HHsearch alignment for GI: 254781032 and conserved domain: COG0720

>COG0720 6-pyruvoyl-tetrahydropterin synthase [Coenzyme metabolism].
Probab=100.00  E-value=3.6e-38  Score=225.02  Aligned_cols=116  Identities=50%  Similarity=0.822  Sum_probs=105.9

Q ss_pred             CEEEEEEEEECCEECCCCCCCCCCCCCCCCCEEEEEEEEECCCCCCEEEEEHHHHHHHHHHHHHHHHHHHCCCCCCC--C
Q ss_conf             97999999971212279998776356767348999999933688754886299999999888775313320335543--3
Q gi|254781032|r    1 MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEEL--E   78 (118)
Q Consensus         1 m~itk~~~F~aaH~l~~~~~~~kc~~lHGH~y~v~v~~~g~~~~~~G~viDf~~lk~~~~~i~~~lDH~~Lnd~~~~--~   78 (118)
T Consensus         3 ~~i~~~f~F~AaH~l~~~~--~kC~~lHGHty~veV~i~ge~~d~~Gmv~DF~~lk~~~k~i~~~~DH~~Ln~~~~~~~~   80 (127)
T COG0720           3 RGITKRFSFDAAHRLPGHP--GKCGRLHGHTYKVEVEIEGEELDEHGMVVDFGELKKAVKEILDELDHKLLNDIEEFDKE   80 (127)
T ss_pred             EEEEEEEEEECCEECCCCC--CCCCCCCCCCEEEEEEEEEEEECCCCEEEEHHHHHHHHHHHHHCCCHHHHCCCCCCCCC
T ss_conf             8999978997420536899--85457778326999999864314778899989999999986641581665476543556


Q ss_pred             CCCHHHHHHHHHHHHHHHCC---CCEE--EEEE--ECCCCEEEEECC
Q ss_conf             66556899999999985114---2127--9999--859955997509
Q gi|254781032|r   79 NPTAENIAIWIWKRLSTSLS---ILSS--VRVY--ETPMSWVEYQGF  118 (118)
Q Consensus        79 nPT~Enia~~i~~~l~~~l~---~l~~--V~v~--Et~~~~a~Y~G~  118 (118)
T Consensus        81 ~pt~E~~a~~i~~~~~~~l~~~~~~s~~~~~~~~~Et~~~~~e~~~~  127 (127)
T COG0720          81 NPTAENIAKWIFDRLKVVLPDEAETSAEELREYVAETPTSGAEYRKR  127 (127)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCCHHHEEEEEECCCCCEEEEEEC
T ss_conf             73399999999999986546612456521023354179731899649