RPSBLAST alignment for GI: 254781028 and conserved domain: PRK09862

>gnl|CDD|182120 PRK09862, PRK09862, putative ATP-dependent protease; Provisional. Length = 506
 Score = 45.4 bits (107), Expect = 4e-06
 Identities = 21/58 (36%), Positives = 37/58 (63%)

Query: 2  ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59
          +S + T A  G+   P+ V+V +S G  G+ +VGLP+  V E+R+R++S  I++G  +
Sbjct: 3  LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGYEY 60