila DC2201]
 gi|183580948|dbj|BAG29419.1| hypothetical protein [Kocuria rhizophila DC2201]
          Length = 519

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           +R  ++A  G++G  V+V+  +     G  I+GLPD+AV ES+ERI+S   HAG+    
Sbjct: 4  FARSRSVALVGLEGHVVDVEADIGQSLPGFTIIGLPDQAVNESKERIRSAARHAGVP--- 60

Query: 62 NELPSIYLQLIYQKKDL 78
            L    + +      L
Sbjct: 61 --LSPRKITVNLSPATL 75


>gi|153815653|ref|ZP_01968321.1| hypothetical protein RUMTOR_01889 [Ruminococcus torques ATCC
          27756]
 gi|317502439|ref|ZP_07960603.1| Mg chelatase [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331090299|ref|ZP_08339183.1| Mg chelatase [Lachnospiraceae bacterium 3_1_46FAA]
 gi|145847084|gb|EDK24002.1| hypothetical protein RUMTOR_01889 [Ruminococcus torques ATCC
          27756]
 gi|316896177|gb|EFV18284.1| Mg chelatase [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330401434|gb|EGG81019.1| Mg chelatase [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 514

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 15/77 (19%), Positives = 32/77 (41%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           S I +   +G++   + V+  +S G     +VG     V E+ ER+++   ++G     
Sbjct: 3  FSTILSAVIEGLEVAFIHVEADISNGLPVFHMVGYLSSEVKEAGERVRTAIKNSGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           E P+    +      +
Sbjct: 59 -EYPAKRTVVNLSPATM 74


>gi|86142938|ref|ZP_01061360.1| magnesium chelatase subunit ChlI [Leeuwenhoekiella blandensis
          MED217]
 gi|85830383|gb|EAQ48842.1| magnesium chelatase subunit ChlI [Leeuwenhoekiella blandensis
          MED217]
          Length = 512

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++   A  G++   + ++V +  G  G  +VGLPD A+ ES  RI +   + G    
Sbjct: 1  MLTKVYGSAVFGVEASTITIEVNIDKGI-GYHLVGLPDNAIRESNYRIAAALQNNGFK-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + L     DL
Sbjct: 58 ---IPGKKITLNMAPADL 72


>gi|327399176|ref|YP_004340045.1| Mg chelatase subunit ChlI [Hippea maritima DSM 10411]
 gi|327181805|gb|AEA33986.1| Mg chelatase, subunit ChlI [Hippea maritima DSM 10411]
          Length = 503

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 36/78 (46%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  ++++    GI+  PV +++  + G   + I+GL   A  ES++R      ++G+   
Sbjct: 1  MFVKLNSALVVGIEARPVTIEIDATRGLPSLNIIGLAQGAAKESKDRAIHALSNSGIK-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 59 ---LPPKKITISLAPADL 73


>gi|145593870|ref|YP_001158167.1| Mg chelatase, subunit ChlI [Salinispora tropica CNB-440]
 gi|145303207|gb|ABP53789.1| Mg chelatase, subunit ChlI [Salinispora tropica CNB-440]
          Length = 506

 Score = 93.9 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           +R+  +   G+ G  ++V+  ++PG   V I GLPD A+ E+R+R+++  +++G     
Sbjct: 3  YARVRCVGLVGVTGHVLQVEADLAPGLPTVAITGLPDTALHEARDRVRAAVVNSG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + +      L
Sbjct: 58 RAWPNRRITINLLPATL 74


>gi|120436473|ref|YP_862159.1| competence protein ComM [Gramella forsetii KT0803]
 gi|117578623|emb|CAL67092.1| competence protein ComM [Gramella forsetii KT0803]
          Length = 512

 Score = 93.9 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ ++   A  G+    + V+V ++ G  G  +VGLPD AV ES  RI +   +      
Sbjct: 1  MLIKVYGSAVYGVDATTITVEVNIASGI-GYHLVGLPDNAVKESSYRIAAALQNNKFK-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 58 ---LPGKKIIINMAPADL 72


>gi|305667055|ref|YP_003863342.1| magnesium chelatase subunit ChlI [Maribacter sp. HTCC2170]
 gi|88709291|gb|EAR01525.1| magnesium chelatase, subunit ChlI [Maribacter sp. HTCC2170]
          Length = 511

 Score = 93.9 bits (233), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++   A  G++   + V+V V  G  G  +VGLPD A+ ES  RI +  ++ G    
Sbjct: 1  MLTKVFGSAVFGVEATTITVEVNVDKGV-GYHLVGLPDNAIKESNYRIAAALLNNGYK-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     DL
Sbjct: 58 ---IPGKKITINMAPADL 72


>gi|330836633|ref|YP_004411274.1| magnesium chelatase ChlI subunit [Spirochaeta coccoides DSM
          17374]
 gi|329748536|gb|AEC01892.1| magnesium chelatase ChlI subunit [Spirochaeta coccoides DSM
          17374]
          Length = 521

 Score = 93.5 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 7/76 (9%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+  I +   QG +GI ++++  V  G  G  IVGLPD  + E+RERI+S   ++G  F 
Sbjct: 1  ML--IFSHLAQGYRGICIQIEADVRNGFPGFDIVGLPDSTIREARERIRSAIRNSGFKF- 57

Query: 61 VNELPSIYLQLIYQKK 76
              P+  + +     
Sbjct: 58 ----PAQRILVNLAPA 69


>gi|269120374|ref|YP_003308551.1| Mg chelatase, subunit ChlI [Sebaldella termitidis ATCC 33386]
 gi|268614252|gb|ACZ08620.1| Mg chelatase, subunit ChlI [Sebaldella termitidis ATCC 33386]
          Length = 497

 Score = 93.5 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M   I + +F G+    V V+V +  G  G  IVG+ D A+IESRERI+S   +  ++F 
Sbjct: 1  MAITILSASFTGMNSYIVSVEVDIFNGLSGFSIVGMGDTAIIESRERIRSSLKNIDVIF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     D+
Sbjct: 60 ----PAKKVIVNLSPADI 73


>gi|229491399|ref|ZP_04385223.1| Mg chelatase homolog [Rhodococcus erythropolis SK121]
 gi|229321684|gb|EEN87481.1| Mg chelatase homolog [Rhodococcus erythropolis SK121]
          Length = 502

 Score = 93.5 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  ++A  G+ G  VE++  +  G   V +VGLPD A+ ESR+RI++   ++G     
Sbjct: 3  LGRAHSVAVSGVDGQIVEIEADIGRGLPAVHLVGLPDTALHESRDRIRAAVTNSG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + L      L
Sbjct: 58 EEWPDSKVILALSPATL 74


>gi|255993973|ref|ZP_05427108.1| Mg chelatase-like protein [Eubacterium saphenum ATCC 49989]
 gi|255993641|gb|EEU03730.1| Mg chelatase-like protein [Eubacterium saphenum ATCC 49989]
          Length = 526

 Score = 93.5 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 36/78 (46%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI+   + +   ++   + V+  +  G     +VGL D  + E++ERI++   ++G  F 
Sbjct: 1  MINAFYSSSIWAMEPSLITVETDIRNGIPMFNMVGLADITINEAKERIRAALSNSGYKF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     D+
Sbjct: 60 ----PNKRITVNLAPADV 73


>gi|257063752|ref|YP_003143424.1| Mg chelatase-related protein [Slackia heliotrinireducens DSM
          20476]
 gi|256791405|gb|ACV22075.1| Mg chelatase-related protein [Slackia heliotrinireducens DSM
          20476]
          Length = 497

 Score = 93.5 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 5/72 (6%)

Query: 4  RISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNE 63
           + + A  G++ IPV V+V+V  G  G+ IVG+PD AV ES+ER++S    +G       
Sbjct: 6  SVQSAALVGVEAIPVHVEVVVMSGLPGISIVGMPDAAVRESQERVKSAIKASGFT----- 60

Query: 64 LPSIYLQLIYQK 75
          +P   + +    
Sbjct: 61 MPGDKIVINLAP 72


>gi|320096212|ref|ZP_08027799.1| competence protein ComM [Actinomyces sp. oral taxon 178 str.
          F0338]
 gi|319976860|gb|EFW08616.1| competence protein ComM [Actinomyces sp. oral taxon 178 str.
          F0338]
          Length = 517

 Score = 93.5 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++R  +++  G++G  V V+  V  G V   IVGLPD +V ES++R++S     GL  L 
Sbjct: 7  LARTHSVSLVGLEGRLVRVETQVGRGLVQFVIVGLPDASVRESKDRVRSALESCGLEVLD 66

Query: 62 NELPSIYLQLIYQKKDL 78
          +      + +      L
Sbjct: 67 S-----RVTVNLSPAGL 78


>gi|257791159|ref|YP_003181765.1| Mg chelatase, subunit ChlI [Eggerthella lenta DSM 2243]
 gi|257475056|gb|ACV55376.1| Mg chelatase, subunit ChlI [Eggerthella lenta DSM 2243]
          Length = 499

 Score = 93.5 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 40/74 (54%), Gaps = 5/74 (6%)

Query: 5  ISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNEL 64
          + +   +G++ +PV+V+V+++ G  G  IVGL D +V ESRER+++     G       L
Sbjct: 9  VRSATLRGVEAVPVDVEVVMANGIPGFSIVGLADASVQESRERVKAALRSCGF-----SL 63

Query: 65 PSIYLQLIYQKKDL 78
          P+  + +      L
Sbjct: 64 PASKVVVNLAPGVL 77


>gi|317488109|ref|ZP_07946685.1| magnesium chelatase [Eggerthella sp. 1_3_56FAA]
 gi|316912781|gb|EFV34314.1| magnesium chelatase [Eggerthella sp. 1_3_56FAA]
          Length = 499

 Score = 93.5 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 40/74 (54%), Gaps = 5/74 (6%)

Query: 5  ISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNEL 64
          + +   +G++ +PV+V+V+++ G  G  IVGL D +V ESRER+++     G       L
Sbjct: 9  VRSATLRGVEAVPVDVEVVMANGIPGFSIVGLADASVQESRERVKAALRSCGF-----SL 63

Query: 65 PSIYLQLIYQKKDL 78
          P+  + +      L
Sbjct: 64 PASKVVVNLAPGVL 77


>gi|226305957|ref|YP_002765917.1| hypothetical protein RER_24700 [Rhodococcus erythropolis PR4]
 gi|226185074|dbj|BAH33178.1| conserved hypothetical protein [Rhodococcus erythropolis PR4]
          Length = 351

 Score = 93.5 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  ++A  G+ G  VE++  +  G   V +VGLPD A+ ESR+RI++   ++G     
Sbjct: 3  LGRAHSVAVSGVDGQIVEIEADIGRGLPAVHLVGLPDTALHESRDRIRAAVTNSG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + L      L
Sbjct: 58 EEWPDSKVILALSPATL 74


>gi|325832934|ref|ZP_08165607.1| Mg chelatase-like protein [Eggerthella sp. HGA1]
 gi|325485799|gb|EGC88263.1| Mg chelatase-like protein [Eggerthella sp. HGA1]
          Length = 499

 Score = 93.5 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 40/74 (54%), Gaps = 5/74 (6%)

Query: 5  ISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNEL 64
          + +   +G++ +PV+V+V+++ G  G  IVGL D +V ESRER+++     G       L
Sbjct: 9  VRSATLRGVEAVPVDVEVVMANGIPGFSIVGLADASVQESRERVKAALRSCGF-----SL 63

Query: 65 PSIYLQLIYQKKDL 78
          P+  + +      L
Sbjct: 64 PASKVVVNLAPGVL 77


>gi|325262839|ref|ZP_08129575.1| Mg chelatase-like protein [Clostridium sp. D5]
 gi|324031933|gb|EGB93212.1| Mg chelatase-like protein [Clostridium sp. D5]
          Length = 510

 Score = 93.5 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 34/77 (44%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           S + + + QG+K   V V+  VS G     +VG     V E+ ER+++   ++GL F  
Sbjct: 3  FSTVLSASIQGLKVEFVHVEADVSNGLPAFHMVGYLSSEVKEAAERVRTAIRNSGLDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+    +      +
Sbjct: 61 ---PAKKTVINLSPATM 74


>gi|148550347|ref|YP_001270449.1| ATPase with chaperone activity-like protein [Pseudomonas putida
          F1]
 gi|148514405|gb|ABQ81265.1| ATPase with chaperone activity-like protein [Pseudomonas putida
          F1]
          Length = 128

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 19/80 (23%), Positives = 41/80 (51%), Gaps = 5/80 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+  V ES++R++S  +++GL +  
Sbjct: 3  LALVHSRAQVGVQAPAVSVETHLTNGLPHLTLVGLPETTVKESKDRVRSAIVNSGLKY-- 60

Query: 62 NELPSIYLQLIYQKKDLIMI 81
             P   +        L+ I
Sbjct: 61 ---PQRRITQNLAADGLVPI 77


>gi|319955772|ref|YP_004167035.1| mg chelatase, subunit chli [Nitratifractor salsuginis DSM 16511]
 gi|319418176|gb|ADV45286.1| Mg chelatase, subunit ChlI [Nitratifractor salsuginis DSM 16511]
          Length = 520

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 18/74 (24%), Positives = 35/74 (47%), Gaps = 5/74 (6%)

Query: 4  RISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNE 63
           I++   +G+   P+ V+   + G  G  +VGL    + E+RER+++  I  G +F    
Sbjct: 20 TIASATLEGVTARPITVEATFTKGLPGFSVVGLAGNDIQEARERVKAALITNGFVF---- 75

Query: 64 LPSIYLQLIYQKKD 77
           P + + +     D
Sbjct: 76 -PPLKITVNLAPSD 88


>gi|325473751|gb|EGC76940.1| magnesium chelatase [Treponema denticola F0402]
          Length = 485

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 5/73 (6%)

Query: 5  ISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNEL 64
          I + +  G +G  ++V+  +  G   + IVGLP  AV E+R+R+++   ++GL     E 
Sbjct: 3  ILSFSSFGYEGELIKVEADLRRGLPVIDIVGLPGSAVKEARDRMRAAIRNSGL-----EF 57

Query: 65 PSIYLQLIYQKKD 77
          P   + +     D
Sbjct: 58 PVSRILINLSPAD 70


>gi|313206749|ref|YP_004045926.1| mg chelatase, subunit chli [Riemerella anatipestifer DSM 15868]
 gi|312446065|gb|ADQ82420.1| Mg chelatase, subunit ChlI [Riemerella anatipestifer DSM 15868]
 gi|315023820|gb|EFT36822.1| MG(2+) chelatase family protein / ComM-related protein
          [Riemerella anatipestifer RA-YM]
 gi|325335812|gb|ADZ12086.1| Predicted ATPase with chaperone activity [Riemerella
          anatipestifer RA-GD]
          Length = 510

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ ++   A  G+    + ++V V  G  G  +VGLPD A+ ES  RI +   + G    
Sbjct: 1  MLVKVYGSAIHGVSAQTITIEVNVDQGV-GYHLVGLPDNAIKESSHRISAALKNVGYK-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 58 ---LPGKKITINMAPADL 72


>gi|197303736|ref|ZP_03168773.1| hypothetical protein RUMLAC_02465 [Ruminococcus lactaris ATCC
          29176]
 gi|197297256|gb|EDY31819.1| hypothetical protein RUMLAC_02465 [Ruminococcus lactaris ATCC
          29176]
          Length = 511

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 17/77 (22%), Positives = 32/77 (41%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           S + + A +G+    V V+  VS G     +VG     V E+ ER+++   ++G  F  
Sbjct: 3  FSTVVSAATEGLAVEFVHVEADVSNGLPVFHMVGYLASEVKEAGERVRTAIKNSGFDF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+    +      +
Sbjct: 61 ---PAKRTVINLSPATM 74


>gi|213856935|ref|ZP_03384175.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Typhi str. M223]
          Length = 79

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 36/60 (60%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  G+   P+ ++V +S G  G+ +VGLP+  V E R+R++S  I++G  F  
Sbjct: 3  LAIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEVRDRVRSAIINSGYEFPA 62


>gi|187917964|ref|YP_001883527.1| magnesium chelatase subunit ChlI-related ATPase [Borrelia hermsii
          DAH]
 gi|119860812|gb|AAX16607.1| magnesium chelatase subunit ChlI-related ATPase [Borrelia hermsii
          DAH]
          Length = 509

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 5/73 (6%)

Query: 4  RISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNE 63
          +I + +  G +G  +EV+V +  G  G+ IVGL    + ESRER++S   ++   F    
Sbjct: 2  KIYSHSSIGYEGELIEVEVDIRKGIPGIDIVGLAGSEIKESRERVKSAIKNSEFTF---- 57

Query: 64 LPSIYLQLIYQKK 76
           P   + +     
Sbjct: 58 -PKDRILINLAPA 69


>gi|256820717|ref|YP_003141996.1| Mg chelatase, subunit ChlI [Capnocytophaga ochracea DSM 7271]
 gi|256582300|gb|ACU93435.1| Mg chelatase, subunit ChlI [Capnocytophaga ochracea DSM 7271]
          Length = 512

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +I   A  G++   + ++V +  G  G  +VGLPD A+ ES  RI +   + G    
Sbjct: 1  MLVKIYGSAVFGVEASTITIEVNIDKGI-GYHLVGLPDIAIKESNYRIAAALQNNGYK-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     D+
Sbjct: 58 ---IPGKKITINMAPADM 72


>gi|315223850|ref|ZP_07865698.1| Mg chelatase-like protein [Capnocytophaga ochracea F0287]
 gi|314946180|gb|EFS98181.1| Mg chelatase-like protein [Capnocytophaga ochracea F0287]
          Length = 512

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +I   A  G++   + ++V +  G  G  +VGLPD A+ ES  RI +   + G    
Sbjct: 1  MLVKIYGSAVFGVEASTITIEVNIDKGI-GYHLVGLPDIAIKESNYRIAAALQNNGYK-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     D+
Sbjct: 58 ---IPGKKITINMAPADM 72


>gi|220903564|ref|YP_002478876.1| Mg chelatase, subunit ChlI [Desulfovibrio desulfuricans subsp.
          desulfuricans str. ATCC 27774]
 gi|219867863|gb|ACL48198.1| Mg chelatase, subunit ChlI [Desulfovibrio desulfuricans subsp.
          desulfuricans str. ATCC 27774]
          Length = 512

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 37/77 (48%), Gaps = 6/77 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVM-VSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M+ R+++   +G+   PVE++V  V  G  G  +VGL + AV E+++R+ +    A    
Sbjct: 1  MVVRLNSGGVEGVDAYPVELEVDYVRQGLPGFTMVGLAETAVREAKDRVFAALRAANFK- 59

Query: 60 LVNELPSIYLQLIYQKK 76
              LP   + +     
Sbjct: 60 ----LPPARVTVNLAPA 72


>gi|281421484|ref|ZP_06252483.1| Mg chelatase-like protein [Prevotella copri DSM 18205]
 gi|281404556|gb|EFB35236.1| Mg chelatase-like protein [Prevotella copri DSM 18205]
          Length = 516

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +    A  G++   V V+V ++ G +   + GL D+AV ESR RI +   ++G  F 
Sbjct: 1  MLVKTYCAAVNGLEVTTVTVEVSLNRGVM-YHLTGLGDEAVKESRNRISAALQYSGFKF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 59 ----PIADITINLAPADL 72


>gi|254442320|ref|ZP_05055796.1| Mg chelatase family protein [Verrucomicrobiae bacterium DG1235]
 gi|198256628|gb|EDY80936.1| Mg chelatase family protein [Verrucomicrobiae bacterium DG1235]
          Length = 509

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVS-PGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M++ +S+ A QGI+ +PV V+V     G   + +VGLPD AV ES +R+ S   ++G   
Sbjct: 1  MLAIVSSAALQGIQAVPVLVEVNSGESGDPRLIMVGLPDAAVKESDDRVFSALANSGYRK 60

Query: 60 LVNELPSIYLQLIYQKKDL 78
               P     +     DL
Sbjct: 61 -----PQTRTTINLAPGDL 74


>gi|332520586|ref|ZP_08397048.1| magnesium chelatase ChlI subunit [Lacinutrix algicola 5H-3-7-4]
 gi|332043939|gb|EGI80134.1| magnesium chelatase ChlI subunit [Lacinutrix algicola 5H-3-7-4]
          Length = 282

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ ++   A  G+    + V+V V  G  G  +VGLPD A+ ES  RI +   + G    
Sbjct: 1  MLKKVFGSAVFGVDATTITVEVNVDSGI-GYHLVGLPDNAIKESNYRIAAALQNNGYK-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     DL
Sbjct: 58 ---IPGKKITINMAPADL 72


>gi|332702120|ref|ZP_08422208.1| Mg chelatase, subunit ChlI [Desulfovibrio africanus str. Walvis
          Bay]
 gi|332552269|gb|EGJ49313.1| Mg chelatase, subunit ChlI [Desulfovibrio africanus str. Walvis
          Bay]
          Length = 510

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 6/79 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSP-GRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          MI+ I+T A  GI  +PV +++  S  G     +VGL + AV E++ER  S    +G   
Sbjct: 1  MIATIATSALMGIDALPVALEIDFSRQGLPAFVMVGLAEGAVREAKERAFSALKSSGYK- 59

Query: 60 LVNELPSIYLQLIYQKKDL 78
              LP   + +     D+
Sbjct: 60 ----LPPARITVNLAPADV 74


>gi|218887805|ref|YP_002437126.1| competence protein ComM [Desulfovibrio vulgaris str. 'Miyazaki
          F']
 gi|218758759|gb|ACL09658.1| competence protein ComM, putative [Desulfovibrio vulgaris str.
          'Miyazaki F']
          Length = 236

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSP-GRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          MI R++  A  G+    V+++V ++  G     +VGL + A+ ESRER+ +      L  
Sbjct: 1  MIVRVACAALHGVDAFRVDLEVDLARQGMPAFVMVGLAEGALRESRERVFAAMRACNLR- 59

Query: 60 LVNELPSIYLQLIYQKKD 77
              LP   + +     D
Sbjct: 60 ----LPPARITVNLAPAD 73


>gi|163816841|ref|ZP_02208204.1| hypothetical protein COPEUT_03031 [Coprococcus eutactus ATCC
          27759]
 gi|158448098|gb|EDP25093.1| hypothetical protein COPEUT_03031 [Coprococcus eutactus ATCC
          27759]
          Length = 510

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 15/78 (19%), Positives = 35/78 (44%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S++ +   +G++G  + V+  +  G   + +VG     V E+ ER+++   ++     
Sbjct: 1  MYSKVLSGLVRGVEGTLISVETDIHDGLPMMNMVGYLSACVREAGERVRTALRNSNF--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     D+
Sbjct: 58 --SLPPKRVTINLFPADI 73


>gi|300774666|ref|ZP_07084529.1| Mg chelatase-like protein [Chryseobacterium gleum ATCC 35910]
 gi|300506481|gb|EFK37616.1| Mg chelatase-like protein [Chryseobacterium gleum ATCC 35910]
          Length = 511

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +I   A  G+    + ++V V  G VG  +VGLPD A+ ES  RI +   + G    
Sbjct: 1  MLIKIYGSAIHGVAAQTITIEVNVDTGGVGYHLVGLPDNAIKESSYRISAALKNVGYK-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     DL
Sbjct: 59 ---IPGKKITINMAPADL 73


>gi|313683651|ref|YP_004061389.1| sigma 54 interacting domain protein [Sulfuricurvum kujiense DSM
          16994]
 gi|313156511|gb|ADR35189.1| Sigma 54 interacting domain protein [Sulfuricurvum kujiense DSM
          16994]
          Length = 502

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 5/75 (6%)

Query: 4  RISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNE 63
          ++    F+GI    VEVQ   + G     IVG+ + A+ ES+ER++S  +  G  F    
Sbjct: 3  QLLCATFEGIDAKGVEVQFTATKGLPAFTIVGMANTAITESKERVKSALLSNGFTF---- 58

Query: 64 LPSIYLQLIYQKKDL 78
           P   L +     DL
Sbjct: 59 -PPKRLTINLAPSDL 72


>gi|197124078|ref|YP_002136029.1| Mg chelatase, subunit ChlI [Anaeromyxobacter sp. K]
 gi|196173927|gb|ACG74900.1| Mg chelatase, subunit ChlI [Anaeromyxobacter sp. K]
          Length = 504

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ R+ + A  G+  +PV+V+V  + G  G  IVGL    V E+  R+ +   + G    
Sbjct: 1  MLVRVRSGAVLGVNAVPVDVEVDATVGMPGFYIVGLAAGPVREAEVRVLAAIRNIG---- 56

Query: 61 VNELPSIYLQLIYQKKDL 78
            +LPS  + +     DL
Sbjct: 57 -VKLPSKRVTVNLAPGDL 73


>gi|282859902|ref|ZP_06268990.1| Mg chelatase-like protein [Prevotella bivia JCVIHMP010]
 gi|282587305|gb|EFB92522.1| Mg chelatase-like protein [Prevotella bivia JCVIHMP010]
          Length = 515

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 34/78 (43%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +    A  G++   V V+V ++ G     + GL D AV ES +RI +  ++ G  F 
Sbjct: 1  MLVKTFCAAVNGMEVTTVTVEVSITRGI-LFHLTGLADTAVKESHDRIAAALMNNGYKF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   +       D+
Sbjct: 59 ----PVADITANLAPADI 72


>gi|149174912|ref|ZP_01853536.1| comM protein [Planctomyces maris DSM 8797]
 gi|148846249|gb|EDL60588.1| comM protein [Planctomyces maris DSM 8797]
          Length = 511

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPG-RVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M++++ T +  GI   PVEV+V +SPG      +VGL + AV ES  RI+   +++G   
Sbjct: 1  MLAKLYTYSLFGIDAKPVEVEVDISPGAMPKTILVGLAEAAVKESTHRIERALVNSGYNR 60

Query: 60 LVNELPSIYLQLIYQKKDL 78
               P   + +     DL
Sbjct: 61 -----PIDRIVINLSPADL 74


>gi|317486287|ref|ZP_07945119.1| magnesium chelatase [Bilophila wadsworthia 3_1_6]
 gi|316922457|gb|EFV43711.1| magnesium chelatase [Bilophila wadsworthia 3_1_6]
          Length = 508

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVM-VSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          MI R++  A QG+    V+++   +  G     +VGL + AV E++ER+ +     G   
Sbjct: 1  MIVRLACGALQGVDAFRVDLEADFLRKGMPAFVMVGLAEGAVREAKERVFAAMRSCGFT- 59

Query: 60 LVNELPSIYLQLIYQKKD 77
              LP+  + +     D
Sbjct: 60 ----LPAARITVNLAPAD 73


>gi|42527500|ref|NP_972598.1| magnesium chelatase family protein [Treponema denticola ATCC
          35405]
 gi|41818085|gb|AAS12509.1| magnesium chelatase family protein [Treponema denticola ATCC
          35405]
          Length = 566

 Score = 92.7 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 5/73 (6%)

Query: 5  ISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNEL 64
          I + +  G +G  ++V+  +  G   + IVGLP  AV E+R+R+++   ++GL     E 
Sbjct: 3  ILSFSSFGYEGELIKVEADLRRGLPVIDIVGLPGSAVKEARDRMRAAIRNSGL-----EF 57

Query: 65 PSIYLQLIYQKKD 77
          P   + +     D
Sbjct: 58 PVSRILINLSPAD 70


>gi|261414795|ref|YP_003248478.1| Mg chelatase, subunit ChlI [Fibrobacter succinogenes subsp.
          succinogenes S85]
 gi|261371251|gb|ACX73996.1| Mg chelatase, subunit ChlI [Fibrobacter succinogenes subsp.
          succinogenes S85]
 gi|302325587|gb|ADL24788.1| Mg chelatase-like protein [Fibrobacter succinogenes subsp.
          succinogenes S85]
          Length = 509

 Score = 92.7 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 35/78 (44%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  RI +    GIK + V V+V  + G  G  +VGLPD AV ESRER+ S     G +  
Sbjct: 1  MFRRIRSYCLFGIKAVSVSVEVDAAQGLPGFTLVGLPDNAVRESRERVVSAIRSIGKVVT 60

Query: 61 VNELPSIYLQLIYQKKDL 78
                    +     DL
Sbjct: 61 GF-----RTTVNLSPADL 73


>gi|94987193|ref|YP_595126.1| Mg chelatase-related protein [Lawsonia intracellularis
          PHE/MN1-00]
 gi|94731442|emb|CAJ54805.1| Mg chelatase-related protein [Lawsonia intracellularis
          PHE/MN1-00]
          Length = 509

 Score = 92.7 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 35/78 (44%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVM-VSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M  R++  A +G+    V+++V  +  G     +VGL + AV E++ER+ +     G   
Sbjct: 1  MTVRLACGALEGVDAFRVDLEVDFLRQGLPSFVMVGLAEGAVREAKERVFAALRSCGFT- 59

Query: 60 LVNELPSIYLQLIYQKKD 77
              LP   + +     +
Sbjct: 60 ----LPPARITVNLAPAN 73


>gi|213962672|ref|ZP_03390933.1| Mg chelatase homolog [Capnocytophaga sputigena Capno]
 gi|213954667|gb|EEB65988.1| Mg chelatase homolog [Capnocytophaga sputigena Capno]
          Length = 513

 Score = 92.7 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ ++   A  G++   + ++V +  G  G  +VGLPD A+ ES  RI +   + G    
Sbjct: 1  MLVKVYGSAVFGVEATTITIEVNIVKGI-GYHLVGLPDIAIKESNFRIAAALQNTGYK-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     D+
Sbjct: 58 ---IPGKKITINMAPADM 72


>gi|330994763|ref|ZP_08318685.1| Competence protein ComM [Gluconacetobacter sp. SXCC-1]
 gi|329758024|gb|EGG74546.1| Competence protein ComM [Gluconacetobacter sp. SXCC-1]
          Length = 503

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ I   AF GI+ +PV+V+V +S G     IVGLPDKAV ESRER+++     GL    
Sbjct: 6  LASICGFAFSGIEAVPVKVEVQLSVGLPSFLIVGLPDKAVNESRERVRATLSAMGL---- 61

Query: 62 NELPSIYLQLIYQKKDLI 79
            LP+  + +     +L+
Sbjct: 62 -ALPAKRIVVNLVPANLM 78


>gi|260891334|ref|ZP_05902597.1| Mg chelatase-like protein [Leptotrichia hofstadii F0254]
 gi|260858717|gb|EEX73217.1| Mg chelatase-like protein [Leptotrichia hofstadii F0254]
          Length = 496

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 5/67 (7%)

Query: 12 GIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSIYLQL 71
          G+    VEV+V +S G     IVG+ D+A+ ES+ERI+S F + G      E P   + +
Sbjct: 2  GVDTYVVEVEVDLSRGLPVFNIVGMGDQAISESKERIRSCFKNVGF-----EFPVRRVLV 56

Query: 72 IYQKKDL 78
               ++
Sbjct: 57 NLSPANI 63


>gi|325955108|ref|YP_004238768.1| Mg chelatase, subunit ChlI [Weeksella virosa DSM 16922]
 gi|323437726|gb|ADX68190.1| Mg chelatase, subunit ChlI [Weeksella virosa DSM 16922]
          Length = 508

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ ++   A  G++   + V+V +  G  G  +VGLPD A+ ES  RI +   + G    
Sbjct: 1  MLVKVYGSAIFGVESKMITVEVNIDNGV-GYHLVGLPDSAIKESNFRISAALKNVGYK-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     DL
Sbjct: 58 ---IPGKKITINMAPADL 72


>gi|326771767|ref|ZP_08231052.1| Mg chelatase-like protein [Actinomyces viscosus C505]
 gi|326637900|gb|EGE38801.1| Mg chelatase-like protein [Actinomyces viscosus C505]
          Length = 515

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 5/71 (7%)

Query: 8  IAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSI 67
          +   G+ G  VEV+   + G  G  +VGLPD AV ESRER+++     G+          
Sbjct: 1  MTLTGLAGHIVEVEAHATQGLPGFTLVGLPDAAVRESRERVRAALSTCGVT-----WGEQ 55

Query: 68 YLQLIYQKKDL 78
           L +     DL
Sbjct: 56 RLTVNLSPADL 66


>gi|288922425|ref|ZP_06416613.1| Mg chelatase, subunit ChlI [Frankia sp. EUN1f]
 gi|288346228|gb|EFC80569.1| Mg chelatase, subunit ChlI [Frankia sp. EUN1f]
          Length = 517

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++R   +A  GI+G  VEV+  +  G  G  ++GLPD A+ E+R+R+++  +++      
Sbjct: 3  LARSLAVAVVGIEGRLVEVEADLGRGLPGFTLIGLPDAALHEARDRVRAAVVNS-----R 57

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +      L
Sbjct: 58 EHWPDQKITVGLFPATL 74


>gi|153854398|ref|ZP_01995676.1| hypothetical protein DORLON_01671 [Dorea longicatena DSM 13814]
 gi|149752924|gb|EDM62855.1| hypothetical protein DORLON_01671 [Dorea longicatena DSM 13814]
          Length = 416

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 16/75 (21%), Positives = 32/75 (42%), Gaps = 5/75 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
             + + A QG+    + V+  VS G     +VG     V E+ ER+++   ++G+    
Sbjct: 3  FCTVLSAAVQGLSVEMIRVEADVSNGLPMFHMVGYLSSEVKEASERVRTAIRNSGMK--- 59

Query: 62 NELPSIYLQLIYQKK 76
            LP+  + +     
Sbjct: 60 --LPAKKIIVNLAPA 72


>gi|34558487|ref|NP_908302.1| sigma-54 interacting protein [Wolinella succinogenes DSM 1740]
 gi|34481781|emb|CAE11202.1| SIGMA-54 INTERACTING PROTEIN [Wolinella succinogenes]
          Length = 507

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 17/77 (22%), Positives = 31/77 (40%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + +I +    G+    +EV+   + G     I G+   ++ E+R R QS     G  F  
Sbjct: 3  LHQIHSATLLGLDAKIIEVEAAFNKGLPSFTIAGMAQASIQEARHRSQSALCAIGFHF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P + + +     DL
Sbjct: 61 ---PPLKIVINLAPSDL 74


>gi|307566198|ref|ZP_07628649.1| Mg chelatase-like protein [Prevotella amnii CRIS 21A-A]
 gi|307345091|gb|EFN90477.1| Mg chelatase-like protein [Prevotella amnii CRIS 21A-A]
          Length = 515

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 34/78 (43%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +    A  G++   V V+V ++ G     + GL D AV ES +RI +  ++ G  F 
Sbjct: 1  MLVKTFCAAVNGMEVTTVTVEVSITRGV-LFHLTGLADAAVKESHDRIAAALLNNGYKF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   +       D+
Sbjct: 59 ----PVADITANLAPADI 72


>gi|225568717|ref|ZP_03777742.1| hypothetical protein CLOHYLEM_04796 [Clostridium hylemonae DSM
          15053]
 gi|225162216|gb|EEG74835.1| hypothetical protein CLOHYLEM_04796 [Clostridium hylemonae DSM
          15053]
          Length = 512

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 17/75 (22%), Positives = 31/75 (41%), Gaps = 5/75 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           S + + A +G+    V V+  +S G     +VG     V E+ ER+++   ++G     
Sbjct: 3  FSTVLSAAIEGLTVEFVHVEADISNGLPMFHMVGYLSSEVKEASERVRTAVRNSG----- 57

Query: 62 NELPSIYLQLIYQKK 76
           ELP     +     
Sbjct: 58 IELPPKKTVINLSPA 72


>gi|146296262|ref|YP_001180033.1| Mg chelatase, subunit ChlI [Caldicellulosiruptor saccharolyticus
          DSM 8903]
 gi|145409838|gb|ABP66842.1| Mg chelatase, subunit ChlI [Caldicellulosiruptor saccharolyticus
          DSM 8903]
          Length = 499

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 5/65 (7%)

Query: 12 GIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSIYLQL 71
          GIKG  V V+  ++ G     IVGLPD  + ES+ERI+    ++G  F     P+  + +
Sbjct: 2  GIKGFVVTVETDMTNGLPNFDIVGLPDVTIKESKERIKVAIKNSGFDF-----PNRRIIV 56

Query: 72 IYQKK 76
               
Sbjct: 57 NLAPA 61


>gi|89891290|ref|ZP_01202797.1| ATPase with chaperone activity, competance-related, ComM
          [Flavobacteria bacterium BBFL7]
 gi|89516602|gb|EAS19262.1| ATPase with chaperone activity, competance-related, ComM
          [Flavobacteria bacterium BBFL7]
          Length = 512

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++   A  G++   + V+V    G  G  +VGLPDKA+ ES  RI +   + G    
Sbjct: 1  MLTKVYGSAVFGVEATTITVEVNSVKGI-GYHLVGLPDKAISESSYRIAAALSNVGYK-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 58 ---LPGKKITINMAPADL 72


>gi|288803435|ref|ZP_06408867.1| Mg chelatase-like protein [Prevotella melaninogenica D18]
 gi|288334045|gb|EFC72488.1| Mg chelatase-like protein [Prevotella melaninogenica D18]
          Length = 513

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 37/85 (43%), Gaps = 6/85 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +    A  G++   V V+V ++ G     + GL D AV ES +RI +  ++ G  F 
Sbjct: 1  MLVKTFCAAVNGMEVTTVTVEVSITRGV-LFHLTGLADGAVKESHDRIAAALLNTGYKF- 58

Query: 61 VNELPSIYLQLIYQKKDLIMIYLSF 85
              P   +       DL  +  SF
Sbjct: 59 ----PVADITANLAPADLKKVGSSF 79


>gi|331002044|ref|ZP_08325564.1| Mg chelatase [Lachnospiraceae oral taxon 107 str. F0167]
 gi|330411840|gb|EGG91245.1| Mg chelatase [Lachnospiraceae oral taxon 107 str. F0167]
          Length = 504

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 14/78 (17%), Positives = 32/78 (41%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S+I T    GI    V  +  +  G  G+ ++G     V E+ +R+++   ++   F 
Sbjct: 1  MLSKIHTAGLLGINAFHVCCETDIGDGLPGIILIGSLSGEVKEAADRVRTAIKNSNFSFY 60

Query: 61 VNELPSIYLQLIYQKKDL 78
                  + +     ++
Sbjct: 61 -----PRKIVINLSPAEI 73


>gi|308177310|ref|YP_003916716.1| Mg chelatase-like protein [Arthrobacter arilaitensis Re117]
 gi|307744773|emb|CBT75745.1| Mg chelatase-like protein [Arthrobacter arilaitensis Re117]
          Length = 517

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 3  SRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVN 62
          +R S +A  G+    VEV+  +  G  G  I+GLPD ++ E+RERI++   + G+     
Sbjct: 4  ARTSAVALHGVSASLVEVEADLGNGIPGFTILGLPDASLNEARERIKAAARNTGIP---- 59

Query: 63 ELPSIYLQLIYQKKDL 78
           L +  L +      L
Sbjct: 60 -LANRKLTVNLSPATL 74


>gi|291522668|emb|CBK80961.1| Predicted ATPase with chaperone activity [Coprococcus catus GD/7]
          Length = 360

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 34/78 (43%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S+  +    G++   + V+  VS G    ++VG     V E++ER+++   +AG    
Sbjct: 1  MFSKTISAVLLGMRSDMITVEADVSGGLPYFEMVGYLSAEVKEAKERVRTAIRNAGFK-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             L    + +     D+
Sbjct: 59 ---LEPRRIIVNLSPADV 73


>gi|298208349|ref|YP_003716528.1| magnesium chelatase subunit ChlI [Croceibacter atlanticus
          HTCC2559]
 gi|83848270|gb|EAP86140.1| magnesium chelatase subunit ChlI [Croceibacter atlanticus
          HTCC2559]
          Length = 512

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ ++   A  G++   + V+V V  G  G  +VGLPDKA+ ES  RI +   + G    
Sbjct: 1  MLIKVFGSAVFGVEATTITVEVNVDKGI-GYHLVGLPDKAIQESSYRIAAALKNVGYK-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + L     D+
Sbjct: 58 ---LPGKKITLNMAPADM 72


>gi|291456571|ref|ZP_06595961.1| Mg chelatase-like protein [Bifidobacterium breve DSM 20213]
 gi|291381848|gb|EFE89366.1| Mg chelatase-like protein [Bifidobacterium breve DSM 20213]
          Length = 511

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I    ++   G+K   V+VQ  +SPG     I+GLPD ++ E+RER++S    +G     
Sbjct: 3  IGSALSVGLIGLKAFIVQVQAFISPGLPYFSIIGLPDTSLSEARERVKSACQASGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +      L
Sbjct: 59 -SWPQTRVTVNMSPASL 74


>gi|54026113|ref|YP_120355.1| putative magnesium chelatase [Nocardia farcinica IFM 10152]
 gi|54017621|dbj|BAD58991.1| putative magnesium chelatase [Nocardia farcinica IFM 10152]
          Length = 502

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  ++A  G+ G  VE++  +  G   V +VGLPD A+ ESR+R+++   ++G     
Sbjct: 3  LGRAHSVAVAGVDGQLVEIEADIGQGLPSVHLVGLPDTALTESRDRVRAAVANSG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
           + P   + L      L
Sbjct: 58 EKWPDGRVILALSPATL 74


>gi|327312739|ref|YP_004328176.1| Mg chelatase-like protein [Prevotella denticola F0289]
 gi|326946195|gb|AEA22080.1| Mg chelatase-like protein [Prevotella denticola F0289]
          Length = 513

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +    A  G++   V V+V ++ G     + GL D AV ES +RI +  ++ G  F 
Sbjct: 1  MLVKTFCAAVNGMEVTTVTVEVSITRGV-LFHLTGLADGAVKESHDRIAAALLNNGYKF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   +       DL
Sbjct: 59 ----PVADITANLAPADL 72


>gi|257469096|ref|ZP_05633190.1| Mg(2+) chelatase family protein [Fusobacterium ulcerans ATCC
          49185]
 gi|317063342|ref|ZP_07927827.1| Mg(2+) chelatase [Fusobacterium ulcerans ATCC 49185]
 gi|313689018|gb|EFS25853.1| Mg(2+) chelatase [Fusobacterium ulcerans ATCC 49185]
          Length = 499

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 36/76 (47%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  R+ + ++ G++   VE +V +S G     IVGL D A+ ES++R+++   ++     
Sbjct: 1  MNIRVLSSSYLGVEPFLVEAEVDISSGLPFFSIVGLGDTAISESKDRVRTALKNSDFR-- 58

Query: 61 VNELPSIYLQLIYQKK 76
             +    + +     
Sbjct: 59 ---MEPKKIIVNLSPA 71


>gi|258653288|ref|YP_003202444.1| Mg chelatase subunit ChlI [Nakamurella multipartita DSM 44233]
 gi|258556513|gb|ACV79455.1| Mg chelatase, subunit ChlI [Nakamurella multipartita DSM 44233]
          Length = 506

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++R  +I   G+ G  V V+  +S G  G  ++G+PD A+I+SR+RI++  +++G     
Sbjct: 3  LARTWSIGLTGVTGHLVTVEADLSAGLPGTAVIGMPDPAIIQSRDRIRAAIVNSG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
          ++ P   + L      L
Sbjct: 58 HKWPDRRITLALSPAGL 74


>gi|317051897|ref|YP_004113013.1| Mg chelatase subunit ChlI [Desulfurispirillum indicum S5]
 gi|316946981|gb|ADU66457.1| Mg chelatase, subunit ChlI [Desulfurispirillum indicum S5]
          Length = 497

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPG-RVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M++ + + A  GI+   VE+QV  S G    + I GLPD +V ES++RI +     G   
Sbjct: 1  MVTLLPSCALHGIEAQAVEIQVSSSQGMLPSIVITGLPDTSVKESKDRIDAAIRSIG--- 57

Query: 60 LVNELPSIYLQLIYQKKD 77
              +P   + +     D
Sbjct: 58 --ERIPPRRITINLSPAD 73


>gi|283780554|ref|YP_003371309.1| Mg chelatase, subunit ChlI [Pirellula staleyi DSM 6068]
 gi|283439007|gb|ADB17449.1| Mg chelatase, subunit ChlI [Pirellula staleyi DSM 6068]
          Length = 514

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 6/79 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPG-RVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M++++ T +  GI  +PVEV+V +S G      +VGLP+ AV ES  R+     ++G + 
Sbjct: 1  MLAKLQTFSLLGIDAVPVEVEVDISAGALPKTLLVGLPEAAVRESTHRVARAIANSGFIP 60

Query: 60 LVNELPSIYLQLIYQKKDL 78
               P+  + +     +L
Sbjct: 61 -----PNDRVVINLAPAEL 74


>gi|149372528|ref|ZP_01891640.1| magnesium chelatase, subunit ChlI [unidentified eubacterium
          SCB49]
 gi|149354571|gb|EDM43135.1| magnesium chelatase, subunit ChlI [unidentified eubacterium
          SCB49]
          Length = 513

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++   A  G+    + V+V V  G  G  +VGLPD A+ ES  RI +   + G    
Sbjct: 1  MLTKVYGSAVFGVDATTITVEVNVDNGI-GYHLVGLPDNAIKESNYRIAAALQNNGYK-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   L L     DL
Sbjct: 58 ---IPGKKLILNMSPADL 72


>gi|16124395|ref|NP_418959.1| ComM protein [Caulobacter crescentus CB15]
 gi|221233078|ref|YP_002515514.1| magnesium chelatase subunit ChlI-like ATPase [Caulobacter
          crescentus NA1000]
 gi|13421251|gb|AAK22127.1| ComM protein [Caulobacter crescentus CB15]
 gi|220962250|gb|ACL93606.1| magnesium chelatase subunit ChlI-like ATPase [Caulobacter
          crescentus NA1000]
          Length = 535

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +R+ T+AF+G++   V+V+V ++ G+    +VGL DKAV ESRER++  F   GL   
Sbjct: 1  MAARVVTVAFEGVEARRVDVEVQLTTGQHAFVVVGLADKAVAESRERVRGAFAGLGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   +       DL
Sbjct: 58 --SLPGKRIVANLAPADL 73


>gi|295836280|ref|ZP_06823213.1| Mg chelatase-like protein [Streptomyces sp. SPB74]
 gi|197697355|gb|EDY44288.1| Mg chelatase-like protein [Streptomyces sp. SPB74]
          Length = 538

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 40/75 (53%), Gaps = 5/75 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           +R  ++   GI  + VEVQ  + PG     +VGLPDK+++ESR+R+++  +++G     
Sbjct: 3  FARTCSVTLLGIDAVVVEVQADLEPGVAAFTLVGLPDKSLVESRDRVRAAVVNSG----- 57

Query: 62 NELPSIYLQLIYQKK 76
           E P   L +     
Sbjct: 58 AEWPQKKLTVGLSPA 72


>gi|325860252|ref|ZP_08173377.1| Mg chelatase-like protein [Prevotella denticola CRIS 18C-A]
 gi|325482339|gb|EGC85347.1| Mg chelatase-like protein [Prevotella denticola CRIS 18C-A]
          Length = 513

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +    A  G++   V V+V ++ G     + GL D AV ES +RI +  ++ G  F 
Sbjct: 1  MLVKTFCAAVNGMEVTTVTVEVSITRGV-LFHLTGLADGAVKESHDRIAAALLNNGYKF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   +       DL
Sbjct: 59 ----PVADITANLAPADL 72


>gi|330997432|ref|ZP_08321283.1| Mg chelatase-like protein [Paraprevotella xylaniphila YIT 11841]
 gi|329570806|gb|EGG52522.1| Mg chelatase-like protein [Paraprevotella xylaniphila YIT 11841]
          Length = 512

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ ++   + +G+  IPV ++V  S G     +VGLPD AV ES ERI +   ++G  F 
Sbjct: 1  MLVKVYGASVRGLSAIPVTIEVNASRGI-KFFLVGLPDNAVKESHERIVAAVENSGFRF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              PS    +     D+
Sbjct: 59 ----PSKQFVVNMAPADI 72


>gi|238063319|ref|ZP_04608028.1| Mg2+ chelatase subunit chlI [Micromonospora sp. ATCC 39149]
 gi|237885130|gb|EEP73958.1| Mg2+ chelatase subunit chlI [Micromonospora sp. ATCC 39149]
          Length = 376

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           +++  +   G+ G  VEV+  ++PG   V I GLPD A+ E+R+R+++  +++G     
Sbjct: 3  YAKVLCVGLVGVTGHVVEVEADLAPGLPAVVISGLPDTALHEARDRVRAAVVNSG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L      +
Sbjct: 58 QRWPNRRITLNLLPATM 74


>gi|302345982|ref|YP_003814335.1| Mg chelatase-like protein [Prevotella melaninogenica ATCC 25845]
 gi|302150049|gb|ADK96311.1| Mg chelatase-like protein [Prevotella melaninogenica ATCC 25845]
          Length = 513

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +    A  G++   V V+V ++ G     + GL D AV ES +RI +  ++ G  F 
Sbjct: 1  MLVKTFCAAVNGMEVTTVTVEVSITRGV-LFHLTGLADGAVKESHDRIAAALLNTGYKF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   +       DL
Sbjct: 59 ----PVADITANLAPADL 72


>gi|312194958|ref|YP_004015019.1| Mg chelatase, subunit ChlI [Frankia sp. EuI1c]
 gi|311226294|gb|ADP79149.1| Mg chelatase, subunit ChlI [Frankia sp. EuI1c]
          Length = 512

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++R   +A  G++G  +EV+  ++ G   + ++GLPD A+ ESR+RI++  +++G     
Sbjct: 3  LARTLAVAVIGVEGHLIEVEAHLAGGLPALALIGLPDAALAESRDRIRAAVLNSG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
           + P   + +      L
Sbjct: 58 QKWPDERITVGLFPATL 74


>gi|256379910|ref|YP_003103570.1| Mg chelatase, subunit ChlI [Actinosynnema mirum DSM 43827]
 gi|255924213|gb|ACU39724.1| Mg chelatase, subunit ChlI [Actinosynnema mirum DSM 43827]
          Length = 506

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 47/77 (61%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++R  ++A +G++G+PVE++  V  G VG Q++GLPD A+ ES++R+++   ++G     
Sbjct: 3  LARAWSVALRGVEGVPVEIEADVGAGSVGTQLLGLPDAALHESKDRVRAAVRNSG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
           + P+  + L      +
Sbjct: 58 QQWPAHRVTLGLSPASM 74


>gi|260593457|ref|ZP_05858915.1| Mg chelatase-like protein [Prevotella veroralis F0319]
 gi|260534573|gb|EEX17190.1| Mg chelatase-like protein [Prevotella veroralis F0319]
          Length = 513

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +    A  G++   V V+V ++ G     + GL D AV ES +RI +  ++ G  F 
Sbjct: 1  MLVKTFCAAVNGMEVTTVTVEVSITRGV-LFHLTGLADAAVKESHDRIAAALLNTGYKF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   +       DL
Sbjct: 59 ----PVADITANLAPADL 72


>gi|303236395|ref|ZP_07322984.1| Mg chelatase-like protein [Prevotella disiens FB035-09AN]
 gi|302483367|gb|EFL46373.1| Mg chelatase-like protein [Prevotella disiens FB035-09AN]
          Length = 513

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +    A  G++   V V+V ++ G +   + GL D AV ES +RI +  ++ G  F 
Sbjct: 1  MLVKTYCAAVNGLEVNTVTVEVSITRGIM-YHLTGLADVAVKESHDRIAAALLNNGYKF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   +       DL
Sbjct: 59 ----PVADITANLAPADL 72


>gi|326335406|ref|ZP_08201593.1| competence protein ComM [Capnocytophaga sp. oral taxon 338 str.
          F0234]
 gi|325692172|gb|EGD34124.1| competence protein ComM [Capnocytophaga sp. oral taxon 338 str.
          F0234]
          Length = 513

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +I   A  G++ I + ++V +  G  G  +VGLPD A+ ES  RI++   +      
Sbjct: 1  MLVKIYGSAVYGVEAITITIEVNIDKGV-GYHLVGLPDNAIKESNFRIEAALQNNHYK-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     D+
Sbjct: 58 ---IPGKKITINMAPADM 72


>gi|327404505|ref|YP_004345343.1| Mg chelatase subunit ChlI [Fluviicola taffensis DSM 16823]
 gi|327320013|gb|AEA44505.1| Mg chelatase, subunit ChlI [Fluviicola taffensis DSM 16823]
          Length = 511

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +    A  GI    + ++V ++ G     +VGLPDKAV ES +RI++   +  L + 
Sbjct: 1  MLVKTFGSAVFGIDATTITIEVNIANGV-NFMLVGLPDKAVQESHQRIKAALKNNNLNY- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 59 ----PGKEITVNMAPADI 72


>gi|262066157|ref|ZP_06025769.1| Mg chelatase-like protein [Fusobacterium periodonticum ATCC
          33693]
 gi|291380132|gb|EFE87650.1| Mg chelatase-like protein [Fusobacterium periodonticum ATCC
          33693]
          Length = 497

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  +I T ++ G++   VEV+V +S G     IVG+ D A++ES+ R+++   ++     
Sbjct: 1  MKKKIFTSSYLGLESYLVEVEVDISRGLPMFSIVGMGDTAILESKFRVKAALKNSNY--- 57

Query: 61 VNELPSIYLQLIYQKK 76
            E+    + +     
Sbjct: 58 --EISPQKIVVNLSPA 71


>gi|118591484|ref|ZP_01548881.1| probable Mg-chelatase protein [Stappia aggregata IAM 12614]
 gi|118435812|gb|EAV42456.1| probable Mg-chelatase protein [Stappia aggregata IAM 12614]
          Length = 508

 Score = 91.6 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 49/78 (62%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+SRI+T+AF+GI+ +PV+VQV V PG V   IVGLPDKAV ESRER+++          
Sbjct: 1  MVSRITTVAFRGIEAVPVDVQVHVGPGMVAFTIVGLPDKAVAESRERVRAAL-----AAS 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  + +     DL
Sbjct: 56 GLALPAKRVTVNLAPADL 73


>gi|227543217|ref|ZP_03973266.1| possible ATPase [Corynebacterium glucuronolyticum ATCC 51866]
 gi|227181026|gb|EEI61998.1| possible ATPase [Corynebacterium glucuronolyticum ATCC 51866]
          Length = 510

 Score = 91.6 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++R  ++AF+G+    V+V+  V PG  G  IVGL DKAV ESR+RI+    ++ L    
Sbjct: 3  LARTKSVAFEGVTARIVDVEANVGPGLPGTYIVGLADKAVAESRDRIKLAAQNSHLP--- 59

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +      L
Sbjct: 60 --WPKTKIIVSLSPASL 74


>gi|152991611|ref|YP_001357332.1| Mg chelatase-related protein [Sulfurovum sp. NBC37-1]
 gi|151423472|dbj|BAF70975.1| Mg chelatase-related protein [Sulfurovum sp. NBC37-1]
          Length = 527

 Score = 91.6 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 16/77 (20%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++R++    +G+    +EV+   + G  G  +VGL    + E++ER++S  +    +F  
Sbjct: 27 VNRLTCATLEGVNAKVIEVEATFTKGLPGFSVVGLASSDIQEAKERVKSALLTNEFVF-- 84

Query: 62 NELPSIYLQLIYQKKDL 78
             P + + +     D+
Sbjct: 85 ---PPLKITINLSPSDI 98


>gi|307722029|ref|YP_003893169.1| Sigma 54 interacting domain-containing protein [Sulfurimonas
          autotrophica DSM 16294]
 gi|306980122|gb|ADN10157.1| Sigma 54 interacting domain protein [Sulfurimonas autotrophica
          DSM 16294]
          Length = 502

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 16/75 (21%), Positives = 34/75 (45%), Gaps = 5/75 (6%)

Query: 4  RISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNE 63
          ++    ++G+    V+V+  ++ G     IVG+   A+ ES+ER++S  +     F    
Sbjct: 3  KVRCATYEGVDAKVVDVESTLTKGLPSFSIVGMASTAITESKERVKSALLSNEFSF---- 58

Query: 64 LPSIYLQLIYQKKDL 78
           P   +  +    +L
Sbjct: 59 -PPKRITFLLAPSEL 72


>gi|227488614|ref|ZP_03918930.1| possible ATPase [Corynebacterium glucuronolyticum ATCC 51867]
 gi|227091508|gb|EEI26820.1| possible ATPase [Corynebacterium glucuronolyticum ATCC 51867]
          Length = 510

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++R  ++AF+G+    V+V+  V PG  G  IVGL DKAV ESR+RI+    ++ L    
Sbjct: 3  LARTKSVAFEGVTARIVDVEANVGPGLPGTYIVGLADKAVAESRDRIKLAAQNSHLP--- 59

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +      L
Sbjct: 60 --WPKTKIIVSLSPASL 74


>gi|256028479|ref|ZP_05442313.1| Mg(2+) chelatase family protein [Fusobacterium sp. D11]
 gi|289766400|ref|ZP_06525778.1| Mg(2+) chelatase [Fusobacterium sp. D11]
 gi|289717955|gb|EFD81967.1| Mg(2+) chelatase [Fusobacterium sp. D11]
          Length = 500

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  +I T ++ G++   VEV+V +S G     IVG+ D A++ES+ R+++   ++     
Sbjct: 1  MKKKIFTSSYLGLESYLVEVEVDISRGLPMFSIVGMGDTAILESKFRVKAALKNSNY--- 57

Query: 61 VNELPSIYLQLIYQKK 76
            E+    + +     
Sbjct: 58 --EIAPQKIVVNLSPA 71


>gi|226324650|ref|ZP_03800168.1| hypothetical protein COPCOM_02435 [Coprococcus comes ATCC 27758]
 gi|225207098|gb|EEG89452.1| hypothetical protein COPCOM_02435 [Coprococcus comes ATCC 27758]
          Length = 518

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 14/73 (19%), Positives = 30/73 (41%), Gaps = 5/73 (6%)

Query: 4  RISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNE 63
          ++ +    G+K   V+V+     G     +VG     V E+ ER+++   +AG       
Sbjct: 15 KVHSATILGLKVEFVQVEADAGNGLPMFHMVGYLSSEVKEAAERVRTAMRNAGYT----- 69

Query: 64 LPSIYLQLIYQKK 76
          +P+  + +     
Sbjct: 70 MPAKKIVINLSPA 82


>gi|203284011|ref|YP_002221751.1| magnesium chelatase family protein [Borrelia duttonii Ly]
 gi|201083454|gb|ACH93045.1| magnesium chelatase family protein [Borrelia duttonii Ly]
          Length = 535

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 5/73 (6%)

Query: 4  RISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNE 63
          +I + +  G +G  +EV+V +  G  G+ IVGL    + ESRERI++   ++   F    
Sbjct: 28 QIYSHSSIGYEGELIEVEVDIKKGIPGIDIVGLAGSEIKESRERIKAAIKNSEFTF---- 83

Query: 64 LPSIYLQLIYQKK 76
           P   + +     
Sbjct: 84 -PKDRILINLAPA 95


>gi|7514624|pir||H71378 conserved hypothetical protein TP0866 - syphilis spirochete
          Length = 646

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +I + +  G +G  ++V+V +  G   V IVGLP  AV E++ERI++   +A L F 
Sbjct: 1  MV-QIMSFSAFGYEGEVIKVEVDLRRGLPVVDIVGLPGSAVKEAKERIRAAIRNAALPF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 59 ----PQERILINLSPADL 72


>gi|332881127|ref|ZP_08448788.1| Mg chelatase-like protein [Capnocytophaga sp. oral taxon 329 str.
          F0087]
 gi|332680922|gb|EGJ53858.1| Mg chelatase-like protein [Capnocytophaga sp. oral taxon 329 str.
          F0087]
          Length = 511

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +I   A  G++   + ++V +  G  G  +VGLPD A+ ES  RI +   + G    
Sbjct: 1  MLVKIYGSAVFGVEATTITIEVNIDKGV-GYYLVGLPDVAIKESNYRIAAALQNNGYK-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     D+
Sbjct: 58 ---IPGRKITINMAPADM 72


>gi|84498370|ref|ZP_00997167.1| hypothetical protein JNB_19823 [Janibacter sp. HTCC2649]
 gi|84381870|gb|EAP97753.1| hypothetical protein JNB_19823 [Janibacter sp. HTCC2649]
          Length = 514

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 18/77 (23%), Positives = 34/77 (44%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R   +A  G+ G  V+V+  +S       + GLPDKA  ++ +R++S    +G     
Sbjct: 5  LGRTLCVALTGLNGRLVDVEAHISSQLPNFSVTGLPDKACGQAPDRVRSAAATSGFP--- 61

Query: 62 NELPSIYLQLIYQKKDL 78
            LP   + +      +
Sbjct: 62 --LPPQRITVNLSPASI 76


>gi|294784107|ref|ZP_06749408.1| Mg chelatase-like protein [Fusobacterium sp. 3_1_27]
 gi|294488177|gb|EFG35522.1| Mg chelatase-like protein [Fusobacterium sp. 3_1_27]
          Length = 500

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  +I T ++ G++   VEV+V +S G     IVG+ D A++ES+ R+++   ++     
Sbjct: 1  MKKKIFTSSYLGLESYLVEVEVDISRGLPMFSIVGMGDTAILESKFRVKAALKNSNY--- 57

Query: 61 VNELPSIYLQLIYQKK 76
            E+    + +     
Sbjct: 58 --EITPQKIIVNLSPA 71


>gi|91214722|ref|ZP_01251695.1| hypothetical protein P700755_17694 [Psychroflexus torquis ATCC
          700755]
 gi|91187149|gb|EAS73519.1| hypothetical protein P700755_17694 [Psychroflexus torquis ATCC
          700755]
          Length = 512

 Score = 91.2 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ ++   +  G+    + V++ +  G  G  +VGLPD A+ ES  RIQ+   + G  F 
Sbjct: 1  MLVKVFGSSVFGVDAEIITVEINMEKGI-GYHLVGLPDNAIRESSFRIQAALKNTGFKF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 59 ----PGKKIIVNMAPADM 72


>gi|330976622|gb|EGH76666.1| Mg chelatase-related protein [Pseudomonas syringae pv. aptata
          str. DSM 50252]
          Length = 67

 Score = 91.2 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 41/70 (58%), Gaps = 5/70 (7%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G++   V V+  ++ G   + +VGLP+ AV ES++R++S  +++GL F  
Sbjct: 3  LAIVHSRAQVGVEAPAVTVEAHLANGLPALTLVGLPEGAVKESKDRVRSAILNSGLDF-- 60

Query: 62 NELPSIYLQL 71
             P+  + L
Sbjct: 61 ---PARRITL 67


>gi|300727436|ref|ZP_07060845.1| Mg chelatase-like protein [Prevotella bryantii B14]
 gi|299775316|gb|EFI71915.1| Mg chelatase-like protein [Prevotella bryantii B14]
          Length = 515

 Score = 91.2 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +    A  G+    V V+V ++ G +   + GL D AV ES++RI +   ++G  F 
Sbjct: 1  MLVKTYCAAVNGLNVTTVTVEVSLNRGVM-YHLTGLGDTAVRESKDRISAAMQYSGYHF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 59 ----PIADITVNMAPADL 72


>gi|227495324|ref|ZP_03925640.1| ATPase [Actinomyces coleocanis DSM 15436]
 gi|226831194|gb|EEH63577.1| ATPase [Actinomyces coleocanis DSM 15436]
          Length = 517

 Score = 90.8 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 5/75 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I R   +A  G++G  ++V+  V+PG V   +VGLPD  V ES+ER+++     G+ ++ 
Sbjct: 5  IVRTHAVAIVGMEGRIIDVETHVAPGLVAFNLVGLPDAGVKESKERVRAALQTCGIKWVE 64

Query: 62 NELPSIYLQLIYQKK 76
          +      + +     
Sbjct: 65 H-----RVTVNLSPA 74


>gi|300783887|ref|YP_003764178.1| magnesium chelatase family protein [Amycolatopsis mediterranei
          U32]
 gi|299793401|gb|ADJ43776.1| magnesium chelatase family protein [Amycolatopsis mediterranei
          U32]
          Length = 503

 Score = 90.8 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 18/77 (23%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I++  +    GI G  +E++  +  G   + +VGLPD  + E+++R++S   ++G     
Sbjct: 3  IAKAWSAGLLGINGRVIEIEADLGGGLSRITLVGLPDAGLREAKDRVRSAVRNSG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + L     +L
Sbjct: 58 QPWPDGKVTLGLSPANL 74


>gi|198277384|ref|ZP_03209915.1| hypothetical protein BACPLE_03596 [Bacteroides plebeius DSM
          17135]
 gi|198269882|gb|EDY94152.1| hypothetical protein BACPLE_03596 [Bacteroides plebeius DSM
          17135]
          Length = 512

 Score = 90.8 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ ++   A QGI    V ++V  S G     +VGLPD AV ES ERI S     G  F 
Sbjct: 1  MLVKLFGAAVQGIDATIVTIEVNCSRGI-KFYLVGLPDSAVKESHERIVSALQVNGYKF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     D+
Sbjct: 59 ----PTRQIVVNMAPADI 72


>gi|257784504|ref|YP_003179721.1| Mg chelatase, subunit ChlI [Atopobium parvulum DSM 20469]
 gi|257473011|gb|ACV51130.1| Mg chelatase, subunit ChlI [Atopobium parvulum DSM 20469]
          Length = 498

 Score = 90.8 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 41/74 (55%), Gaps = 5/74 (6%)

Query: 5  ISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNEL 64
          + T   +GI+ IPV+V+V +  G  G+ IVG+PD +++ESR R++     AG       +
Sbjct: 8  VHTATLRGIEAIPVDVEVGILGGIPGITIVGMPDSSIMESRSRVRCSLKAAGFT-----I 62

Query: 65 PSIYLQLIYQKKDL 78
          P + + +     D+
Sbjct: 63 PRLLVTINLTPADI 76


>gi|325662150|ref|ZP_08150768.1| hypothetical protein HMPREF0490_01506 [Lachnospiraceae bacterium
          4_1_37FAA]
 gi|325471599|gb|EGC74819.1| hypothetical protein HMPREF0490_01506 [Lachnospiraceae bacterium
          4_1_37FAA]
          Length = 169

 Score = 90.8 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 35/78 (44%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S + + + QG++   + V+  V  G     +VG     V ES ER+++   ++G    
Sbjct: 1  MFSTVLSASLQGMQAEFIHVEADVGNGLPFFHMVGHLASEVKESAERVRTAVKNSG---- 56

Query: 61 VNELPSIYLQLIYQKKDL 78
            ++P   + +     ++
Sbjct: 57 -IQIPPRKVVINLSPANV 73


>gi|237725985|ref|ZP_04556466.1| magnesium chelatase [Bacteroides sp. D4]
 gi|229435793|gb|EEO45870.1| magnesium chelatase [Bacteroides dorei 5_1_36/D4]
          Length = 512

 Score = 90.8 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ ++   A QGI    V ++V  S G     +VGLPD AV ES ERI S     G  F 
Sbjct: 1  MLVKVYGAAVQGIDATIVTIEVNSSRGI-KFFLVGLPDSAVKESHERIISALQVNGYKF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     D+
Sbjct: 59 ----PTCQIVVNMAPADI 72


>gi|295691355|ref|YP_003595048.1| Mg chelatase subunit ChlI [Caulobacter segnis ATCC 21756]
 gi|295433258|gb|ADG12430.1| Mg chelatase, subunit ChlI [Caulobacter segnis ATCC 21756]
          Length = 510

 Score = 90.8 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +R+ T+AF+G++   V+V+V ++ G+    +VGL DKAV ESRER++  F   GL   
Sbjct: 1  MAARVVTVAFEGVEARRVDVEVQLTTGQHAFVVVGLADKAVAESRERVRGAFAGLGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   +       D+
Sbjct: 58 --SLPGKRIVANLAPADM 73


>gi|237711561|ref|ZP_04542042.1| magnesium chelatase [Bacteroides sp. 9_1_42FAA]
 gi|265752989|ref|ZP_06088558.1| Mg chelatase [Bacteroides sp. 3_1_33FAA]
 gi|229454256|gb|EEO59977.1| magnesium chelatase [Bacteroides sp. 9_1_42FAA]
 gi|263236175|gb|EEZ21670.1| Mg chelatase [Bacteroides sp. 3_1_33FAA]
          Length = 512

 Score = 90.8 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ ++   A QGI    V ++V  S G     +VGLPD AV ES ERI S     G  F 
Sbjct: 1  MLVKVYGAAVQGIDATIVTIEVNSSRGI-KFFLVGLPDSAVKESHERIISALQVNGYKF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     D+
Sbjct: 59 ----PTCQIVVNMAPADI 72


>gi|212695401|ref|ZP_03303529.1| hypothetical protein BACDOR_04950 [Bacteroides dorei DSM 17855]
 gi|212662036|gb|EEB22610.1| hypothetical protein BACDOR_04950 [Bacteroides dorei DSM 17855]
          Length = 512

 Score = 90.8 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ ++   A QGI    V ++V  S G     +VGLPD AV ES ERI S     G  F 
Sbjct: 1  MLVKVYGAAVQGIDATIVTIEVNSSRGI-KFFLVGLPDSAVKESHERIISALQVNGYKF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     D+
Sbjct: 59 ----PTCQIVVNMAPADI 72


>gi|163797085|ref|ZP_02191040.1| Mg chelatase-related protein [alpha proteobacterium BAL199]
 gi|159177601|gb|EDP62154.1| Mg chelatase-related protein [alpha proteobacterium BAL199]
          Length = 506

 Score = 90.8 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 32/79 (40%), Positives = 47/79 (59%), Gaps = 6/79 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPG-RVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M +R++T+AF+GI+ + V+VQV V  G   G+ +VGLPDKAV ESRER+ +     GL  
Sbjct: 1  MPARVATVAFRGIETLEVDVQVHVGGGGWPGIYVVGLPDKAVGESRERVHAALSALGL-- 58

Query: 60 LVNELPSIYLQLIYQKKDL 78
              +P   + +     DL
Sbjct: 59 ---AIPQKRIVVNLAPADL 74


>gi|315604540|ref|ZP_07879603.1| Mg-chelatase D/I family [Actinomyces sp. oral taxon 180 str.
          F0310]
 gi|315313552|gb|EFU61606.1| Mg-chelatase D/I family [Actinomyces sp. oral taxon 180 str.
          F0310]
          Length = 515

 Score = 90.4 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 5/75 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++R  +++  GI+G  V+V+     G V   +VGL D +V E+R+R+++ F   GL  L 
Sbjct: 6  LARTYSMSIVGIEGHLVDVETYAGSGLVAFTLVGLLDTSVREARDRVRAAFESCGLDVLD 65

Query: 62 NELPSIYLQLIYQKK 76
                 + +     
Sbjct: 66 -----QRITVNLSPA 75


>gi|333024160|ref|ZP_08452224.1| putative magnesium chelatase [Streptomyces sp. Tu6071]
 gi|332744012|gb|EGJ74453.1| putative magnesium chelatase [Streptomyces sp. Tu6071]
          Length = 538

 Score = 90.4 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 40/75 (53%), Gaps = 5/75 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           +R  ++   GI  + VEVQ  + PG     +VGLPDK+++ESR+R+++  +++G     
Sbjct: 3  FARTCSVTLLGIDAVVVEVQADLEPGVAAFALVGLPDKSLVESRDRVRAAVVNSG----- 57

Query: 62 NELPSIYLQLIYQKK 76
           E P   L +     
Sbjct: 58 AEWPQKKLTVGLSPA 72


>gi|268680777|ref|YP_003305208.1| Mg chelatase, subunit ChlI [Sulfurospirillum deleyianum DSM 6946]
 gi|268618808|gb|ACZ13173.1| Mg chelatase, subunit ChlI [Sulfurospirillum deleyianum DSM 6946]
          Length = 511

 Score = 90.4 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 34/80 (42%), Gaps = 8/80 (10%)

Query: 2  ISRIS---TIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLL 58
          +SR+         G K   V V+  +     G  IVG+ D+++ ESRERI+S        
Sbjct: 7  LSRVKHAKCATLYGNKAHEVAVESTLVRSLPGFSIVGMADQSIQESRERIKSALSSIHF- 65

Query: 59 FLVNELPSIYLQLIYQKKDL 78
              E PS  + +     DL
Sbjct: 66 ----EFPSQKITINLSPSDL 81


>gi|224438110|ref|ZP_03659045.1| competence protein ComM [Helicobacter cinaedi CCUG 18818]
 gi|313144550|ref|ZP_07806743.1| competence protein ComM [Helicobacter cinaedi CCUG 18818]
 gi|313129581|gb|EFR47198.1| competence protein ComM [Helicobacter cinaedi CCUG 18818]
          Length = 508

 Score = 90.4 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 33/78 (42%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ I +    G     ++V+     G     I GL   ++ ES++R+Q+   + G+   
Sbjct: 1  MVNTILSATSFGTSAKIIQVEATFIRGLPSFNITGLAHSSIQESKQRVQAALANIGIT-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     D+
Sbjct: 59 ---LPPQKININLSPSDI 73


>gi|294675026|ref|YP_003575642.1| Mg-chelatase subunits D/I family, ComM subfamily protein
          [Prevotella ruminicola 23]
 gi|294473491|gb|ADE82880.1| Mg-chelatase subunits D/I family, ComM subfamily protein
          [Prevotella ruminicola 23]
          Length = 513

 Score = 90.4 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 35/78 (44%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +  + A   ++   + ++V ++ G     + GL D AV ES +RI++   + G    
Sbjct: 1  MLVKTYSAAVTALEATTITIEVNLARGT-SFHLSGLADTAVKESYDRIRAAIENIGYKS- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  L +     D+
Sbjct: 59 ----PTADLTINMSPADI 72


>gi|332881235|ref|ZP_08448885.1| Mg chelatase-like protein [Capnocytophaga sp. oral taxon 329 str.
          F0087]
 gi|332680611|gb|EGJ53558.1| Mg chelatase-like protein [Capnocytophaga sp. oral taxon 329 str.
          F0087]
          Length = 512

 Score = 90.4 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ ++   + +G+  IPV ++V  S G     +VGLPD AV ES ERI +   ++G  F 
Sbjct: 1  MLVKVYGASVRGLSAIPVTIEVNASRGI-KFFLVGLPDNAVKESHERIVAAVENSGYRF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              PS    +     D+
Sbjct: 59 ----PSKQFVVNMAPADI 72


>gi|294783424|ref|ZP_06748748.1| Mg chelatase-like protein [Fusobacterium sp. 1_1_41FAA]
 gi|294480302|gb|EFG28079.1| Mg chelatase-like protein [Fusobacterium sp. 1_1_41FAA]
          Length = 497

 Score = 90.4 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 39/76 (51%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M ++I T ++ G++   VEV+V +S G     IVG+ D A++ES+ R+++   ++     
Sbjct: 1  MKNKIFTSSYLGLESYLVEVEVDISRGLPMFSIVGMGDTAILESKFRVKAALKNSDY--- 57

Query: 61 VNELPSIYLQLIYQKK 76
            E+    + +     
Sbjct: 58 --EVRPQKIVVNLSPA 71


>gi|302522169|ref|ZP_07274511.1| magnesium chelatase [Streptomyces sp. SPB78]
 gi|302431064|gb|EFL02880.1| magnesium chelatase [Streptomyces sp. SPB78]
          Length = 538

 Score = 90.4 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 40/75 (53%), Gaps = 5/75 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           +R  ++   GI  + VEVQ  + PG     +VGLPDK+++ESR+R+++  +++G     
Sbjct: 3  FARTCSVTLLGIDAVVVEVQADLEPGVAAFALVGLPDKSLVESRDRVRAAVVNSG----- 57

Query: 62 NELPSIYLQLIYQKK 76
           E P   L +     
Sbjct: 58 AEWPQKKLTVGLSPA 72


>gi|221194583|ref|ZP_03567640.1| Mg chelatase homolog [Atopobium rimae ATCC 49626]
 gi|221185487|gb|EEE17877.1| Mg chelatase homolog [Atopobium rimae ATCC 49626]
          Length = 487

 Score = 90.4 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 5/73 (6%)

Query: 6  STIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELP 65
           T   +GI+ +P+ V+  V+ G  GV +VG+PD AV+E+R R++      G       +P
Sbjct: 2  RTATIRGIESVPINVEASVAGGIPGVTVVGMPDSAVLEARSRVRCAINACGF-----AIP 56

Query: 66 SIYLQLIYQKKDL 78
            ++ +     D+
Sbjct: 57 RRHITINLSPADM 69


>gi|254417832|ref|ZP_05031556.1| Mg chelatase family protein [Brevundimonas sp. BAL3]
 gi|196184009|gb|EDX78985.1| Mg chelatase family protein [Brevundimonas sp. BAL3]
          Length = 538

 Score = 90.4 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 43/80 (53%), Gaps = 7/80 (8%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVG--VQIVGLPDKAVIESRERIQSHFIHAGLL 58
          M++R+ T+AF G++   V+V+V +          IVGLPDKAV ESRER++  F   GL 
Sbjct: 1  MVARVVTVAFDGVEARRVDVEVQLVGQDQQTVFNIVGLPDKAVAESRERVRGAFAGIGL- 59

Query: 59 FLVNELPSIYLQLIYQKKDL 78
               LP+  +       DL
Sbjct: 60 ----ALPAKRIIANLAPADL 75


>gi|332526435|ref|ZP_08402555.1| putative Mg(2+) chelatase family protein [Rubrivivax
          benzoatilyticus JA2]
 gi|332110565|gb|EGJ10888.1| putative Mg(2+) chelatase family protein [Rubrivivax
          benzoatilyticus JA2]
          Length = 68

 Score = 90.4 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 19/70 (27%), Positives = 34/70 (48%), Gaps = 4/70 (5%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + + A  G+    V V+V ++ G     +VGL D  V ESRER+++    +G  F  
Sbjct: 3  LAVVMSRALDGLDAPAVHVEVQLANGLPSFTLVGLADTEVKESRERVRAALQSSGFSFPH 62

Query: 62 NELPSIYLQL 71
          N      + +
Sbjct: 63 N----RRITV 68


>gi|38234091|ref|NP_939858.1| hypothetical protein DIP1512 [Corynebacterium diphtheriae NCTC
          13129]
 gi|38200353|emb|CAE50039.1| Conserved hypothetical protein [Corynebacterium diphtheriae]
          Length = 516

 Score = 90.4 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +++  + A  G+ G+ V+V+  +  G  G  IVGL D AV E+R+RI++   ++ L    
Sbjct: 3  LAKTRSAAISGVTGVIVDVEANIGAGLPGTYIVGLADAAVAEARQRIKTAVNNSELP--- 59

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +      L
Sbjct: 60 --WPKTKVIVNLSPASL 74


>gi|150003454|ref|YP_001298198.1| magnesium chelatase, subunit ChlI [Bacteroides vulgatus ATCC
          8482]
 gi|254881248|ref|ZP_05253958.1| magnesium chelatase [Bacteroides sp. 4_3_47FAA]
 gi|294777664|ref|ZP_06743115.1| Mg chelatase-like protein [Bacteroides vulgatus PC510]
 gi|149931878|gb|ABR38576.1| magnesium chelatase, subunit ChlI [Bacteroides vulgatus ATCC
          8482]
 gi|254834041|gb|EET14350.1| magnesium chelatase [Bacteroides sp. 4_3_47FAA]
 gi|294448732|gb|EFG17281.1| Mg chelatase-like protein [Bacteroides vulgatus PC510]
          Length = 512

 Score = 90.4 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ ++   A QGI    V ++V  S G     +VGLPD AV ES ERI S     G  F 
Sbjct: 1  MLVKVYGAAVQGIDATIVTIEVNSSRGI-KFFLVGLPDSAVKESHERIISALQVNGYKF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     D+
Sbjct: 59 ----PTCQIVVNMAPADI 72


>gi|260495019|ref|ZP_05815148.1| Mg(2+) chelatase [Fusobacterium sp. 3_1_33]
 gi|260197462|gb|EEW94980.1| Mg(2+) chelatase [Fusobacterium sp. 3_1_33]
          Length = 507

 Score = 90.4 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  +I T ++ G++   VEV+V +S G     IVG+ D A++ES+ R+++   ++     
Sbjct: 8  MKKKIFTSSYLGLESYLVEVEVDISRGLPMFSIVGMGDTAILESKFRVKAALKNSNY--- 64

Query: 61 VNELPSIYLQLIYQKK 76
            E+    + +     
Sbjct: 65 --EIVPQKIVVNLSPA 78


>gi|318056576|ref|ZP_07975299.1| magnesium chelatase [Streptomyces sp. SA3_actG]
 gi|318077458|ref|ZP_07984790.1| magnesium chelatase [Streptomyces sp. SA3_actF]
          Length = 538

 Score = 90.4 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 40/75 (53%), Gaps = 5/75 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           +R  ++   GI  + VEVQ  + PG     +VGLPDK+++ESR+R+++  +++G     
Sbjct: 3  FARTCSVTLLGIDAVVVEVQADLEPGVAAFALVGLPDKSLVESRDRVRAAVVNSG----- 57

Query: 62 NELPSIYLQLIYQKK 76
           E P   L +     
Sbjct: 58 AEWPQKKLTVGLSPA 72


>gi|319640250|ref|ZP_07994975.1| magnesium chelatase [Bacteroides sp. 3_1_40A]
 gi|317388025|gb|EFV68879.1| magnesium chelatase [Bacteroides sp. 3_1_40A]
          Length = 512

 Score = 90.4 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ ++   A QGI    V ++V  S G     +VGLPD AV ES ERI S     G  F 
Sbjct: 1  MLVKVYGAAVQGIDATIVTIEVNSSRGI-KFFLVGLPDSAVKESHERIISALQVNGYKF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     D+
Sbjct: 59 ----PTCQIVVNMAPADI 72


>gi|154504526|ref|ZP_02041264.1| hypothetical protein RUMGNA_02030 [Ruminococcus gnavus ATCC
          29149]
 gi|153795008|gb|EDN77428.1| hypothetical protein RUMGNA_02030 [Ruminococcus gnavus ATCC
          29149]
          Length = 507

 Score = 90.4 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 15/77 (19%), Positives = 33/77 (42%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
             + + A  G++   + V+  VS G     +VG     V E+ ER+++   ++G+ F  
Sbjct: 3  FCSVLSAAVIGLRVEFIHVEADVSNGLPVFHMVGYLSSEVKEAAERVRTAIRNSGVSF-- 60

Query: 62 NELPSIYLQLIYQKKDL 78
             P+    +     ++
Sbjct: 61 ---PAKRTIVNLAPANV 74


>gi|257055036|ref|YP_003132868.1| Mg chelatase-like protein [Saccharomonospora viridis DSM 43017]
 gi|256584908|gb|ACU96041.1| Mg chelatase-related protein [Saccharomonospora viridis DSM
          43017]
          Length = 503

 Score = 90.4 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++R  +IA  GI+G  VE++  +  G  G ++VGLPD  + E+++R+++   ++      
Sbjct: 3  LARTWSIALLGIEGRLVEIEADIGAGMPGTKLVGLPDPGLREAKDRVRAAVRNS-----R 57

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + L     +L
Sbjct: 58 QTWPDTKVTLGLFPANL 74


>gi|261879041|ref|ZP_06005468.1| competence protein ComM [Prevotella bergensis DSM 17361]
 gi|270334322|gb|EFA45108.1| competence protein ComM [Prevotella bergensis DSM 17361]
          Length = 513

 Score = 90.4 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +  + A  G++  PV ++V ++ G     + GL D+AV E R+RI +  +H    F 
Sbjct: 1  MLIKTYSAAVNGLEVTPVTIEVSITKGI-VYHLTGLGDEAVKEGRDRIAAALMHNNFHF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 59 ----PRADITVNMAPADL 72


>gi|88855251|ref|ZP_01129916.1| competence protein M [marine actinobacterium PHSC20C1]
 gi|88815779|gb|EAR25636.1| competence protein M [marine actinobacterium PHSC20C1]
          Length = 511

 Score = 90.4 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I R   ++  G++G  VE++  +S    G  ++GLPD A+ E+++R+++   ++G     
Sbjct: 3  IGRTYAVSLLGLEGAIVEIEADLSNNLPGFVLIGLPDTALGEAKDRVRAAATNSGCG--- 59

Query: 62 NELPSIYLQLIYQKKDL 78
            LP+  + +      L
Sbjct: 60 --LPNRKITVNLSPAAL 74


>gi|227539012|ref|ZP_03969061.1| ATPase [Sphingobacterium spiritivorum ATCC 33300]
 gi|227241215|gb|EEI91230.1| ATPase [Sphingobacterium spiritivorum ATCC 33300]
          Length = 512

 Score = 90.4 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +    A  GI+   + V+V +SPG     IVGLPD AV ES +RI++    +G    
Sbjct: 1  MLVKTYCSAVYGIQATTITVEVNISPGV-KYYIVGLPDNAVKESLQRIETAISSSGYR-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     D+
Sbjct: 58 ---MPRQKIVVNLAPADI 72


>gi|296329189|ref|ZP_06871690.1| Mg chelatase-like protein [Fusobacterium nucleatum subsp.
          nucleatum ATCC 23726]
 gi|296153545|gb|EFG94362.1| Mg chelatase-like protein [Fusobacterium nucleatum subsp.
          nucleatum ATCC 23726]
          Length = 499

 Score = 90.4 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  +I T ++ G++   VEV+V VS G     IVG+ D A++ES+ R+++   ++     
Sbjct: 1  MKKKIFTSSYLGLESYLVEVEVDVSRGLPMFSIVGMGDTAILESKFRVKAALKNSNY--- 57

Query: 61 VNELPSIYLQLIYQKK 76
            E+    + +     
Sbjct: 58 --EIVPQKIVVNLSPA 71


>gi|255037395|ref|YP_003088016.1| Mg chelatase, subunit ChlI [Dyadobacter fermentans DSM 18053]
 gi|254950151|gb|ACT94851.1| Mg chelatase, subunit ChlI [Dyadobacter fermentans DSM 18053]
          Length = 513

 Score = 90.4 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+++    A  G+    + ++V V  G  G  +VGL D AV ES++R+++   H G    
Sbjct: 1  MLAKTYGSAVFGVDATIITIEVNVGQGL-GFYMVGLADNAVKESQQRVEASLKHFGYK-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   L +     D+
Sbjct: 58 ---MPRQKLVVNLAPADI 72


>gi|300770520|ref|ZP_07080399.1| Mg chelatase-like protein [Sphingobacterium spiritivorum ATCC
          33861]
 gi|300762996|gb|EFK59813.1| Mg chelatase-like protein [Sphingobacterium spiritivorum ATCC
          33861]
          Length = 512

 Score = 90.4 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +    A  GI+   + V+V +SPG     IVGLPD AV ES +RI++    +G    
Sbjct: 1  MLVKTYCSAVYGIQATTITVEVNISPGV-KYYIVGLPDNAVKESLQRIETAISSSGYR-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     D+
Sbjct: 58 ---MPRQKIVVNLAPADI 72


>gi|88801383|ref|ZP_01116911.1| magnesium chelatase subunit ChlI [Polaribacter irgensii 23-P]
 gi|88782041|gb|EAR13218.1| magnesium chelatase subunit ChlI [Polaribacter irgensii 23-P]
          Length = 511

 Score = 90.4 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ ++   A  GI+   + V+V +  G  G  +VGLPD AV ES  RI +   +      
Sbjct: 1  MLVKVYGAAVFGIEATTIAVEVNIDAGI-GYHLVGLPDNAVRESSYRISAALKNNNYK-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     D+
Sbjct: 58 ---LPGKKIIINMAPADI 72


>gi|254303388|ref|ZP_04970746.1| possible ATP-binding protein [Fusobacterium nucleatum subsp.
          polymorphum ATCC 10953]
 gi|148323580|gb|EDK88830.1| possible ATP-binding protein [Fusobacterium nucleatum subsp.
          polymorphum ATCC 10953]
          Length = 499

 Score = 90.0 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  +I T ++ G++   VEV+V +S G     IVG+ D A++ES+ R+++   ++     
Sbjct: 1  MKKKIFTSSYLGLESYLVEVEVDISRGLPMFSIVGMGDTAILESKFRVKAALKNS----- 55

Query: 61 VNELPSIYLQLIYQKK 76
            E+    + +     
Sbjct: 56 DYEIVPQKIVVNLSPA 71


>gi|296120432|ref|YP_003628210.1| Mg chelatase, subunit ChlI [Planctomyces limnophilus DSM 3776]
 gi|296012772|gb|ADG66011.1| Mg chelatase, subunit ChlI [Planctomyces limnophilus DSM 3776]
          Length = 511

 Score = 90.0 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 6/79 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPG-RVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M++R+ T +  GI  + ++V+V +SPG      +VGL + AV ES  RI+   +++G   
Sbjct: 1  MLARLMTYSLLGIDAVAIDVEVDISPGALPKTTLVGLAEAAVRESTHRIERALVNSGY-- 58

Query: 60 LVNELPSIYLQLIYQKKDL 78
             + P  +  +     DL
Sbjct: 59 ---QRPVDHTVINLSPADL 74


>gi|288926898|ref|ZP_06420798.1| Mg chelatase-like protein [Prevotella buccae D17]
 gi|315607118|ref|ZP_07882122.1| Mg chelatase-like protein [Prevotella buccae ATCC 33574]
 gi|288336337|gb|EFC74718.1| Mg chelatase-like protein [Prevotella buccae D17]
 gi|315251172|gb|EFU31157.1| Mg chelatase-like protein [Prevotella buccae ATCC 33574]
          Length = 515

 Score = 90.0 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +    A  G++   V ++V +S G +   + GL D+AV ESR+RI +   + G  F 
Sbjct: 1  MLVKTYCAAVNGLEVTTVMIEVSLSQGVM-YHLTGLGDEAVRESRDRIAAALQYNGFKF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 59 ----PVADITVNMAPADL 72


>gi|23308885|ref|NP_601235.2| ATPase with chaperone activity [Corynebacterium glutamicum ATCC
          13032]
 gi|62390869|ref|YP_226271.1| ATPase with chaperone activity [Corynebacterium glutamicum ATCC
          13032]
 gi|21324800|dbj|BAB99423.1| Predicted ATPase with chaperone activity [Corynebacterium
          glutamicum ATCC 13032]
 gi|41326208|emb|CAF20370.1| Predicted ATPase with chaperone activity [Corynebacterium
          glutamicum ATCC 13032]
          Length = 507

 Score = 90.0 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  + A  G++   V V+  V PG  G  IVGL D A+ ESR+RI++   ++GL+   
Sbjct: 3  LGRTISTAQLGVQAKIVRVEANVGPGLPGTYIVGLADTAISESRDRIKTAVQNSGLM--- 59

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +      +
Sbjct: 60 --WPKTKVIINLSPASM 74


>gi|19704935|ref|NP_602430.1| Mg(2+) chelatase family protein [Fusobacterium nucleatum subsp.
          nucleatum ATCC 25586]
 gi|19712834|gb|AAL93729.1| MG(2+) chelatase family protein [Fusobacterium nucleatum subsp.
          nucleatum ATCC 25586]
          Length = 497

 Score = 90.0 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  +I T ++ G++   VEV+V VS G     IVG+ D A++ES+ R+++   ++     
Sbjct: 1  MKKKIFTSSYLGLESYLVEVEVDVSRGLPMFSIVGMGDTAILESKFRVKAALKNSNY--- 57

Query: 61 VNELPSIYLQLIYQKK 76
            E+    + +     
Sbjct: 58 --EIVPQKIVVNLSPA 71


>gi|324998961|ref|ZP_08120073.1| hypothetical protein PseP1_09361 [Pseudonocardia sp. P1]
          Length = 113

 Score = 90.0 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++R+ ++   G+ G+PVE++  +  G  GV +VGLPD A+ E+++R++S  +H+G     
Sbjct: 4  LARVWSVELHGVDGVPVEIEAAIGGGIPGVHLVGLPDAALNEAKDRVRSAVVHSG----- 58

Query: 62 NELPSIYLQLIYQKKDL 78
             P+  + L      L
Sbjct: 59 RRWPNERIVLALSPATL 75


>gi|145295933|ref|YP_001138754.1| hypothetical protein cgR_1858 [Corynebacterium glutamicum R]
 gi|140845853|dbj|BAF54852.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 507

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  + A  G++   V V+  V PG  G  IVGL D A+ ESR+RI++   ++GL+   
Sbjct: 3  LGRTISTAQLGVQAKIVRVEANVGPGLPGTYIVGLADTAISESRDRIKTAVQNSGLM--- 59

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +      +
Sbjct: 60 --WPKTKVIINLSPASM 74


>gi|296283119|ref|ZP_06861117.1| Mg chelatase-related protein [Citromicrobium bathyomarinum JL354]
          Length = 502

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++ + T+A+ G++   VEVQ  ++ G     +VGLPDKAV ESRER+Q+         +
Sbjct: 1  MVALVRTVAYLGLEARSVEVQCQLASGLPRFSVVGLPDKAVSESRERVQAAL-----AAM 55

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     DL
Sbjct: 56 GLALPPKRITVNLSPADL 73


>gi|239982578|ref|ZP_04705102.1| magnesium chelatase [Streptomyces albus J1074]
 gi|291454420|ref|ZP_06593810.1| magnesium chelatase [Streptomyces albus J1074]
 gi|291357369|gb|EFE84271.1| magnesium chelatase [Streptomyces albus J1074]
          Length = 537

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 5/75 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           +R   +   G++GI VEVQ  + PG     +VGLPDK ++ESR+R+++   +AG     
Sbjct: 3  FARTYAVTLVGVEGIIVEVQADLEPGVASFALVGLPDKTLVESRDRVRAAVANAG----- 57

Query: 62 NELPSIYLQLIYQKK 76
           E P   L +     
Sbjct: 58 IEWPQRKLTIGLSPA 72


>gi|167463751|ref|ZP_02328840.1| Mg chelatase, subunit ChlI [Paenibacillus larvae subsp. larvae
          BRL-230010]
          Length = 333

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 5/62 (8%)

Query: 17 PVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSIYLQLIYQKK 76
           +EV+V +S G   +Q+VGLPD ++ ES +R+++   +    F     P   + +     
Sbjct: 1  MIEVEVDLSNGLPMMQLVGLPDSSIRESADRVRAALKNCSFTF-----PLERITINLAPA 55

Query: 77 DL 78
          DL
Sbjct: 56 DL 57


>gi|149918761|ref|ZP_01907248.1| Mg(2+) chelatase family protein [Plesiocystis pacifica SIR-1]
 gi|149820362|gb|EDM79778.1| Mg(2+) chelatase family protein [Plesiocystis pacifica SIR-1]
          Length = 519

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 18/77 (23%), Positives = 35/77 (45%), Gaps = 5/77 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+SR  +    G++G  + ++  V  G   + +VG    A+ E+RER++S   H G    
Sbjct: 1  MLSRTYSAGILGVEGYVITIEADVGLGLPCLTLVGQVSGALHEARERVRSALSHCG---- 56

Query: 61 VNELPSIYLQLIYQKKD 77
           + +P     +     +
Sbjct: 57 -HAIPPRKQIVNLAPAE 72


>gi|228473679|ref|ZP_04058429.1| Mg chelatase family protein [Capnocytophaga gingivalis ATCC
          33624]
 gi|228274893|gb|EEK13708.1| Mg chelatase family protein [Capnocytophaga gingivalis ATCC
          33624]
          Length = 513

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +I   A  G++ I + ++V +  G  G  +VGLPD A+ ES  RI++   +      
Sbjct: 1  MLVKIYGSAVYGVEAITITIEVNIDKGV-GYHLVGLPDNAIKESNYRIEAALHNNQYK-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     D+
Sbjct: 58 ---IPGKKITINMAPADM 72


>gi|291060225|gb|ADD72960.1| putative Mg chelatase-like protein [Treponema pallidum subsp.
          pallidum str. Chicago]
          Length = 646

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 5/75 (6%)

Query: 4  RISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNE 63
          +I + +  G +G  ++V+V +  G   V IVGLP  AV E++ERI++   +A L F    
Sbjct: 2  QIMSFSAFGYEGEVIKVEVDLRRGLPVVDIVGLPGSAVKEAKERIRAAIRNAALPF---- 57

Query: 64 LPSIYLQLIYQKKDL 78
           P   + +     DL
Sbjct: 58 -PQERILINLSPADL 71


>gi|166031220|ref|ZP_02234049.1| hypothetical protein DORFOR_00907 [Dorea formicigenerans ATCC
          27755]
 gi|166029067|gb|EDR47824.1| hypothetical protein DORFOR_00907 [Dorea formicigenerans ATCC
          27755]
          Length = 517

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 16/75 (21%), Positives = 30/75 (40%), Gaps = 5/75 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           S I++   QG+    +  +  VS G     +VG     V E+ ER+++   ++G     
Sbjct: 3  FSSIASACVQGLHIEVIHAESDVSNGLPMFHMVGYLSSEVKEAAERVRTAIRNSGF---- 58

Query: 62 NELPSIYLQLIYQKK 76
            LP   + +     
Sbjct: 59 -SLPPKKIVVNLSPA 72


>gi|237752135|ref|ZP_04582615.1| DNA transformation competence protein [Helicobacter winghamensis
          ATCC BAA-430]
 gi|229376377|gb|EEO26468.1| DNA transformation competence protein [Helicobacter winghamensis
          ATCC BAA-430]
          Length = 513

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 32/75 (42%), Gaps = 5/75 (6%)

Query: 4  RISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNE 63
           +   A  GI    VEV+V  +       I GL   A+ ESR+R+QS  +  G  F    
Sbjct: 3  TLFCAAQVGIGAQEVEVEVSFTRALPSFSITGLAGNAIQESRQRVQSSLLANGFKF---- 58

Query: 64 LPSIYLQLIYQKKDL 78
           P + + +     DL
Sbjct: 59 -PPLKITVNLSPSDL 72


>gi|306823246|ref|ZP_07456622.1| Mg chelatase-like protein [Bifidobacterium dentium ATCC 27679]
 gi|304553878|gb|EFM41789.1| Mg chelatase-like protein [Bifidobacterium dentium ATCC 27679]
          Length = 508

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I    ++   G+K   +++Q  +SPG     I+GLPD ++ E+RER++S    +G     
Sbjct: 3  IGSALSVGLIGLKAFIIQIQAFISPGLPYFSIIGLPDTSLSEARERVKSACQASGFK--- 59

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +      +
Sbjct: 60 --WPETRVTVNLSPASM 74


>gi|256824960|ref|YP_003148920.1| Mg chelatase-related protein [Kytococcus sedentarius DSM 20547]
 gi|256688353|gb|ACV06155.1| Mg chelatase-related protein [Kytococcus sedentarius DSM 20547]
          Length = 511

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R   +   GI G  V+V+  V  G     + GLPD A  ++ +RI++   +AGL    
Sbjct: 3  LGRTWAVGLVGITGRMVQVEADVGAGLPTFTVGGLPDAACAQAPDRIRAATANAGL---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
           +LPS  + +     DL
Sbjct: 59 -QLPSRKVVVNLSPADL 74


>gi|158313009|ref|YP_001505517.1| Mg chelatase, subunit ChlI [Frankia sp. EAN1pec]
 gi|158108414|gb|ABW10611.1| Mg chelatase, subunit ChlI [Frankia sp. EAN1pec]
          Length = 530

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++R   +A  GI+G  VEV+  ++ G  G+ ++GLPD A+ E+R+R+++  +++      
Sbjct: 3  LARSLAVAVVGIEGHLVEVEADLARGLPGLTLIGLPDAALHEARDRVRAAVVNS-----R 57

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +      L
Sbjct: 58 ERWPGHRITVGLFPATL 74


>gi|169333873|ref|ZP_02861066.1| hypothetical protein ANASTE_00259 [Anaerofustis stercorihominis
          DSM 17244]
 gi|169259438|gb|EDS73404.1| hypothetical protein ANASTE_00259 [Anaerofustis stercorihominis
          DSM 17244]
          Length = 523

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 37/77 (48%), Gaps = 6/77 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMV-SPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M S++ + +  GI GI V V++ + +     + +VGL D AV ES+ER+ S   +     
Sbjct: 16 MFSKLFSGSIVGIDGIIVSVEIDILNKALPSISVVGLGDIAVKESKERVFSAIKNNSF-- 73

Query: 60 LVNELPSIYLQLIYQKK 76
             ++P   + +     
Sbjct: 74 ---QIPMGKITVNLAPA 87


>gi|23465509|ref|NP_696112.1| hypothetical protein BL0936 [Bifidobacterium longum NCC2705]
 gi|46190457|ref|ZP_00206471.1| COG0606: Predicted ATPase with chaperone activity
          [Bifidobacterium longum DJO10A]
 gi|189439540|ref|YP_001954621.1| putative ATP-dependent serine protease [Bifidobacterium longum
          DJO10A]
 gi|227545994|ref|ZP_03976043.1| possible ATPase [Bifidobacterium longum subsp. infantis ATCC
          55813]
 gi|239621950|ref|ZP_04664981.1| mg chelatase [Bifidobacterium longum subsp. infantis CCUG 52486]
 gi|312132949|ref|YP_004000288.1| sms1 [Bifidobacterium longum subsp. longum BBMN68]
 gi|317482279|ref|ZP_07941300.1| magnesium chelatase [Bifidobacterium sp. 12_1_47BFAA]
 gi|322688899|ref|YP_004208633.1| hypothetical protein BLIF_0712 [Bifidobacterium longum subsp.
          infantis 157F]
 gi|322690874|ref|YP_004220444.1| hypothetical protein BLLJ_0684 [Bifidobacterium longum subsp.
          longum JCM 1217]
 gi|23326168|gb|AAN24748.1| conserved hypothetical protein in chelatase subunits D/I family
          [Bifidobacterium longum NCC2705]
 gi|189427975|gb|ACD98123.1| Putative ATP-dependent serine protease [Bifidobacterium longum
          DJO10A]
 gi|227213628|gb|EEI81477.1| possible ATPase [Bifidobacterium longum subsp. infantis ATCC
          55813]
 gi|239515141|gb|EEQ55008.1| mg chelatase [Bifidobacterium longum subsp. infantis CCUG 52486]
 gi|291517056|emb|CBK70672.1| Mg chelatase-related protein [Bifidobacterium longum subsp.
          longum F8]
 gi|311773930|gb|ADQ03418.1| SmS1 [Bifidobacterium longum subsp. longum BBMN68]
 gi|316916295|gb|EFV37696.1| magnesium chelatase [Bifidobacterium sp. 12_1_47BFAA]
 gi|320455730|dbj|BAJ66352.1| conserved hypothetical protein [Bifidobacterium longum subsp.
          longum JCM 1217]
 gi|320460235|dbj|BAJ70855.1| conserved hypothetical protein [Bifidobacterium longum subsp.
          infantis 157F]
          Length = 511

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 5/75 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I    ++   G+K   V+VQ  +SPG     I+GLPD ++ E+RER++S     G     
Sbjct: 3  IGSTLSVGLIGLKAFIVQVQAFISPGLPYFSIIGLPDASLSEARERVKSACQATGFG--- 59

Query: 62 NELPSIYLQLIYQKK 76
             P   + +     
Sbjct: 60 --WPQTRVTVNMSPA 72


>gi|255534198|ref|YP_003094569.1| MG(2+) chelatase family protein / ComM-related protein
          [Flavobacteriaceae bacterium 3519-10]
 gi|255340394|gb|ACU06507.1| MG(2+) chelatase family protein / ComM-related protein
          [Flavobacteriaceae bacterium 3519-10]
          Length = 511

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +I   A  G+    + ++V V    VG  +VGL D A+ ES  RI +   + G    
Sbjct: 1  MLVKIYGSAIFGVSAQTITIEVNVDTSGVGYHLVGLADNAIKESSYRISAALKNVGFK-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     DL
Sbjct: 59 ---IPGKKITINMAPADL 73


>gi|256832226|ref|YP_003160953.1| magnesium chelatase ChlI subunit [Jonesia denitrificans DSM
          20603]
 gi|256685757|gb|ACV08650.1| magnesium chelatase ChlI subunit [Jonesia denitrificans DSM
          20603]
          Length = 340

 Score = 89.3 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 35/77 (45%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +     ++  G+ G  V V+  ++    G  IVGLPD ++ E++ER+++     GL    
Sbjct: 3  LGHAQAMSLLGLDGHHVVVEAHLANALPGFTIVGLPDASLTEAKERVRAAIASCGLT--- 59

Query: 62 NELPSIYLQLIYQKKDL 78
            LP   + +      L
Sbjct: 60 --LPPRKIVVNLAPASL 74


>gi|255526681|ref|ZP_05393585.1| Mg chelatase, subunit ChlI [Clostridium carboxidivorans P7]
 gi|296185601|ref|ZP_06854010.1| Mg chelatase-like protein [Clostridium carboxidivorans P7]
 gi|255509613|gb|EET85949.1| Mg chelatase, subunit ChlI [Clostridium carboxidivorans P7]
 gi|296049729|gb|EFG89154.1| Mg chelatase-like protein [Clostridium carboxidivorans P7]
          Length = 512

 Score = 89.3 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M S I++ A  GI    V+++     G+  V IVGL D A+ E+RER+++  +H+     
Sbjct: 1  MASIINSFAISGIDAYMVKIETDTIYGQPSVSIVGLGDTAIKEARERLEAAIVHS----- 55

Query: 61 VNELPSIYLQLIYQKKDL 78
            E P + + +     D+
Sbjct: 56 KYEFPKMKIVINLSPCDM 73


>gi|332290989|ref|YP_004429598.1| Mg chelatase, subunit ChlI [Krokinobacter diaphorus 4H-3-7-5]
 gi|332169075|gb|AEE18330.1| Mg chelatase, subunit ChlI [Krokinobacter diaphorus 4H-3-7-5]
          Length = 512

 Score = 89.3 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++   A  G+    + ++V V  G  G  +VGLPD A+ ES  RI +   + G    
Sbjct: 1  MLTKVYGSAVFGVDATTITIEVNVDKGV-GYHLVGLPDNAIKESSYRIAAALQNNGYK-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   L L     DL
Sbjct: 58 ---IPGKKLILNMSPADL 72


>gi|296453949|ref|YP_003661092.1| Mg chelatase subunit ChlI [Bifidobacterium longum subsp. longum
          JDM301]
 gi|296183380|gb|ADH00262.1| Mg chelatase, subunit ChlI [Bifidobacterium longum subsp. longum
          JDM301]
          Length = 511

 Score = 89.3 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 5/75 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I    ++   G+K   V+VQ  +SPG     I+GLPD ++ E+RER++S     G     
Sbjct: 3  IGSTLSVGLIGLKAFIVQVQAFISPGLPYFSIIGLPDASLSEARERVKSACQATGFG--- 59

Query: 62 NELPSIYLQLIYQKK 76
             P   + +     
Sbjct: 60 --WPQTRVTVNMSPA 72


>gi|254422783|ref|ZP_05036501.1| Mg chelatase family protein [Synechococcus sp. PCC 7335]
 gi|196190272|gb|EDX85236.1| Mg chelatase family protein [Synechococcus sp. PCC 7335]
          Length = 509

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++R+ + +  GI  + V V+V +S G  GV +VGLPD AV ESRER+++   +AG  F 
Sbjct: 1  MLARVWSASLIGIDALKVGVEVDLSGGLPGVVVVGLPDTAVQESRERVRAALKNAGFAF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 60 ----PMRKVVINLTPADV 73


>gi|197106941|ref|YP_002132318.1| comM protein [Phenylobacterium zucineum HLK1]
 gi|196480361|gb|ACG79889.1| comM protein [Phenylobacterium zucineum HLK1]
          Length = 512

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M + + T+AF+G++ + V+VQV  + G     +VG+ DKAV ESRER+++ F   GL   
Sbjct: 1  MSAGVVTLAFRGVEAVRVDVQVQFTGGEPKFFLVGMGDKAVSESRERVRAAFAGLGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP+  +       DL
Sbjct: 58 --ALPARRIIANLAPADL 73


>gi|213692567|ref|YP_002323153.1| Mg chelatase, subunit ChlI [Bifidobacterium longum subsp.
          infantis ATCC 15697]
 gi|213524028|gb|ACJ52775.1| Mg chelatase, subunit ChlI [Bifidobacterium longum subsp.
          infantis ATCC 15697]
 gi|320458719|dbj|BAJ69340.1| conserved hypothetical protein [Bifidobacterium longum subsp.
          infantis ATCC 15697]
          Length = 511

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 5/75 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I    ++   G+K   V+VQ  +SPG     I+GLPD ++ E+RER++S     G     
Sbjct: 3  IGSTLSVGLIGLKAFIVQVQAFISPGLPYFSIIGLPDASLSEARERVKSACQATGFG--- 59

Query: 62 NELPSIYLQLIYQKK 76
             P   + +     
Sbjct: 60 --WPQTRVTVNMSPA 72


>gi|154487076|ref|ZP_02028483.1| hypothetical protein BIFADO_00916 [Bifidobacterium adolescentis
          L2-32]
 gi|154084939|gb|EDN83984.1| hypothetical protein BIFADO_00916 [Bifidobacterium adolescentis
          L2-32]
          Length = 509

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I    ++   G+K   V++Q  VSPG     I+GLPD ++ E+RER++S    +G     
Sbjct: 3  IGSALSVGLIGLKAFIVQIQAFVSPGLPYFSIIGLPDTSLSEARERVKSACQASGFK--- 59

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +      +
Sbjct: 60 --WPETRVTVNLSPASM 74


>gi|86131838|ref|ZP_01050435.1| magnesium chelatase subunit ChlI [Dokdonia donghaensis MED134]
 gi|85817660|gb|EAQ38834.1| magnesium chelatase subunit ChlI [Dokdonia donghaensis MED134]
          Length = 512

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++   A  G+    + ++V V  G  G  +VGLPD A+ ES  RI +   + G    
Sbjct: 1  MLTKVYGSAVFGVDATTITIEVNVDKGV-GYHLVGLPDNAIKESSYRIAAALQNNGYK-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   L L     DL
Sbjct: 58 ---IPGKKLILNMSPADL 72


>gi|119025613|ref|YP_909458.1| hypothetical protein BAD_0595 [Bifidobacterium adolescentis ATCC
          15703]
 gi|118765197|dbj|BAF39376.1| hypothetical protein [Bifidobacterium adolescentis ATCC 15703]
          Length = 509

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I    ++   G+K   V++Q  VSPG     I+GLPD ++ E+RER++S    +G     
Sbjct: 3  IGSALSVGLIGLKAFIVQIQAFVSPGLPYFSIIGLPDTSLSEARERVKSACQASGFK--- 59

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +      +
Sbjct: 60 --WPETRVTVNLSPASM 74


>gi|253582083|ref|ZP_04859307.1| Mg(2+) chelatase [Fusobacterium varium ATCC 27725]
 gi|251836432|gb|EES64969.1| Mg(2+) chelatase [Fusobacterium varium ATCC 27725]
          Length = 499

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 16/76 (21%), Positives = 36/76 (47%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  R+ + ++ G++   VE ++ +S G     IVGL D A+ ES++R+++   ++     
Sbjct: 1  MNIRVLSSSYIGVEPFLVETEIDISSGLPFFSIVGLGDTAISESKDRVRTALKNSDYK-- 58

Query: 61 VNELPSIYLQLIYQKK 76
             +    + +     
Sbjct: 59 ---MEPKKIIVNLSPA 71


>gi|281355418|ref|ZP_06241912.1| Mg chelatase, subunit ChlI [Victivallis vadensis ATCC BAA-548]
 gi|281318298|gb|EFB02318.1| Mg chelatase, subunit ChlI [Victivallis vadensis ATCC BAA-548]
          Length = 513

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 27/85 (31%), Positives = 43/85 (50%), Gaps = 13/85 (15%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVG------VQIVGLPDKAVIESRERIQSHFIH 54
          M+++  + +  GI   PVE++V V+    G      V IVGLPD AV ESR+R++S  + 
Sbjct: 1  MLAKTFSASVIGIDAYPVEIEVNVTGSSSGGAADSVVSIVGLPDMAVKESRDRVKSAILS 60

Query: 55 AGLLFLVNELPSIYLQ-LIYQKKDL 78
          +G+      +P      +     DL
Sbjct: 61 SGM------IPPKGFTVVNLAPADL 79


>gi|284992380|ref|YP_003410934.1| Mg chelatase subunit ChlI [Geodermatophilus obscurus DSM 43160]
 gi|284065625|gb|ADB76563.1| Mg chelatase, subunit ChlI [Geodermatophilus obscurus DSM 43160]
          Length = 506

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++R  ++   G+ G  V+V+V +S G  GV +VGLPD  V +S +R+++  ++AG     
Sbjct: 3  LARTWSVGLAGVHGALVDVEVDLSAGVPGVVLVGLPDAVVRQSVDRVRAAVVNAG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +      +
Sbjct: 58 GRWPLRRITIGLSPASM 74


>gi|269219631|ref|ZP_06163485.1| Mg chelatase-like protein [Actinomyces sp. oral taxon 848 str.
          F0332]
 gi|269210873|gb|EEZ77213.1| Mg chelatase-like protein [Actinomyces sp. oral taxon 848 str.
          F0332]
          Length = 500

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 39/70 (55%), Gaps = 5/70 (7%)

Query: 8  IAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSI 67
          +A  GI+G PV ++ ++  G   V IVGLPD AV ESRERI++ F  AG+ F     P  
Sbjct: 1  MAVVGIEGRPVRIEAVLLHGLPAVTIVGLPDAAVSESRERIRAAFASAGIGF-----PQA 55

Query: 68 YLQLIYQKKD 77
           L +     D
Sbjct: 56 RLTINLSPAD 65


>gi|124006829|ref|ZP_01691659.1| putative Mg chelatase-like protein [Microscilla marina ATCC
          23134]
 gi|123987510|gb|EAY27219.1| putative Mg chelatase-like protein [Microscilla marina ATCC
          23134]
          Length = 512

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 38/78 (48%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+++    A  G+    + ++V VS G     +VGLPD AV ES++RI++   + G    
Sbjct: 1  MLAKTYGSAVYGVNAYLITIEVNVSKGTKYF-MVGLPDNAVKESQQRIEAAIKYLGYK-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     D+
Sbjct: 58 ---MPRQKIVINMAPADI 72


>gi|240170584|ref|ZP_04749243.1| hypothetical protein MkanA1_14820 [Mycobacterium kansasii ATCC
          12478]
          Length = 503

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  ++A   + G  VE++  ++ G  GV +VGLPD A+ ESR R+++   +       
Sbjct: 3  LGRAFSVAVCALDGQIVEIEADITSGLPGVHLVGLPDAALQESRNRVRAAVTNC-----S 57

Query: 62 NELPSIYLQLIYQKKDL 78
          N  P   L L      L
Sbjct: 58 NSWPQARLTLALSPATL 74


>gi|325110475|ref|YP_004271543.1| Mg chelatase, subunit ChlI [Planctomyces brasiliensis DSM 5305]
 gi|324970743|gb|ADY61521.1| Mg chelatase, subunit ChlI [Planctomyces brasiliensis DSM 5305]
          Length = 509

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 6/79 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPG-RVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M++R+ +    GI   PVEV+V +SPG      +VGL + AV E   RI+   +++G + 
Sbjct: 1  MLARLLSYTLYGIDARPVEVEVDISPGALPKTILVGLAEAAVRECTHRIERAIVNSGYVR 60

Query: 60 LVNELPSIYLQLIYQKKDL 78
           V       + +     DL
Sbjct: 61 CV-----DRIVINLSPADL 74


>gi|315657110|ref|ZP_07909994.1| Mg-chelatase D/I family [Mobiluncus curtisii subsp. holmesii ATCC
          35242]
 gi|315492213|gb|EFU81820.1| Mg-chelatase D/I family [Mobiluncus curtisii subsp. holmesii ATCC
          35242]
          Length = 521

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 34/73 (46%), Gaps = 5/73 (6%)

Query: 6  STIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELP 65
           +I   G++  PV V+  +S G     +VGLPD AV E+++R+++          + E P
Sbjct: 7  WSICLVGMQARPVRVEAHISDGMTAYSLVGLPDTAVREAKDRVRAAVTSC-----LYEWP 61

Query: 66 SIYLQLIYQKKDL 78
             + L      L
Sbjct: 62 GTRIVLNLSPASL 74


>gi|311745802|ref|ZP_07719587.1| Mg chelatase-like protein [Algoriphagus sp. PR1]
 gi|126576003|gb|EAZ80281.1| Mg chelatase-like protein [Algoriphagus sp. PR1]
          Length = 512

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+++    A  G+    + ++V V  G     +VGLPD AV ES++R++S        F 
Sbjct: 1  MVAKTFGSAVSGVDANIITIEVNVGQGT-SFYMVGLPDSAVKESQQRVESALK-----FF 54

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     D+
Sbjct: 55 GYRMPRQKVVINLAPADI 72


>gi|304389805|ref|ZP_07371764.1| Mg chelatase-like protein [Mobiluncus curtisii subsp. curtisii
          ATCC 35241]
 gi|304326981|gb|EFL94220.1| Mg chelatase-like protein [Mobiluncus curtisii subsp. curtisii
          ATCC 35241]
          Length = 521

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 34/73 (46%), Gaps = 5/73 (6%)

Query: 6  STIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELP 65
           +I   G++  PV V+  +S G     +VGLPD AV E+++R+++          + E P
Sbjct: 7  WSICLVGMQARPVRVEAHISDGMTAYSLVGLPDTAVREAKDRVRAAVTSC-----LYEWP 61

Query: 66 SIYLQLIYQKKDL 78
             + L      L
Sbjct: 62 GTRIVLNLSPASL 74


>gi|119952888|ref|YP_945097.1| magnesium chelatase subunit ChlI-related ATPase [Borrelia
          turicatae 91E135]
 gi|119861659|gb|AAX17427.1| magnesium chelatase subunit ChlI-related ATPase [Borrelia
          turicatae 91E135]
          Length = 509

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 5/73 (6%)

Query: 4  RISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNE 63
          +I + +  G +G  +E++V +  G  G+ IVGL    + ESRER++S   ++   F    
Sbjct: 2  KIYSHSSIGYEGELIEIEVDIRKGISGIDIVGLAGSEIKESRERVKSAIKNSEFTF---- 57

Query: 64 LPSIYLQLIYQKK 76
           P   + +     
Sbjct: 58 -PKDRILINLAPA 69


>gi|256846507|ref|ZP_05551964.1| Mg(2+) chelatase [Fusobacterium sp. 3_1_36A2]
 gi|256718276|gb|EEU31832.1| Mg(2+) chelatase [Fusobacterium sp. 3_1_36A2]
          Length = 353

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  +I T ++ G++   VEV+V +S G     IVG+ D A++ES+ R+++   ++     
Sbjct: 1  MKKKIFTSSYLGLESYLVEVEVDISRGLPMFSIVGMGDTAILESKFRVKAALKNSNY--- 57

Query: 61 VNELPSIYLQLIYQKK 76
            E+    + +     
Sbjct: 58 --EITPQKIIVNLSPA 71


>gi|293115686|ref|ZP_05792631.2| Mg chelatase-like protein [Butyrivibrio crossotus DSM 2876]
 gi|292808804|gb|EFF68009.1| Mg chelatase-like protein [Butyrivibrio crossotus DSM 2876]
          Length = 510

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 36/78 (46%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          MI ++ + A  GI  +PVEVQ  V+PG    ++ G       E++ER++    ++     
Sbjct: 10 MIGKVYSAAVTGIYAVPVEVQADVAPGIPYFELTGNLAGTTKEAKERVRIAIKNSKF--- 66

Query: 61 VNELPSIYLQLIYQKKDL 78
            ++    + +     ++
Sbjct: 67 --QINPSKITINMIPANI 82


>gi|299142446|ref|ZP_07035578.1| Mg chelatase-like protein [Prevotella oris C735]
 gi|298576168|gb|EFI48042.1| Mg chelatase-like protein [Prevotella oris C735]
          Length = 513

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +    A  G++   V ++V ++PG     + GL DKAV E R+RI +  ++ G  F 
Sbjct: 1  MLVKTYCAAVNGLEVTTVTIEVSMNPGV-VYHLTGLGDKAVQEGRDRIAAALLYCGFKF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 59 ----PKADITVNMAPADL 72


>gi|116626878|ref|YP_829034.1| Mg chelatase subunit ChlI [Candidatus Solibacter usitatus
          Ellin6076]
 gi|116230040|gb|ABJ88749.1| Mg chelatase, subunit ChlI [Candidatus Solibacter usitatus
          Ellin6076]
          Length = 512

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 7/79 (8%)

Query: 2  ISRISTIAFQGIKGIPVEVQVM-VSPGRVGVQ-IVGLPDKAVIESRERIQSHFIHAGLLF 59
          + +  + A  GI    ++V+V   S G      +VG+PD AV ESRERI+S  I++G  +
Sbjct: 9  LFKTRSAAVYGIDAHLIDVEVDMFSSGNARDSVMVGMPDVAVRESRERIKSALINSGFGY 68

Query: 60 LVNELPSIYLQLIYQKKDL 78
               P+  + +     ++
Sbjct: 69 -----PNKQITINLAPANV 82


>gi|281426024|ref|ZP_06256937.1| Mg chelatase-like protein [Prevotella oris F0302]
 gi|281399917|gb|EFB30748.1| Mg chelatase-like protein [Prevotella oris F0302]
          Length = 513

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +    A  G++   V ++V ++PG     + GL DKAV E R+RI +  ++ G  F 
Sbjct: 1  MLVKTYCAAVNGLEVTTVTIEVSMNPGV-VYHLTGLGDKAVQEGRDRIAAALLYCGFKF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 59 ----PKADITVNMAPADL 72


>gi|302381629|ref|YP_003817452.1| Mg chelatase, subunit ChlI [Brevundimonas subvibrioides ATCC
          15264]
 gi|302192257|gb|ADK99828.1| Mg chelatase, subunit ChlI [Brevundimonas subvibrioides ATCC
          15264]
          Length = 529

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 44/80 (55%), Gaps = 7/80 (8%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSP--GRVGVQIVGLPDKAVIESRERIQSHFIHAGLL 58
          M++ I+T+AF+G++   V V+V +    G     IVGLPDKAV ESRER++  F   GL 
Sbjct: 1  MLASIATVAFEGVEARRVAVEVQLVGNEGPTIFSIVGLPDKAVAESRERVRGAFAGIGL- 59

Query: 59 FLVNELPSIYLQLIYQKKDL 78
               LP+  +       DL
Sbjct: 60 ----ALPAKRIIANLAPADL 75


>gi|167757714|ref|ZP_02429841.1| hypothetical protein CLOSCI_00044 [Clostridium scindens ATCC
          35704]
 gi|167664596|gb|EDS08726.1| hypothetical protein CLOSCI_00044 [Clostridium scindens ATCC
          35704]
          Length = 513

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 16/75 (21%), Positives = 32/75 (42%), Gaps = 5/75 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
             + + + QG+    V V+  VS G     +VG     V E+ ER+++   +AG     
Sbjct: 5  FHTVLSASIQGLHVEMVHVEADVSNGLPMFHMVGYLSAEVKEASERVRTAIRNAG----- 59

Query: 62 NELPSIYLQLIYQKK 76
           ++P+  + +     
Sbjct: 60 IQIPARKVVVNLAPA 74


>gi|332886254|gb|EGK06498.1| Mg chelatase [Dysgonomonas mossii DSM 22836]
          Length = 514

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +I   A QGI+   + ++V  S G     +VGLPD +V ES ERI S     G  F 
Sbjct: 1  MLVKIFGAAVQGIEATLITIEVNCSKGI-KFMLVGLPDASVKESHERIISALQVNGYKF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 59 ----PRQQVVINMSPADI 72


>gi|319950990|ref|ZP_08024860.1| magnesium chelatase [Dietzia cinnamea P4]
 gi|319435333|gb|EFV90583.1| magnesium chelatase [Dietzia cinnamea P4]
          Length = 505

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R   +   G+ G  VEV+  V  G  GV IVGLPD AV+++RERI++  I++GL    
Sbjct: 3  LGRTWAVTLHGVGGQMVEVEADVGRGLPGVSIVGLPDSAVLQARERIRAAVINSGL---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + L      L
Sbjct: 59 -SWPVGKVVLSLSPAGL 74


>gi|282856250|ref|ZP_06265533.1| putative Mg chelatase family protein [Pyramidobacter piscolens
          W5455]
 gi|282586009|gb|EFB91294.1| putative Mg chelatase family protein [Pyramidobacter piscolens
          W5455]
          Length = 501

 Score = 88.5 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M + I  I  +GI+ +PVEV+  ++ G     +VGLPD AV ESRER+++      +   
Sbjct: 1  MAAEIQGITLRGIEALPVEVEAEITSGMFSFSVVGLPDAAVRESRERVRAALRELDISIY 60

Query: 61 VNELPSIYLQLIYQKKDL 78
                  + +     DL
Sbjct: 61 G------RIAVNLAPADL 72


>gi|182414893|ref|YP_001819959.1| Mg chelatase, subunit ChlI [Opitutus terrae PB90-1]
 gi|177842107|gb|ACB76359.1| Mg chelatase, subunit ChlI [Opitutus terrae PB90-1]
          Length = 512

 Score = 88.5 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/79 (29%), Positives = 37/79 (46%), Gaps = 6/79 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVS-PGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M++ I++ A QG++   V V+V     G   + +VGLPD AV ES +R+ S   ++G   
Sbjct: 1  MLATIASAALQGVEAEMVHVEVNAGEAGEPKLILVGLPDAAVKESDDRVFSALSNSGFKP 60

Query: 60 LVNELPSIYLQLIYQKKDL 78
               P     +      L
Sbjct: 61 -----PRTRTTINLAPGHL 74


>gi|294507603|ref|YP_003571661.1| magnesium chelatase subunit ChlI [Salinibacter ruber M8]
 gi|294343931|emb|CBH24709.1| magnesium chelatase subunit ChlI [Salinibacter ruber M8]
          Length = 516

 Score = 88.5 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S++ +    G++ +PVE++  V+ G  G+ +VGLP  AV ES +R+++   +  +   
Sbjct: 1  MLSQVWSSTTHGVEALPVELETNVASGMRGLSVVGLPRAAVRESFDRVRAALENNDIP-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
            E     + +     D+
Sbjct: 59 -VEW--GRITINLAPADV 73


>gi|150009395|ref|YP_001304138.1| magnesium chelatase subunit ChlI [Parabacteroides distasonis ATCC
          8503]
 gi|255016250|ref|ZP_05288376.1| magnesium chelatase subunit ChlI [Bacteroides sp. 2_1_7]
 gi|149937819|gb|ABR44516.1| magnesium chelatase subunit ChlI [Parabacteroides distasonis ATCC
          8503]
          Length = 512

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 34/78 (43%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +    A QGI    V V+V  S G     +VGLPD AV ES ERI S     G  F 
Sbjct: 1  MLVKSYAAAVQGISATVVTVEVNCSKGI-QFFLVGLPDVAVRESHERIISALQVCGYKF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 59 ----PRNRIVINMAPADI 72


>gi|219558921|ref|ZP_03537997.1| hypothetical protein MtubT1_17082 [Mycobacterium tuberculosis
          T17]
          Length = 506

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 5/67 (7%)

Query: 12 GIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSIYLQL 71
          G+ G  VE++  ++ G  GV +VGLPD A+ ESR+R+++   + G     N  P   L L
Sbjct: 16 GLDGEIVEIEADITSGLPGVHLVGLPDAALQESRDRVRAAVTNCG-----NSWPMARLTL 70

Query: 72 IYQKKDL 78
                L
Sbjct: 71 ALSPATL 77


>gi|189459718|ref|ZP_03008503.1| hypothetical protein BACCOP_00346 [Bacteroides coprocola DSM
          17136]
 gi|189433565|gb|EDV02550.1| hypothetical protein BACCOP_00346 [Bacteroides coprocola DSM
          17136]
          Length = 512

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++   A QGI    V ++V  S G     +VGLPD AV ES ERI S     G  F 
Sbjct: 1  MLTKLFGAAVQGIDATIVTIEVNSSRGI-KFFLVGLPDSAVKESHERIMSALQVNGYKF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     D+
Sbjct: 59 ----PTCQIVVNMAPADI 72


>gi|171743301|ref|ZP_02919108.1| hypothetical protein BIFDEN_02430 [Bifidobacterium dentium ATCC
          27678]
 gi|283455726|ref|YP_003360290.1| ATPase-like magnesium chelatase subunit ChlI [Bifidobacterium
          dentium Bd1]
 gi|171278915|gb|EDT46576.1| hypothetical protein BIFDEN_02430 [Bifidobacterium dentium ATCC
          27678]
 gi|283102360|gb|ADB09466.1| ATPase-like magnesium chelatase subunit ChlI [Bifidobacterium
          dentium Bd1]
          Length = 508

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 18/77 (23%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I    ++   G+K   +++Q  +SPG     I+GLPD ++ E++ER++S    +G     
Sbjct: 3  IGSALSVGLIGLKAFIIQIQAFISPGLPYFSIIGLPDTSLSEAKERVKSACQASGFK--- 59

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +      +
Sbjct: 60 --WPETRVTVNLSPASM 74


>gi|301312305|ref|ZP_07218222.1| Mg chelatase-like protein [Bacteroides sp. 20_3]
 gi|300829727|gb|EFK60380.1| Mg chelatase-like protein [Bacteroides sp. 20_3]
          Length = 512

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 34/78 (43%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +    A QGI    V V+V  S G     +VGLPD AV ES ERI S     G  F 
Sbjct: 1  MLVKSYAAAVQGISATVVTVEVNCSKGI-QFFLVGLPDVAVRESHERIISALQVCGYKF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 59 ----PRNRIVINMAPADI 72


>gi|262384691|ref|ZP_06077824.1| Mg chelatase [Bacteroides sp. 2_1_33B]
 gi|262293672|gb|EEY81607.1| Mg chelatase [Bacteroides sp. 2_1_33B]
          Length = 512

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 34/78 (43%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +    A QGI    V V+V  S G     +VGLPD AV ES ERI S     G  F 
Sbjct: 1  MLVKSYAAAVQGISATVVTVEVNCSKGI-QFFLVGLPDVAVRESHERIISALQVCGYKF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 59 ----PRNRIVINMAPADI 72


>gi|163789065|ref|ZP_02183509.1| magnesium chelatase, subunit ChlI [Flavobacteriales bacterium
          ALC-1]
 gi|159875729|gb|EDP69789.1| magnesium chelatase, subunit ChlI [Flavobacteriales bacterium
          ALC-1]
          Length = 512

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ ++   A  G++   + V+V V  G  G  +VGLPD A+ ES  RI +   +      
Sbjct: 1  MLKKVFASAVFGVEASTITVEVNVDKGV-GYHLVGLPDNAIKESNYRIAAALQNNNYR-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     DL
Sbjct: 58 ---IPGKKITINMAPADL 72


>gi|86135027|ref|ZP_01053609.1| magnesium chelatase family protein [Polaribacter sp. MED152]
 gi|85821890|gb|EAQ43037.1| magnesium chelatase family protein [Polaribacter sp. MED152]
          Length = 281

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ ++   A  GI+   + V+V +  G  G  +VGLPDKAV ES  RI +   +      
Sbjct: 1  MLVKVFGSAVFGIEATTITVEVNIDKGI-GYHLVGLPDKAVSESSYRISAALDNNNFK-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     D+
Sbjct: 58 ---LPGKKIIINMAPADI 72


>gi|315637676|ref|ZP_07892881.1| magnesium chelatase [Arcobacter butzleri JV22]
 gi|315478023|gb|EFU68751.1| magnesium chelatase [Arcobacter butzleri JV22]
          Length = 506

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 33/74 (44%), Gaps = 5/74 (6%)

Query: 5  ISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNEL 64
          I + +   I  + ++V+   + G     IVG+   ++ ESR+R++S  +     F     
Sbjct: 9  IKSASMDTIDAVSIDVESTFTRGLPSFTIVGMISTSISESRDRVKSALLVNDFKF----- 63

Query: 65 PSIYLQLIYQKKDL 78
          P + + +     +L
Sbjct: 64 PPLKITINLSPTEL 77


>gi|256842401|ref|ZP_05547904.1| magnesium chelatase subunit ChlI [Parabacteroides sp. D13]
 gi|256736008|gb|EEU49339.1| magnesium chelatase subunit ChlI [Parabacteroides sp. D13]
          Length = 512

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 34/78 (43%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +    A QGI    V V+V  S G     +VGLPD AV ES ERI S     G  F 
Sbjct: 1  MLVKSYAAAVQGISATVVTVEVNCSKGI-QFFLVGLPDVAVRESHERIISALQVCGYKF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 59 ----PRNRIVINMAPADI 72


>gi|157737931|ref|YP_001490615.1| Mg chelatase-related protein [Arcobacter butzleri RM4018]
 gi|157699785|gb|ABV67945.1| Mg chelatase-related protein [Arcobacter butzleri RM4018]
          Length = 501

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 33/74 (44%), Gaps = 5/74 (6%)

Query: 5  ISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNEL 64
          I + +   I  + ++V+   + G     IVG+   ++ ESR+R++S  +     F     
Sbjct: 4  IKSASMDTIDAVSIDVESTFTRGLPSFTIVGMISTSISESRDRVKSALLVNDFKF----- 58

Query: 65 PSIYLQLIYQKKDL 78
          P + + +     +L
Sbjct: 59 PPLKITINLSPTEL 72


>gi|224025433|ref|ZP_03643799.1| hypothetical protein BACCOPRO_02173 [Bacteroides coprophilus DSM
          18228]
 gi|224018669|gb|EEF76667.1| hypothetical protein BACCOPRO_02173 [Bacteroides coprophilus DSM
          18228]
          Length = 512

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +    A QGI   PV ++V  S G     +VGLPD AV ES ERI S     G  F 
Sbjct: 1  MLVKTFGAAVQGIDATPVTIEVNSSRGI-RFFLVGLPDSAVRESHERIVSALQVNGYPF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  L +     D+
Sbjct: 59 ----PACQLVVNMAPADI 72


>gi|170781197|ref|YP_001709529.1| putative DNA uptake protein [Clavibacter michiganensis subsp.
          sepedonicus]
 gi|169155765|emb|CAQ00886.1| putative DNA uptake protein [Clavibacter michiganensis subsp.
          sepedonicus]
          Length = 518

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R   +A  G+ G  V+V+  ++    G  ++GLPD A+ ++RER+++   +AG     
Sbjct: 3  VGRTLAVALSGLDGALVDVEADITSQLPGFVLIGLPDAALSQARERVRAATGNAG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +      L
Sbjct: 58 CEFPVRRVTVNLSPAVL 74


>gi|83815095|ref|YP_445710.1| Mg chelatase-like protein [Salinibacter ruber DSM 13855]
 gi|83756489|gb|ABC44602.1| Mg chelatase-like protein [Salinibacter ruber DSM 13855]
          Length = 516

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+S++ +    G++ +PVE++  V+ G  G+ +VGLP  AV ES +R+++   +  +   
Sbjct: 1  MLSQVWSSTTHGVEALPVELETNVASGMRGLSVVGLPRAAVRESFDRVRAALENNDIP-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
            E     + +     D+
Sbjct: 59 -VEW--GRITINLAPADV 73


>gi|225011780|ref|ZP_03702218.1| magnesium chelatase ChlI subunit [Flavobacteria bacterium
          MS024-2A]
 gi|225004283|gb|EEG42255.1| magnesium chelatase ChlI subunit [Flavobacteria bacterium
          MS024-2A]
          Length = 264

 Score = 88.1 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 34/78 (43%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+  +      G++   + ++V +  G  G  +VGLPD A+ ES  RI +   + G    
Sbjct: 1  MLVSVFGSTVFGVEANLITIEVNIGQGI-GYHLVGLPDNALKESNFRIAAALTNIGYK-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   + +     D+
Sbjct: 58 ---LPGKKITINMAPADI 72


>gi|325105556|ref|YP_004275210.1| Mg chelatase, subunit ChlI [Pedobacter saltans DSM 12145]
 gi|324974404|gb|ADY53388.1| Mg chelatase, subunit ChlI [Pedobacter saltans DSM 12145]
          Length = 513

 Score = 88.1 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M  +I   A  G++   + ++V +S G+    IVGLPD AV ES  RI+S    +G    
Sbjct: 1  MPVKIFGSAVYGVEAQTITIEVNISSGKPNYFIVGLPDNAVKESMLRIESALSTSGYR-- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     D+
Sbjct: 59 ---MPRQKIVVNMAPADI 73


>gi|260655672|ref|ZP_05861145.1| Mg chelatase-like protein [Jonquetella anthropi E3_33 E1]
 gi|260629589|gb|EEX47783.1| Mg chelatase-like protein [Jonquetella anthropi E3_33 E1]
          Length = 502

 Score = 88.1 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M   +  +  +G++ + VEV+  ++ G     IVGLPD AV ESRER ++     GL   
Sbjct: 1  MAGDVLGVTLRGVQAVEVEVETEITSGLFSFSIVGLPDAAVRESRERTRAALRAIGLPLT 60

Query: 61 VNELPSIYLQLIYQKKDL 78
                  + +     DL
Sbjct: 61 G------KVAVNLAPADL 72


>gi|213425641|ref|ZP_03358391.1| putative ATP-dependent protease [Salmonella enterica subsp.
          enterica serovar Typhi str. E02-1180]
          Length = 62

 Score = 88.1 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 36/60 (60%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + T A  G+   P+ ++V +S G  G+ +VGLP+  V E R+R++S  I++G  F  
Sbjct: 3  LAIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEVRDRVRSAIINSGYEFPD 62


>gi|116671019|ref|YP_831952.1| Mg chelatase subunit ChlI [Arthrobacter sp. FB24]
 gi|116611128|gb|ABK03852.1| Mg chelatase, subunit ChlI [Arthrobacter sp. FB24]
          Length = 514

 Score = 88.1 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  ++A  G+ G  VEV+  +        I+GLPD ++ E++ERI+S   ++G+    
Sbjct: 3  LGRTYSVALVGLNGYIVEVEADIGQTLPAFVILGLPDASLNEAKERIRSAAQNSGIP--- 59

Query: 62 NELPSIYLQLIYQKKDL 78
            L    +        L
Sbjct: 60 --LSRRKITANLIPASL 74


>gi|325963704|ref|YP_004241610.1| Mg chelatase-related protein [Arthrobacter phenanthrenivorans
          Sphe3]
 gi|323469791|gb|ADX73476.1| Mg chelatase-related protein [Arthrobacter phenanthrenivorans
          Sphe3]
          Length = 514

 Score = 88.1 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R  +IA  G+ G  VEV+  +        ++GLPD ++ E++ERI+S   ++G+    
Sbjct: 3  LGRTYSIALVGLNGYLVEVEADIGQTLPAFVLLGLPDASLNEAKERIRSAAKNSGIP--- 59

Query: 62 NELPSIYLQLIYQKKDL 78
            L    +        L
Sbjct: 60 --LSRRKITANLIPASL 74


>gi|148272558|ref|YP_001222119.1| putative ATP-dependent serine protease [Clavibacter michiganensis
          subsp. michiganensis NCPPB 382]
 gi|147830488|emb|CAN01423.1| putative ATP-dependant serine protease [Clavibacter michiganensis
          subsp. michiganensis NCPPB 382]
          Length = 518

 Score = 88.1 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          + R   +A  G+ G  V+V+  ++    G  ++GLPD A+ ++RER+++   +AG     
Sbjct: 3  VGRTLAVALSGLDGALVDVEADITSQLPGFVLIGLPDAALSQARERVRAATGNAG----- 57

Query: 62 NELPSIYLQLIYQKKDL 78
           E P   + +      L
Sbjct: 58 CEFPVRRVTVNLSPAVL 74


>gi|78778227|ref|YP_394542.1| Mg chelatase-related protein [Sulfurimonas denitrificans DSM
          1251]
 gi|78498767|gb|ABB45307.1| Mg chelatase-related protein [Sulfurimonas denitrificans DSM
          1251]
          Length = 503

 Score = 88.1 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 15/78 (19%), Positives = 35/78 (44%), Gaps = 8/78 (10%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++      ++GI+   V V+  ++ G     +VG+   ++ E++ER++S  +     F 
Sbjct: 3  MVA---CATYEGIEAKVVYVESTLTKGLPSFSVVGMASASINEAKERVKSALLCNEFTF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     D+
Sbjct: 59 ----PPKRITINLAPSDV 72


>gi|302206442|gb|ADL10784.1| Uncharacterized protein yifB [Corynebacterium pseudotuberculosis
           C231]
 gi|302330998|gb|ADL21192.1| Putative ATPase with chaperone activity [Corynebacterium
           pseudotuberculosis 1002]
 gi|308276684|gb|ADO26583.1| Putative ATPase with chaperone activity [Corynebacterium
           pseudotuberculosis I19]
          Length = 645

 Score = 88.1 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 2   ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
           + R  + A  G+ G  V V+V + PG  G  +VGL D A+ ESR+R+++   ++GL    
Sbjct: 132 LVRTFSAAISGVTGYVVAVEVNIGPGLPGTYVVGLADAAIAESRDRMKTAAQNSGL---- 187

Query: 62  NELPSIYLQLIYQKKDL 78
              P   + +      L
Sbjct: 188 -AWPKTKVIVSLSPASL 203


>gi|270283870|ref|ZP_05965124.2| Mg chelatase-like protein [Bifidobacterium gallicum DSM 20093]
 gi|270277596|gb|EFA23450.1| Mg chelatase-like protein [Bifidobacterium gallicum DSM 20093]
          Length = 517

 Score = 88.1 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I    ++   G++   +++Q  VSPG     I+GLPD ++ E+RER++S    AG     
Sbjct: 11 IGSTLSVGLIGLQAFIIQIQAFVSPGLPFFSIIGLPDASLTEARERVRSACTAAGF---- 66

Query: 62 NELPSIYLQLIYQKKDL 78
           + P   + +      L
Sbjct: 67 -QWPQTRVTVNMSPASL 82


>gi|212213482|ref|YP_002304418.1| magnesium chelatase subunit-like ATPase [Coxiella burnetii
          CbuG_Q212]
 gi|212011892|gb|ACJ19273.1| magnesium chelatase subunit-like ATPase [Coxiella burnetii
          CbuG_Q212]
          Length = 75

 Score = 88.1 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 24/63 (38%), Positives = 36/63 (57%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ + +    GI   PV V+V +S G     IVGLP+ AV ESR R++S  I++ L F V
Sbjct: 3  LAIVHSRGSAGIDAPPVTVEVHISNGMPVFSIVGLPETAVKESRHRVRSAIINSQLEFPV 62

Query: 62 NEL 64
            +
Sbjct: 63 RRI 65


>gi|218962047|ref|YP_001741822.1| Mg chelatase-related protein [Candidatus Cloacamonas
          acidaminovorans]
 gi|167730704|emb|CAO81616.1| Mg chelatase-related protein [Candidatus Cloacamonas
          acidaminovorans]
          Length = 513

 Score = 88.1 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 35/78 (44%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+  + +    GI    + V+  +  G   + IVG+   AV ES++R+ +   ++G    
Sbjct: 1  MVGIVLSYTTLGIDAYQISVEADIGTGFNPMNIVGMASNAVKESKDRVIAAIKNSGY--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
            ++ + +  +     DL
Sbjct: 58 --QISTQHYTINLAPADL 73


>gi|225158849|ref|ZP_03725164.1| Mg chelatase, subunit ChlI [Opitutaceae bacterium TAV2]
 gi|224802541|gb|EEG20798.1| Mg chelatase, subunit ChlI [Opitutaceae bacterium TAV2]
          Length = 512

 Score = 87.7 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 37/79 (46%), Gaps = 6/79 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVS-PGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M+S + + A  GI+  PV ++V     G   + +VGLPD AV ES +R+ S   ++G   
Sbjct: 1  MLSTLLSAALNGIEAQPVHIEVNTGERGEWKIIMVGLPDSAVKESDDRVISALNNSGFTP 60

Query: 60 LVNELPSIYLQLIYQKKDL 78
               P     +     DL
Sbjct: 61 -----PRTRTTINLAPGDL 74


>gi|326798856|ref|YP_004316675.1| Mg chelatase, subunit ChlI [Sphingobacterium sp. 21]
 gi|326549620|gb|ADZ78005.1| Mg chelatase, subunit ChlI [Sphingobacterium sp. 21]
          Length = 512

 Score = 87.7 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +  + A  GIK   + ++V +S G     IVGLPD A+ ES  R++S    AGL   
Sbjct: 1  MLVKTFSSAVYGIKATTITIEVNISSGTQYF-IVGLPDSAIKESTFRVESALHSAGLR-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     D+
Sbjct: 58 ---MPRQKIVINMAPADI 72


>gi|218288276|ref|ZP_03492575.1| magnesium chelatase ChlI subunit [Alicyclobacillus acidocaldarius
          LAA1]
 gi|218241635|gb|EED08808.1| magnesium chelatase ChlI subunit [Alicyclobacillus acidocaldarius
          LAA1]
          Length = 486

 Score = 87.7 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 35/78 (44%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+         G     V VQ  V PG     IVGLPD +V E++ RI+S F HAGL F 
Sbjct: 1  MLGYAFGAIRHGADVQIVRVQADVGPGFPRFTIVGLPDSSVSEAKARIRSAFHHAGLPF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +  Q   L
Sbjct: 60 ----PKGRITVNLQPASL 73


>gi|257458237|ref|ZP_05623387.1| Mg chelatase homolog [Treponema vincentii ATCC 35580]
 gi|257444347|gb|EEV19440.1| Mg chelatase homolog [Treponema vincentii ATCC 35580]
          Length = 565

 Score = 87.7 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 5/74 (6%)

Query: 4  RISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNE 63
           I + A  G +G  ++V+  +  G   V IVGLP  AV E+RER+++   ++ L F    
Sbjct: 2  TIMSFASFGYEGEIIKVEADLRRGLPIVDIVGLPGSAVKEARERMRAAIGNSDLSF---- 57

Query: 64 LPSIYLQLIYQKKD 77
           P   + +     D
Sbjct: 58 -PQERILINLSPAD 70


>gi|225010844|ref|ZP_03701312.1| Mg chelatase, subunit ChlI [Flavobacteria bacterium MS024-3C]
 gi|225005052|gb|EEG43006.1| Mg chelatase, subunit ChlI [Flavobacteria bacterium MS024-3C]
          Length = 522

 Score = 87.7 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 38/78 (48%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M++++   A  GI  + + ++V ++ G  G  +VG+PD AV ES  RI +  ++ G    
Sbjct: 1  MLTKLYGSAVFGISAVTITIEVHIALGI-GYHLVGMPDNAVKESHYRIAAALLNNGYR-- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +      L
Sbjct: 58 ---IPGKKITINMAPAAL 72


>gi|325299544|ref|YP_004259461.1| Mg chelatase, subunit ChlI [Bacteroides salanitronis DSM 18170]
 gi|324319097|gb|ADY36988.1| Mg chelatase, subunit ChlI [Bacteroides salanitronis DSM 18170]
          Length = 512

 Score = 87.7 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ ++   A QGI    V ++V  S G     +VGLPD AV ES ERI +     G  F 
Sbjct: 1  MLIKLFGAAVQGIDATIVTIEVNSSRGI-KFFLVGLPDSAVKESHERIVAALQVNGYKF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P+  + +     D+
Sbjct: 59 ----PTCQIVINMAPADI 72


>gi|254440281|ref|ZP_05053775.1| Mg chelatase family protein [Octadecabacter antarcticus 307]
 gi|198255727|gb|EDY80041.1| Mg chelatase family protein [Octadecabacter antarcticus 307]
          Length = 491

 Score = 87.7 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 34/66 (51%), Gaps = 5/66 (7%)

Query: 13 IKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSIYLQLI 72
          +    VEVQ   SPG  G  IVGLPDKAV E+R+R+++         L   LPS  + + 
Sbjct: 1  MDARLVEVQCATSPGMPGFSIVGLPDKAVSEARDRVRASLSA-----LSIALPSKRITIN 55

Query: 73 YQKKDL 78
              DL
Sbjct: 56 LSPADL 61


>gi|167644151|ref|YP_001681814.1| Mg chelatase subunit ChlI [Caulobacter sp. K31]
 gi|167346581|gb|ABZ69316.1| Mg chelatase, subunit ChlI [Caulobacter sp. K31]
          Length = 516

 Score = 87.7 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M +++ T+AF+G++   V+V+V ++ G   + IVGL DKAV ES+ER++  F   GL   
Sbjct: 1  MAAKVVTVAFEGVEARRVDVEVQLTGGAQVMVIVGLGDKAVAESKERVRGAFAGLGL--- 57

Query: 61 VNELPSIYLQLIYQKKDL 78
             LP   +       D+
Sbjct: 58 --ALPPKRIVANLAPADM 73


>gi|32476089|ref|NP_869083.1| comM protein [Rhodopirellula baltica SH 1]
 gi|32446633|emb|CAD76469.1| comM protein [Rhodopirellula baltica SH 1]
          Length = 513

 Score = 87.7 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 42/79 (53%), Gaps = 6/79 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSP-GRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M++R+ T    GI+ +PV+V+V +SP       +VGLP+ AV ES  R++   +++G + 
Sbjct: 1  MLARLKTFTLLGIEAMPVDVEVDISPAAMPKTILVGLPEAAVKESTHRVERAIVNSGFIR 60

Query: 60 LVNELPSIYLQLIYQKKDL 78
               P   + +     DL
Sbjct: 61 -----PQDRVVINLAPGDL 74


>gi|257457721|ref|ZP_05622884.1| competence protein ComM [Treponema vincentii ATCC 35580]
 gi|257444889|gb|EEV19969.1| competence protein ComM [Treponema vincentii ATCC 35580]
          Length = 173

 Score = 87.7 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 5/74 (6%)

Query: 4  RISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNE 63
           I + A  G +G  ++V+  +  G   V IVGLP  AV E+RER+++   ++ L F    
Sbjct: 29 TIMSFASFGYEGEIIKVEADLRRGLPIVDIVGLPGSAVKEARERMRAAISNSDLPF---- 84

Query: 64 LPSIYLQLIYQKKD 77
           P   + +     D
Sbjct: 85 -PQERILINLSPAD 97


>gi|304383895|ref|ZP_07366352.1| Mg chelatase-like protein [Prevotella marshii DSM 16973]
 gi|304334973|gb|EFM01246.1| Mg chelatase-like protein [Prevotella marshii DSM 16973]
          Length = 515

 Score = 87.7 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +    A  G+    V ++V + PG     + GL D+AV ES+ RI++   + G  + 
Sbjct: 1  MLVKTFCAAVNGLHVTTVTIEVSIVPG-STFHMSGLGDEAVRESQSRIRAALQYTGFRY- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 59 ----PKANVTINMAPADL 72


>gi|296268975|ref|YP_003651607.1| Mg chelatase, subunit ChlI [Thermobispora bispora DSM 43833]
 gi|296091762|gb|ADG87714.1| Mg chelatase, subunit ChlI [Thermobispora bispora DSM 43833]
          Length = 518

 Score = 87.3 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++R   +A  G+ G  VEV+  V PG  G  ++GL D A+ E+R+R++S  I++ L    
Sbjct: 3  VARTRCVALVGVTGHMVEVEADVGPGIAGTHLIGLLDTAISEARDRVRSALINSRL---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +      L
Sbjct: 59 -AWPDARVTVSLFPASL 74


>gi|327539393|gb|EGF26009.1| magnesium chelatase, subunit ChlI [Rhodopirellula baltica WH47]
          Length = 513

 Score = 87.3 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 42/79 (53%), Gaps = 6/79 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSP-GRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          M++R+ T    GI+ +PV+V+V +SP       +VGLP+ AV ES  R++   +++G + 
Sbjct: 1  MLARLKTFTLLGIEAMPVDVEVDISPAAMPKTILVGLPEAAVKESTHRVERAIVNSGFIR 60

Query: 60 LVNELPSIYLQLIYQKKDL 78
               P   + +     DL
Sbjct: 61 -----PQDRVVINLAPGDL 74


>gi|294791552|ref|ZP_06756709.1| Mg chelatase-like protein [Scardovia inopinata F0304]
 gi|294458023|gb|EFG26377.1| Mg chelatase-like protein [Scardovia inopinata F0304]
          Length = 555

 Score = 87.3 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 32/75 (42%), Gaps = 5/75 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I    ++   G+K   ++VQ   S G     I+GLPD ++ E+R+R++S     G     
Sbjct: 3  IGTAFSVGLWGLKAYTIQVQAFTSSGLPFFSIIGLPDTSLAEARDRVKSACTICGFP--- 59

Query: 62 NELPSIYLQLIYQKK 76
             P   + +     
Sbjct: 60 --WPQTRVTVNLSPA 72


>gi|258511355|ref|YP_003184789.1| magnesium chelatase ChlI subunit [Alicyclobacillus acidocaldarius
          subsp. acidocaldarius DSM 446]
 gi|257478081|gb|ACV58400.1| magnesium chelatase ChlI subunit [Alicyclobacillus acidocaldarius
          subsp. acidocaldarius DSM 446]
          Length = 486

 Score = 87.3 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 35/78 (44%), Gaps = 5/78 (6%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+         G     V VQ  V PG     IVGLPD +V E++ RI+S F HAGL F 
Sbjct: 1  MLGYAFGAIRHGADVQIVRVQADVGPGFPRFTIVGLPDSSVSEAKARIRSAFHHAGLPF- 59

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +  Q   L
Sbjct: 60 ----PKGRITVNLQPASL 73


>gi|302338836|ref|YP_003804042.1| Mg chelatase, subunit ChlI [Spirochaeta smaragdinae DSM 11293]
 gi|301636021|gb|ADK81448.1| Mg chelatase, subunit ChlI [Spirochaeta smaragdinae DSM 11293]
          Length = 511

 Score = 87.3 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 5/72 (6%)

Query: 5  ISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNEL 64
          I   A  G +G  V V+V +  G  G+++VGLPD AV E+R+R+++   ++G  F     
Sbjct: 3  IFAYAGHGYEGSLVHVEVDLRRGIPGIEVVGLPDNAVREARQRVRAGIRNSGFTF----- 57

Query: 65 PSIYLQLIYQKK 76
          P   + +     
Sbjct: 58 PLDRILINLAPA 69


>gi|224283320|ref|ZP_03646642.1| hypothetical protein BbifN4_05775 [Bifidobacterium bifidum NCIMB
          41171]
 gi|313140472|ref|ZP_07802665.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB
          41171]
 gi|313132982|gb|EFR50599.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB
          41171]
          Length = 509

 Score = 87.3 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 18/72 (25%), Positives = 35/72 (48%), Gaps = 5/72 (6%)

Query: 7  TIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPS 66
          ++   G+K   +++Q  +SPG     ++GLPD ++ ESRER++S    +G        P 
Sbjct: 8  SVGLIGLKAFIIQIQAFISPGLPYFSVIGLPDASLSESRERVKSACQASGFK-----WPD 62

Query: 67 IYLQLIYQKKDL 78
            + +      +
Sbjct: 63 TRVTVNMSPASM 74


>gi|311064588|ref|YP_003971313.1| magnesium chelatase subunit ChlI-like protein [Bifidobacterium
          bifidum PRL2010]
 gi|310866907|gb|ADP36276.1| Magnesium chelatase subunit ChlI-like protein [Bifidobacterium
          bifidum PRL2010]
          Length = 509

 Score = 87.3 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 18/72 (25%), Positives = 35/72 (48%), Gaps = 5/72 (6%)

Query: 7  TIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPS 66
          ++   G+K   +++Q  +SPG     ++GLPD ++ ESRER++S    +G        P 
Sbjct: 8  SVGLIGLKAFIIQIQAFISPGLPYFSVIGLPDASLSESRERVKSACQASGFK-----WPD 62

Query: 67 IYLQLIYQKKDL 78
            + +      +
Sbjct: 63 TRVTVNMSPASM 74


>gi|224534908|ref|ZP_03675477.1| Mg chelatase homolog [Borrelia spielmanii A14S]
 gi|224513848|gb|EEF84173.1| Mg chelatase homolog [Borrelia spielmanii A14S]
          Length = 511

 Score = 87.3 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 35/73 (47%), Gaps = 5/73 (6%)

Query: 4  RISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNE 63
          +I + +  G +G  +E+++ +  G  G+ IVGL    + ESRER++S   ++   F    
Sbjct: 2  KIYSHSAIGYEGELIEIEIDIKKGISGIDIVGLAGSEIKESRERVKSAIKNSNFNF---- 57

Query: 64 LPSIYLQLIYQKK 76
           P   + +     
Sbjct: 58 -PKDRILINLAPA 69


>gi|225552056|ref|ZP_03772996.1| Mg chelatase homolog [Borrelia sp. SV1]
 gi|225371054|gb|EEH00484.1| Mg chelatase homolog [Borrelia sp. SV1]
          Length = 511

 Score = 87.3 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 35/73 (47%), Gaps = 5/73 (6%)

Query: 4  RISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNE 63
          ++ + +  G +G  +E+++ +  G  G+ IVGL    + ESRER++S   ++   F    
Sbjct: 2  KVYSHSSIGYEGELIEIEIDIKKGISGIDIVGLAGSEIKESRERVKSAIKNSNFHF---- 57

Query: 64 LPSIYLQLIYQKK 76
           P   + +     
Sbjct: 58 -PKNRILINLAPA 69


>gi|157363832|ref|YP_001470599.1| Mg chelatase, subunit ChlI [Thermotoga lettingae TMO]
 gi|157314436|gb|ABV33535.1| Mg chelatase, subunit ChlI [Thermotoga lettingae TMO]
          Length = 502

 Score = 87.3 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 7/80 (8%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPG--RVGVQIVGLPDKAVIESRERIQSHFIHAGLL 58
          M +++S++   G+   P+EV+V +        V IVGL D AV ES++R++S   ++G  
Sbjct: 1  MPAKLSSVTVVGLNVTPIEVEVDIDRKSIIHDVDIVGLGDTAVKESKKRVKSALRNSGFK 60

Query: 59 FLVNELPSIYLQLIYQKKDL 78
          F     P   + +     DL
Sbjct: 61 F-----PQGKVVVNLAPADL 75


>gi|317504512|ref|ZP_07962488.1| competence protein ComM [Prevotella salivae DSM 15606]
 gi|315664373|gb|EFV04064.1| competence protein ComM [Prevotella salivae DSM 15606]
          Length = 513

 Score = 87.3 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +    A  G++   V ++V ++PG     + GL DKAV E R+RI +  ++ G  F 
Sbjct: 1  MLVKTYCAAVNGLEVTTVTIEVSMNPGV-VYHLTGLGDKAVQEGRDRIAAALLYCGYKF- 58

Query: 61 VNELPSIYLQLIYQKKDL 78
              P   + +     DL
Sbjct: 59 ----PKADITVNMAPADL 72


>gi|310287690|ref|YP_003938948.1| Mg chelatase, ChlI subunit [Bifidobacterium bifidum S17]
 gi|309251626|gb|ADO53374.1| Mg chelatase, ChlI subunit [Bifidobacterium bifidum S17]
          Length = 510

 Score = 87.3 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 18/72 (25%), Positives = 35/72 (48%), Gaps = 5/72 (6%)

Query: 7  TIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPS 66
          ++   G+K   +++Q  +SPG     ++GLPD ++ ESRER++S    +G        P 
Sbjct: 9  SVGLIGLKAFIIQIQAFISPGLPYFSVIGLPDASLSESRERVKSACQASGFK-----WPD 63

Query: 67 IYLQLIYQKKDL 78
            + +      +
Sbjct: 64 TRVTVNMSPASM 75


>gi|312149220|gb|ADQ29291.1| putative Mg chelatase-like protein [Borrelia burgdorferi N40]
          Length = 511

 Score = 87.3 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 35/73 (47%), Gaps = 5/73 (6%)

Query: 4  RISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNE 63
          +I + +  G +G  +E+++ +  G  G+ IVGL    + ESRER++S   ++   F    
Sbjct: 2  KIYSHSSIGYEGELIEIEIDIKKGISGIDIVGLAGSEIKESRERVKSAIKNSNFHF---- 57

Query: 64 LPSIYLQLIYQKK 76
           P   + +     
Sbjct: 58 -PKNRILINLAPA 69


>gi|15594432|ref|NP_212220.1| hypothetical protein BB0086 [Borrelia burgdorferi B31]
 gi|195941824|ref|ZP_03087206.1| hypothetical protein Bbur8_02944 [Borrelia burgdorferi 80a]
 gi|216264791|ref|ZP_03436783.1| putative Mg chelatase homolog [Borrelia burgdorferi 156a]
 gi|218249338|ref|YP_002374615.1| putative Mg chelatase homolog [Borrelia burgdorferi ZS7]
 gi|221217486|ref|ZP_03588957.1| Mg chelatase homolog [Borrelia burgdorferi 72a]
 gi|223889135|ref|ZP_03623724.1| Mg chelatase homolog [Borrelia burgdorferi 64b]
 gi|224533082|ref|ZP_03673685.1| Mg chelatase homolog [Borrelia burgdorferi WI91-23]
 gi|224533919|ref|ZP_03674504.1| Mg chelatase homolog [Borrelia burgdorferi CA-11.2a]
 gi|225549271|ref|ZP_03770244.1| Mg chelatase homolog [Borrelia burgdorferi 94a]
 gi|225549738|ref|ZP_03770703.1| Mg chelatase homolog [Borrelia burgdorferi 118a]
 gi|226320722|ref|ZP_03796280.1| Mg chelatase homolog [Borrelia burgdorferi 29805]
 gi|226322003|ref|ZP_03797528.1| Mg chelatase homolog [Borrelia burgdorferi Bol26]
 gi|2687966|gb|AAC66471.1| conserved hypothetical protein [Borrelia burgdorferi B31]
 gi|215981264|gb|EEC22071.1| putative Mg chelatase homolog [Borrelia burgdorferi 156a]
 gi|218164526|gb|ACK74587.1| putative Mg chelatase homolog [Borrelia burgdorferi ZS7]
 gi|221192764|gb|EEE18980.1| Mg chelatase homolog [Borrelia burgdorferi 72a]
 gi|223885384|gb|EEF56485.1| Mg chelatase homolog [Borrelia burgdorferi 64b]
 gi|224511992|gb|EEF82390.1| Mg chelatase homolog [Borrelia burgdorferi WI91-23]
 gi|224512922|gb|EEF83288.1| Mg chelatase homolog [Borrelia burgdorferi CA-11.2a]
 gi|225369698|gb|EEG99146.1| Mg chelatase homolog [Borrelia burgdorferi 118a]
 gi|225370129|gb|EEG99569.1| Mg chelatase homolog [Borrelia burgdorferi 94a]
 gi|226232593|gb|EEH31347.1| Mg chelatase homolog [Borrelia burgdorferi Bol26]
 gi|226233938|gb|EEH32661.1| Mg chelatase homolog [Borrelia burgdorferi 29805]
 gi|312147887|gb|ADQ30546.1| putative Mg chelatase-like protein [Borrelia burgdorferi JD1]
          Length = 511

 Score = 87.3 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 35/73 (47%), Gaps = 5/73 (6%)

Query: 4  RISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNE 63
          +I + +  G +G  +E+++ +  G  G+ IVGL    + ESRER++S   ++   F    
Sbjct: 2  KIYSHSSIGYEGELIEIEIDIKKGISGIDIVGLAGSEIKESRERVKSAIKNSNFHF---- 57

Query: 64 LPSIYLQLIYQKK 76
           P   + +     
Sbjct: 58 -PKNRILINLAPA 69


>gi|294787612|ref|ZP_06752865.1| Mg chelatase-like protein [Parascardovia denticolens F0305]
 gi|315226785|ref|ZP_07868573.1| subunit D/I family magnesium chelatase [Parascardovia denticolens
          DSM 10105]
 gi|294484968|gb|EFG32603.1| Mg chelatase-like protein [Parascardovia denticolens F0305]
 gi|315120917|gb|EFT84049.1| subunit D/I family magnesium chelatase [Parascardovia denticolens
          DSM 10105]
          Length = 552

 Score = 87.3 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 32/77 (41%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          I     I   G+K   ++VQ   S G     I+GLPD ++ E+RER++S     G     
Sbjct: 3  IGTSYCIGLWGLKAYIIQVQAFTSNGLPYFSIIGLPDTSLGEARERVKSACTVTGF---- 58

Query: 62 NELPSIYLQLIYQKKDL 78
             P   + +      L
Sbjct: 59 -SWPQTRVTVNLSPASL 74


>gi|308234478|ref|ZP_07665215.1| Mg chelatase, subunit ChlI [Atopobium vaginae DSM 15829]
 gi|328944071|ref|ZP_08241536.1| ATPase [Atopobium vaginae DSM 15829]
 gi|327492040|gb|EGF23814.1| ATPase [Atopobium vaginae DSM 15829]
          Length = 521

 Score = 87.3 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 5/76 (6%)

Query: 3  SRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVN 62
            I T   +GI+ IPV+V+V  S G  G+ +VG PD +V+ESR R++      G+     
Sbjct: 5  VTIHTAMLRGIEAIPVKVEVSTSSGIPGITLVGNPDISVLESRSRVRCALKSIGVN---- 60

Query: 63 ELPSIYLQLIYQKKDL 78
           LP  ++ +     ++
Sbjct: 61 -LPRKHITINLSPGEI 75


>gi|224419233|ref|ZP_03657239.1| sigma-54 interacting protein [Helicobacter canadensis MIT
          98-5491]
 gi|253826951|ref|ZP_04869836.1| putative ATPase [Helicobacter canadensis MIT 98-5491]
 gi|313142735|ref|ZP_07804928.1| DNA transformation competence protein [Helicobacter canadensis
          MIT 98-5491]
 gi|253510357|gb|EES89016.1| putative ATPase [Helicobacter canadensis MIT 98-5491]
 gi|313131766|gb|EFR49383.1| DNA transformation competence protein [Helicobacter canadensis
          MIT 98-5491]
          Length = 505

 Score = 87.3 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 5/74 (6%)

Query: 5  ISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNEL 64
          +   A +G++   VEV+V  +      QI GL   A+ ESR+R+QS  +     F     
Sbjct: 6  LYCAAQEGLEAKKVEVEVSFTKALPSFQITGLAGNAIQESRQRVQSSLLSNDFKF----- 60

Query: 65 PSIYLQLIYQKKDL 78
          P + + +     DL
Sbjct: 61 PPLKISVNLSPSDL 74


>gi|149280109|ref|ZP_01886233.1| magnesium chelatase, subunit ChlI [Pedobacter sp. BAL39]
 gi|149229123|gb|EDM34518.1| magnesium chelatase, subunit ChlI [Pedobacter sp. BAL39]
          Length = 393

 Score = 87.3 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 6/78 (7%)

Query: 1  MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60
          M+ +    A  G+    + ++V +  G     IVGLPD A+ ES +R++S     GL   
Sbjct: 28 MLVKTYGSAVFGVNAQTITIEVSIGGGN-KYHIVGLPDNAIKESLKRVESAIQSCGLK-- 84

Query: 61 VNELPSIYLQLIYQKKDL 78
             +P   + +     D+
Sbjct: 85 ---MPRQKIVINLAPADI 99


>gi|315453777|ref|YP_004074047.1| putative Mg-chetalase related protein [Helicobacter felis ATCC
          49179]
 gi|315132829|emb|CBY83457.1| Putative Mg-chetalase related protein [Helicobacter felis ATCC
          49179]
          Length = 507

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 18/77 (23%), Positives = 32/77 (41%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          ++ +      G     VEV+   +       I GLP+ A+ ES++R+Q    + G  F  
Sbjct: 7  VNTLYCATMHGAHAKIVEVEGSFTRALPAFVIAGLPNNAIQESKQRVQGALQNNGFAF-- 64

Query: 62 NELPSIYLQLIYQKKDL 78
             P + + +     DL
Sbjct: 65 ---PPLKITINLSPSDL 78


>gi|269795659|ref|YP_003315114.1| Mg chelatase-like protein [Sanguibacter keddieii DSM 10542]
 gi|269097844|gb|ACZ22280.1| Mg chelatase-related protein [Sanguibacter keddieii DSM 10542]
          Length = 512

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61
          +     +   G+ G  VEV+  ++    G  +VGLPD A+ ESR+R+++     GL+   
Sbjct: 3  LGTTLAVCLVGLTGHLVEVEAHLAASVPGFTLVGLPDTALAESRDRVRAAVASTGLV--- 59

Query: 62 NELPSIYLQLIYQKKDL 78
            LP   + +      L
Sbjct: 60 --LPQRKVTVNLSPAAL 74


>gi|227875949|ref|ZP_03994072.1| ATPase [Mobiluncus mulieris ATCC 35243]
 gi|269977904|ref|ZP_06184858.1| putative Mg chelatase-like protein [Mobiluncus mulieris 28-1]
 gi|227843481|gb|EEJ53667.1| ATPase [Mobiluncus mulieris ATCC 35243]
 gi|269933870|gb|EEZ90450.1| putative Mg chelatase-like protein [Mobiluncus mulieris 28-1]
          Length = 520

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 18/74 (24%), Positives = 32/74 (43%), Gaps = 5/74 (6%)

Query: 5  ISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNEL 64
            ++    ++   V V+  +S G     +VGLPD AV E+R+R+++            E 
Sbjct: 6  TWSVGLVAMEATLVRVEAHISEGISAYTLVGLPDTAVREARDRVRAAVSSC-----FIEW 60

Query: 65 PSIYLQLIYQKKDL 78
          P + + L      L
Sbjct: 61 PDVRVVLNLSPASL 74


>gi|229817792|ref|ZP_04448074.1| hypothetical protein BIFANG_03064 [Bifidobacterium angulatum DSM
          20098]
 gi|229785581|gb|EEP21695.1| hypothetical protein BIFANG_03064 [Bifidobacterium angulatum DSM
          20098]
          Length = 512

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 5/72 (6%)

Query: 7  TIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERI