HHsearch alignment for GI: 254781032 and conserved domain: TIGR03367

>TIGR03367 queuosine_QueD queuosine biosynthesis protein QueD. Members of this protein family, closely related to eukaryotic 6-pyruvoyl tetrahydrobiopterin synthase enzymes, are the QueD protein of queuosine biosynthesis. Queuosine is a hypermodified base in the wobble position of tRNAs for Tyr, His, Asp, and Asn in many species. This modification, although widespread, appears not to be important for viability. The queuosine precursor made by this enzyme may be converted instead to archeaosine as in some Archaea.
Probab=100.00  E-value=2.6e-37  Score=220.46  Aligned_cols=92  Identities=48%  Similarity=0.906  Sum_probs=88.2

Q ss_pred             EEEEEEEEECCEECCCCCCCCCCCCCCCCCEEEEEEEEECCCCCCEEEEEHHHHHHHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             79999999712122799987763567673489999999336887548862999999998887753133203355433665
Q gi|254781032|r    2 KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEELENPT   81 (118)
Q Consensus         2 ~itk~~~F~aaH~l~~~~~~~kc~~lHGH~y~v~v~~~g~~~~~~G~viDf~~lk~~~~~i~~~lDH~~Lnd~~~~~nPT   81 (118)
T Consensus         1 ~i~k~f~F~aAH~l~~~~--gkC~~lHGH~y~v~v~~~g~~l~~~G~vvDf~~lk~~~~~i~~~lDH~~Lnd~~~~~npT   78 (92)
T TIGR03367         1 EITKEFTFDAAHRLPGYP--GKCANLHGHTYKVEVTVSGEVLDEAGMVMDFSDLKAIVKEVVDRLDHALLNDVPGLENPT   78 (92)
T ss_pred             CEEEEEEEECCCCCCCCC--CCCCCCCCCEEEEEEEEEEECCCCCCEEEEHHHHHHHHHHHHHHHCHHHHHCCCCCCCCC
T ss_conf             914999997673668999--886465163599999999401687876975999999999999986624354257877989


Q ss_pred             HHHHHHHHHHHHHH
Q ss_conf             56899999999985
Q gi|254781032|r   82 AENIAIWIWKRLST   95 (118)
Q Consensus        82 ~Enia~~i~~~l~~   95 (118)
T Consensus        79 ~Enla~~i~~~l~~   92 (92)
T TIGR03367        79 AENLARWIYDRLKA   92 (92)
T ss_pred             HHHHHHHHHHHHHC
T ss_conf             99999999999739