RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781028|ref|YP_003065441.1| putative Mg2+ chelatase family protein [Candidatus Liberibacter asiaticus str. psy62] (87 letters) >1rre_A ATP-dependent protease LA; catalytic Ser-Lys DYAD, hydrolase; HET: MSE; 1.75A {Escherichia coli} (A:) Length = 200 Score = 42.8 bits (100), Expect = 2e-05 Identities = 7/56 (12%), Positives = 22/56 (39%) Query: 1 MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAG 56 + +++ +A+ + G + ++ PG+ + G + ES + + Sbjct: 10 RVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVXQESIQAALTVVRARA 65 >1z0w_A Putative protease LA homolog type; ATP-dependent protease, catalytic Ser-Lys DYAD, B-type LON, hydrolase; 1.20A {Archaeoglobus fulgidus} PDB: 1z0b_A 1z0c_A 1z0e_A 1z0g_A 1z0t_A 1z0v_A (A:) Length = 207 Score = 32.4 bits (73), Expect = 0.025 Identities = 12/82 (14%), Positives = 24/82 (29%), Gaps = 4/82 (4%) Query: 9 AFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSIY 68 + + I EV +S V G + E+ + + + N I Sbjct: 24 SAGIVLPIIAEVTPSMSKSEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQ 83 Query: 69 LQLIYQKKDL----IMIYLSFL 86 Y+ + I I + + Sbjct: 84 FVGTYEGVEGDSASISIATAVI 105 >1xhk_A Putative protease LA homolog; LON protease, ATP dependent, catalytic DYAD, hydrolase; HET: MES; 1.90A {Methanocaldococcus jannaschii} (A:) Length = 187 Score = 27.4 bits (60), Expect = 0.78 Identities = 4/67 (5%), Positives = 15/67 (22%), Gaps = 12/67 (17%) Query: 3 SRISTIAFQGIKGIPVEVQVMVSPGR----------VGVQIVGLPDKAVIESRERIQSHF 52 + + + + VQ++ S + + L + + Sbjct: 13 AVLGAGGIGDV--TKIIVQILESKNPGTHLLNISGDIAKHSITLASALSKKLVAEKKLPL 70 Query: 53 IHAGLLF 59 + Sbjct: 71 PKKDIDL 77 >2wpn_B Periplasmic [nifese] hydrogenase, large subunit, selenocysteine-containing; metal-binding, oxidoreductase, oxygen tolerance; HET: FSX SBY PSW; 2.04A {Desulfovibrio vulgaris} (B:84-224,B:327-388) Length = 203 Score = 24.1 bits (52), Expect = 6.9 Identities = 5/15 (33%), Positives = 7/15 (46%) Query: 46 ERIQSHFIHAGLLFL 60 +QSH +H L Sbjct: 16 NYLQSHILHFYHLSA 30 >1z2z_A Probable tRNA pseudouridine synthase D; alpha-beta protein., structural genomics, PSI, protein structure initiative; 2.60A {Methanosarcina mazei} (A:173-292) Length = 120 Score = 23.7 bits (51), Expect = 9.3 Identities = 3/33 (9%), Positives = 12/33 (36%) Query: 39 KAVIESRERIQSHFIHAGLLFLVNELPSIYLQL 71 + + + F+H ++ N + ++ Sbjct: 84 GSFRVLPQNLYRXFVHGYQSYIYNIILCRRIEA 116 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.328 0.145 0.407 Gapped Lambda K H 0.267 0.0436 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 611,424 Number of extensions: 23140 Number of successful extensions: 74 Number of sequences better than 10.0: 1 Number of HSP's gapped: 73 Number of HSP's successfully gapped: 8 Length of query: 87 Length of database: 4,956,049 Length adjustment: 49 Effective length of query: 38 Effective length of database: 3,299,604 Effective search space: 125384952 Effective search space used: 125384952 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.8 bits)