RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781028|ref|YP_003065441.1| putative Mg2+ chelatase family protein [Candidatus Liberibacter asiaticus str. psy62] (87 letters) >gnl|CDD|129465 TIGR00368, TIGR00368, Mg chelatase-related protein. The N-terminal end matches very strongly a pfam Mg_chelatase domain. Length = 499 Score = 52.9 bits (127), Expect = 2e-08 Identities = 19/60 (31%), Positives = 35/60 (58%) Query: 5 ISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNEL 64 + + + G++ + ++V +S G G+ IVGLP+ V ESRER++S ++G F + Sbjct: 1 VYSRSSLGVEAPLITIEVDISKGLPGITIVGLPETTVKESRERVKSAIKNSGFHFPAKRI 60 >gnl|CDD|182120 PRK09862, PRK09862, putative ATP-dependent protease; Provisional. Length = 506 Score = 45.4 bits (107), Expect = 4e-06 Identities = 21/58 (36%), Positives = 37/58 (63%) Query: 2 ISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLF 59 +S + T A G+ P+ V+V +S G G+ +VGLP+ V E+R+R++S I++G + Sbjct: 3 LSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGYEY 60 >gnl|CDD|182576 PRK10594, PRK10594, murein L,D-transpeptidase; Provisional. Length = 608 Score = 28.2 bits (63), Expect = 0.45 Identities = 15/70 (21%), Positives = 32/70 (45%), Gaps = 6/70 (8%) Query: 16 IPVEVQVMVS--PGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSIY----L 69 IP + V VS + LP+ + +SR +++S +N+L +Y + Sbjct: 36 IPGDSPVAVSEQGEALPQAQQPLPEGSAEKSRTQLESQLPAGYKPVYLNQLQLLYAARDM 95 Query: 70 QLIYQKKDLI 79 Q +++ +D + Sbjct: 96 QPMWEDRDAV 105 >gnl|CDD|180971 PRK07418, PRK07418, acetolactate synthase 3 catalytic subunit; Reviewed. Length = 616 Score = 25.4 bits (56), Expect = 3.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 23 MVSPGRVGVQIVGLPDKAVIE 43 MV PG+ Q+VGLP+ + Sbjct: 567 MVPPGKSNAQMVGLPEHPELA 587 >gnl|CDD|163029 TIGR02813, omega_3_PfaA, polyketide-type polyunsaturated fatty acid synthase PfaA. Members of the seed for this alignment are involved in omega-3 polyunsaturated fatty acid biosynthesis, such as the protein PfaA from the eicosapentaenoic acid biosynthesis operon in Photobacterium profundum strain SS9. PfaA is encoded together with PfaB, PfaC, and PfaD, and the functions of the individual polypeptides have not yet been described. More distant homologs of PfaA, also included with the reach of this model, appear to be involved in polyketide-like biosynthetic mechanisms of polyunsaturated fatty acid biosynthesis, an alternative to the more familiar iterated mechanism of chain extension and desaturation, and in most cases are encoded near genes for homologs of PfaB, PfaC, and/or PfaD. Length = 2582 Score = 25.4 bits (55), Expect = 3.2 Identities = 13/45 (28%), Positives = 21/45 (46%), Gaps = 5/45 (11%) Query: 22 VMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPS 66 +V+ G GV + +E ++ Q+HFI AG + PS Sbjct: 2000 FLVTGGAKGVTF-----ECALELAKQCQAHFILAGRSSFDDNEPS 2039 >gnl|CDD|164820 PHA00520, PHA00520, packaging NTPase P4. Length = 330 Score = 25.2 bits (55), Expect = 4.0 Identities = 18/59 (30%), Positives = 23/59 (38%), Gaps = 3/59 (5%) Query: 6 STIAFQGIKGIPVEVQV-MVSPGRVG--VQIVGLPDKAVIESRERIQSHFIHAGLLFLV 61 I F VE QV +V PG G V I + A R H I +G+ +V Sbjct: 72 KIIGFHKGDVAVVESQVKVVRPGHRGWDVIITSVLTVACAPVVHRWIGHRIESGVEVVV 130 >gnl|CDD|178451 PLN02860, PLN02860, o-succinylbenzoate-CoA ligase. Length = 563 Score = 24.8 bits (54), Expect = 5.3 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Query: 17 PVEVQVMVS--PGRVGVQIVGLPDKAVIE 43 P EV+ ++S PG V +VG+PD + E Sbjct: 449 PEEVEAVLSQHPGVASVVVVGVPDSRLTE 477 >gnl|CDD|150907 pfam10310, DUF2413, Protein of unknown function (DUF2413). This is a family of proteins conserved in fungi. The function is not known. Length = 443 Score = 24.8 bits (54), Expect = 5.8 Identities = 13/39 (33%), Positives = 18/39 (46%), Gaps = 6/39 (15%) Query: 42 IESRERIQSHFIHAGLLFLVNELPSIYLQLIYQKKDLIM 80 I S E +Q H +H LV PS+ L+Y +M Sbjct: 200 ISSHEVLQIHLVHD----LVG-YPSLD-PLVYSVFSRVM 232 >gnl|CDD|150518 pfam09856, DUF2083, Predicted transcriptional regulator (DUF2083). This domain is found in various prokaryotic transcriptional regulatory proteins belonging to the XRE family. Its exact function is, as yet, unknown. Length = 156 Score = 24.1 bits (53), Expect = 8.9 Identities = 7/14 (50%), Positives = 10/14 (71%) Query: 25 SPGRVGVQIVGLPD 38 PGR+ VQ+ +PD Sbjct: 52 QPGRILVQLAEMPD 65 >gnl|CDD|168150 PRK05646, PRK05646, lipid A biosynthesis lauroyl acyltransferase; Provisional. Length = 310 Score = 24.0 bits (52), Expect = 9.3 Identities = 11/31 (35%), Positives = 16/31 (51%), Gaps = 9/31 (29%) Query: 44 SRERIQSHFIH---------AGLLFLVNELP 65 R R ++ F+H GLL+LV +LP Sbjct: 2 DRPRFRAAFLHPRFWPLWLGLGLLWLVVQLP 32 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.328 0.145 0.407 Gapped Lambda K H 0.267 0.0698 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,419,379 Number of extensions: 79209 Number of successful extensions: 186 Number of sequences better than 10.0: 1 Number of HSP's gapped: 186 Number of HSP's successfully gapped: 18 Length of query: 87 Length of database: 5,994,473 Length adjustment: 56 Effective length of query: 31 Effective length of database: 4,784,425 Effective search space: 148317175 Effective search space used: 148317175 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.1 bits)