BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781031|ref|YP_003065444.1| exsB protein [Candidatus Liberibacter asiaticus str. psy62] (240 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781031|ref|YP_003065444.1| exsB protein [Candidatus Liberibacter asiaticus str. psy62] Length = 240 Score = 503 bits (1294), Expect = e-144, Method: Compositional matrix adjust. Identities = 240/240 (100%), Positives = 240/240 (100%) Query: 1 MNDIIKKAPSALLLFSGGQDSSTCLSWALDRFDRVETLSFDYGQRNKVELECRLCVRKKI 60 MNDIIKKAPSALLLFSGGQDSSTCLSWALDRFDRVETLSFDYGQRNKVELECRLCVRKKI Sbjct: 1 MNDIIKKAPSALLLFSGGQDSSTCLSWALDRFDRVETLSFDYGQRNKVELECRLCVRKKI 60 Query: 61 VELMPKWKDSLGEDHILPLAILGDISHSSLTKNVAMKIQDNNLPNTFVPGRNIIFLVFAA 120 VELMPKWKDSLGEDHILPLAILGDISHSSLTKNVAMKIQDNNLPNTFVPGRNIIFLVFAA Sbjct: 61 VELMPKWKDSLGEDHILPLAILGDISHSSLTKNVAMKIQDNNLPNTFVPGRNIIFLVFAA 120 Query: 121 TLAYRLGITNIVIGVCETDYSGYPDCRHDTIRAIETAINLGMESHVTVHTPLMWLKKYET 180 TLAYRLGITNIVIGVCETDYSGYPDCRHDTIRAIETAINLGMESHVTVHTPLMWLKKYET Sbjct: 121 TLAYRLGITNIVIGVCETDYSGYPDCRHDTIRAIETAINLGMESHVTVHTPLMWLKKYET 180 Query: 181 WKLAQDIGGQDLVNLILEESHTCYLGKRDKRYEWGYGCNSCPACYLRQKGWMEFKEKYQD 240 WKLAQDIGGQDLVNLILEESHTCYLGKRDKRYEWGYGCNSCPACYLRQKGWMEFKEKYQD Sbjct: 181 WKLAQDIGGQDLVNLILEESHTCYLGKRDKRYEWGYGCNSCPACYLRQKGWMEFKEKYQD 240 >gi|254780439|ref|YP_003064852.1| carbamoyl phosphate synthase large subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 1162 Score = 24.6 bits (52), Expect = 1.6, Method: Compositional matrix adjust. Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Query: 126 LGITNIVIG-VCETDYSGYPDCR 147 +G IVIG CE DYSG C+ Sbjct: 13 IGAGPIVIGQACEFDYSGTQACK 35 >gi|254780340|ref|YP_003064753.1| proline/glycine betaine ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Score = 23.1 bits (48), Expect = 5.1, Method: Compositional matrix adjust. Identities = 15/47 (31%), Positives = 23/47 (48%) Query: 81 ILGDISHSSLTKNVAMKIQDNNLPNTFVPGRNIIFLVFAATLAYRLG 127 +L D SSL + M++QD L + I+F+ A+RLG Sbjct: 191 LLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSHDINEAFRLG 237 >gi|254780234|ref|YP_003064647.1| argininosuccinate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 404 Score = 22.7 bits (47), Expect = 6.3, Method: Compositional matrix adjust. Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 6/54 (11%) Query: 12 LLLFSGGQDSSTCLSWALDRFDRVETLSF--DYGQRNKVEL---ECRLCVRKKI 60 +L +SGG D+S L W L +E + F D GQ ++++ + RL K++ Sbjct: 9 VLAYSGGLDTSIILKW-LQVEKGLEVIVFIADLGQGEELKIASDKARLLGAKEV 61 >gi|254780323|ref|YP_003064736.1| ATP/ADP translocase [Candidatus Liberibacter asiaticus str. psy62] Length = 491 Score = 22.3 bits (46), Expect = 8.5, Method: Compositional matrix adjust. Identities = 11/38 (28%), Positives = 18/38 (47%) Query: 3 DIIKKAPSALLLFSGGQDSSTCLSWALDRFDRVETLSF 40 D+IK P AL +F G + + FD + ++F Sbjct: 375 DVIKLVPLALAVFLGSLQNVLSKATKYTMFDSTKEMAF 412 >gi|254780764|ref|YP_003065177.1| hypothetical protein CLIBASIA_03275 [Candidatus Liberibacter asiaticus str. psy62] Length = 194 Score = 21.9 bits (45), Expect = 9.9, Method: Compositional matrix adjust. Identities = 14/53 (26%), Positives = 25/53 (47%), Gaps = 7/53 (13%) Query: 144 PDCRHDTIRAIETAINLG-------MESHVTVHTPLMWLKKYETWKLAQDIGG 189 P R TI+A +G + +++T P+ +K+YE W+ +D G Sbjct: 53 PLPRFVTIKASRANSRIGPGIMYTVVCTYLTKGLPVEVVKEYENWRQIRDFDG 105 >gi|254780367|ref|YP_003064780.1| ribonuclease protein [Candidatus Liberibacter asiaticus str. psy62] Length = 281 Score = 21.9 bits (45), Expect = 9.9, Method: Compositional matrix adjust. Identities = 11/32 (34%), Positives = 16/32 (50%) Query: 115 FLVFAATLAYRLGITNIVIGVCETDYSGYPDC 146 F+VF A LA LG V V + + +P+ Sbjct: 42 FIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.138 0.438 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 164,690 Number of Sequences: 1233 Number of extensions: 6673 Number of successful extensions: 16 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 11 Number of HSP's gapped (non-prelim): 8 length of query: 240 length of database: 328,796 effective HSP length: 71 effective length of query: 169 effective length of database: 241,253 effective search space: 40771757 effective search space used: 40771757 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 37 (18.9 bits)