HHsearch alignment of GI: 254781032 and MMDB domain: 2oba_A_

>2oba_A (A:) Probable 6-pyruvoyl tetrahydrobiopterin synthase; tetrahydrobiopterin biosynthesis, PTP synthase, PTPS, lyase; 2.33A {Pseudomonas aeruginosa}
Probab=100.00  E-value=5.7e-44  Score=255.69  Aligned_cols=116  Identities=54%  Similarity=0.980  Sum_probs=113.6

Q ss_pred             EEEEEEEEECCEECCCCCCCCCCCCCCCCCEEEEEEEEECCCCCCEEEEEHHHHHHHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             79999999712122799987763567673489999999336887548862999999998887753133203355433665
Q gi|254781032|r    2 KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEELENPT   81 (118)
Q Consensus         2 ~itk~~~F~aaH~l~~~~~~~kc~~lHGH~y~v~v~~~g~~~~~~G~viDf~~lk~~~~~i~~~lDH~~Lnd~~~~~nPT   81 (118)
                      +|+|+++|+|||+|++++..|||+++|||||+|+|+++|+.+++.|||+||+++|++++.++++|||++||+++++.|||
T Consensus        22 ~i~~~~~F~aAH~l~~~~~~g~c~~lHGHty~v~v~i~~~~l~~~g~vvDf~~lk~~~~~v~~~lDh~~L~~~~~~~~pT  101 (138)
T 2oba_A           22 ELFKEFTFESAHRLPHVPEGHKCGRLHGHSFRVAIHIEGEVDPHTGWIRDFAEIKAIFKPIYEQLDHNYLNDIPGLENPT  101 (138)
T ss_dssp             EEEEEEEEEEEECCSSSCTTCGGGSSEEEEEEEEEEEEECCCTTTSSSSCHHHHHHHHHHHHHHHTTSBGGGSTTCSSCC
T ss_pred             EEEEEEEEEEEEECCCCCCCCCCCCCCCCEEEEEEEEEEEECCCCCEEEEHHHHHHHHHHHHHHCCHHHHCCCCCCCCCC
T ss_conf             99999999727596899999975787088089999999766688874854999878898766330203215662211338


Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEEECCCCEEEEEC
Q ss_conf             568999999999851142127999985995599750
Q gi|254781032|r   82 AENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG  117 (118)
Q Consensus        82 ~Enia~~i~~~l~~~l~~l~~V~v~Et~~~~a~Y~G  117 (118)
                      +||||+|||+++++++|++.+|+|||||++||+|+|
T Consensus       102 ~E~la~~i~~~l~~~l~~l~~V~v~Et~~~~A~y~~  137 (138)
T 2oba_A          102 SENLCRWIWQQLKPLLPELSKVRVHETCTSGCEYRG  137 (138)
T ss_dssp             HHHHHHHHHHHHGGGCTTEEEEEEESSTTEEEEECC
T ss_pred             HHHHHHHHHHHHHHHHCCCEEEEEEECCCCEEEEEC
T ss_conf             899999999998874266228999978998899958