RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781028|ref|YP_003065441.1| putative Mg2+ chelatase family protein [Candidatus Liberibacter asiaticus str. psy62] (87 letters) >gnl|CDD|30951 COG0606, COG0606, Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]. Length = 490 Score = 54.1 bits (130), Expect = 8e-09 Identities = 25/58 (43%), Positives = 34/58 (58%), Gaps = 5/58 (8%) Query: 15 GIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF-----LVNELPSI 67 PVEV+V +S G G IVGLPD AV ESRER+++ ++G F +N P+ Sbjct: 2 APPVEVEVDISNGLPGFTIVGLPDTAVKESRERVRAALTNSGFEFPAKRITINLAPAD 59 >gnl|CDD|100020 cd02191, FtsZ, FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes. FtsZ is capable of polymerizing in a GTP-driven process into structures similar to those formed by tubulin. FtsZ forms a ring-shaped septum at the site of bacterial cell division, which is required for constriction of cell membrane and cell envelope to yield two daughter cells.. Length = 303 Score = 25.6 bits (56), Expect = 3.0 Identities = 13/55 (23%), Positives = 25/55 (45%), Gaps = 4/55 (7%) Query: 11 QGIKGIPVEVQVMVSPGRVGVQIVG----LPDKAVIESRERIQSHFIHAGLLFLV 61 Q + G+ E +V++ R G L +A E +E I + +H ++F+ Sbjct: 37 QDLLGLEAENRVLIGQARTKGLGAGANPELGAEAAEEVQEAIDNIPVHVDMVFIT 91 >gnl|CDD|32733 COG2909, MalT, ATP-dependent transcriptional regulator [Transcription]. Length = 894 Score = 24.5 bits (53), Expect = 7.4 Identities = 9/32 (28%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Query: 41 VIESRERIQSHFIHAGLLFLVNELPSIYLQLI 72 V++ I +H L FL+ P L L+ Sbjct: 134 VLDDYHLISDPALHEALRFLLKHAPE-NLTLV 164 >gnl|CDD|177042 CHL00119, atpD, ATP synthase CF1 delta subunit; Validated. Length = 184 Score = 24.2 bits (53), Expect = 7.9 Identities = 10/36 (27%), Positives = 19/36 (52%), Gaps = 8/36 (22%) Query: 57 LLFLVNE-----LPSI---YLQLIYQKKDLIMIYLS 84 L+ LV+ L +I YL+L+Y+ + + +S Sbjct: 80 LMVLVDRGRIALLDAIIEKYLELVYKLASIKIAEVS 115 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.328 0.145 0.407 Gapped Lambda K H 0.267 0.0790 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,031,075 Number of extensions: 47407 Number of successful extensions: 131 Number of sequences better than 10.0: 1 Number of HSP's gapped: 131 Number of HSP's successfully gapped: 10 Length of query: 87 Length of database: 6,263,737 Length adjustment: 56 Effective length of query: 31 Effective length of database: 5,053,633 Effective search space: 156662623 Effective search space used: 156662623 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (23.3 bits)