Query         gi|254781032|ref|YP_003065445.1| hypothetical protein CLIBASIA_04670 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 118
No_of_seqs    107 out of 1297
Neff          6.6 
Searched_HMMs 33803
Date          Wed Jun  1 20:36:36 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781032.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >2oba_A Probable 6-pyruvoyl te 100.0 5.7E-44       0  255.7  12.3  116    2-117    22-137 (138)
  2 >3d7j_A Uncharacterized protei 100.0 2.5E-42       0  247.0  11.0  116    1-117    22-150 (152)
  3 >2g64_A Putative 6-pyruvoyl te 100.0 3.3E-41 1.4E-45  241.0  11.4  117    1-117     7-139 (140)
  4 >1b66_A 6-pyruvoyl tetrahydrop 100.0 1.7E-40 5.6E-45  237.1  11.5  117    1-117     7-139 (140)
  5 >2dj6_A Hypothetical protein P 100.0 3.5E-39   1E-43  230.1  10.4  109    1-116     3-114 (115)
  6 >3jyg_A Uncharacterized protei 100.0 1.8E-36 5.4E-41  215.6  10.7  116    1-117     5-180 (188)
  7 >2a0s_A 6-pyruvoyl tetrahydrop 100.0 5.6E-36 1.6E-40  213.0  10.6  113    1-117    24-178 (180)
  8 >1y13_A PTPS, 6-pyruvoyl tetra 100.0 4.1E-35 1.2E-39  208.3  10.8  113    1-117    25-179 (181)
  9 >3jyg_A Uncharacterized protei  94.0   0.002   6E-08   38.8  -3.8   44   74-117    82-137 (188)
 10 >1y13_A PTPS, 6-pyruvoyl tetra  66.9    0.09 2.7E-06   30.0  -6.0   27   81-107   104-130 (181)
 11 >1oao_C CODH, carbon monoxide   34.2      29 0.00086   16.5   2.4   70   36-105    42-141 (173)
 12 >1k8k_A ARP3, actin-like prote  25.1      51  0.0015   15.2   2.4   50   45-94     79-135 (189)
 13 >3dwl_A Actin-related protein   22.9      41  0.0012   15.7   1.6   50   45-94     95-151 (219)
 14 >2cg8_A Dihydroneopterin aldol  22.2      63  0.0019   14.7   6.9   84    6-106     8-96  (119)

No 1  
>>2oba_A Probable 6-pyruvoyl tetrahydrobiopterin synthase; tetrahydrobiopterin biosynthesis, PTP synthase, PTPS, lyase; 2.33A {Pseudomonas aeruginosa} (A:)
Probab=100.00  E-value=5.7e-44  Score=255.69  Aligned_cols=116  Identities=54%  Similarity=0.980  Sum_probs=113.6

Q ss_pred             EEEEEEEEECCEECCCCCCCCCCCCCCCCCEEEEEEEEECCCCCCEEEEEHHHHHHHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             79999999712122799987763567673489999999336887548862999999998887753133203355433665
Q gi|254781032|r    2 KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEELENPT   81 (118)
Q Consensus         2 ~itk~~~F~aaH~l~~~~~~~kc~~lHGH~y~v~v~~~g~~~~~~G~viDf~~lk~~~~~i~~~lDH~~Lnd~~~~~nPT   81 (118)
                      +|+|+++|+|||+|++++..|||+++|||||+|+|+++|+.+++.|||+||+++|++++.++++|||++||+++++.|||
T Consensus        22 ~i~~~~~F~aAH~l~~~~~~g~c~~lHGHty~v~v~i~~~~l~~~g~vvDf~~lk~~~~~v~~~lDh~~L~~~~~~~~pT  101 (138)
T 2oba_A           22 ELFKEFTFESAHRLPHVPEGHKCGRLHGHSFRVAIHIEGEVDPHTGWIRDFAEIKAIFKPIYEQLDHNYLNDIPGLENPT  101 (138)
T ss_dssp             EEEEEEEEEEEECCSSSCTTCGGGSSEEEEEEEEEEEEECCCTTTSSSSCHHHHHHHHHHHHHHHTTSBGGGSTTCSSCC
T ss_pred             EEEEEEEEEEEEECCCCCCCCCCCCCCCCEEEEEEEEEEEECCCCCEEEEHHHHHHHHHHHHHHCCHHHHCCCCCCCCCC
T ss_conf             99999999727596899999975787088089999999766688874854999878898766330203215662211338


Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEEECCCCEEEEEC
Q ss_conf             568999999999851142127999985995599750
Q gi|254781032|r   82 AENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG  117 (118)
Q Consensus        82 ~Enia~~i~~~l~~~l~~l~~V~v~Et~~~~a~Y~G  117 (118)
                      +||||+|||+++++++|++.+|+|||||++||+|+|
T Consensus       102 ~E~la~~i~~~l~~~l~~l~~V~v~Et~~~~A~y~~  137 (138)
T 2oba_A          102 SENLCRWIWQQLKPLLPELSKVRVHETCTSGCEYRG  137 (138)
T ss_dssp             HHHHHHHHHHHHGGGCTTEEEEEEESSTTEEEEECC
T ss_pred             HHHHHHHHHHHHHHHHCCCEEEEEEECCCCEEEEEC
T ss_conf             899999999998874266228999978998899958


No 2  
>>3d7j_A Uncharacterized protein SCO6650; T-fold, unknown function; 1.45A {Streptomyces coelicolor} (A:)
Probab=100.00  E-value=2.5e-42  Score=246.96  Aligned_cols=116  Identities=20%  Similarity=0.265  Sum_probs=109.0

Q ss_pred             CEEEEEEEEECCEECCCCCCCCCCCCCCCCCEEEEEEEEECCCCCCEEEEEHHHHHHHHHHHHHHHHHHHCCCCCCCC--
Q ss_conf             979999999712122799987763567673489999999336887548862999999998887753133203355433--
Q gi|254781032|r    1 MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEELE--   78 (118)
Q Consensus         1 m~itk~~~F~aaH~l~~~~~~~kc~~lHGH~y~v~v~~~g~~~~~~G~viDf~~lk~~~~~i~~~lDH~~Lnd~~~~~--   78 (118)
                      |+|+|+++|+||||+++ ...|+|+++|||||.|+|++.|+.+++.|||+||+++|+++++++++|||++||+.+++.  
T Consensus        22 ~~i~k~~~F~aaH~l~~-~~~g~c~~lHGHty~v~v~i~g~~l~~~G~viDF~~lk~~~~~v~~~lDH~~L~~~~~~~~~  100 (152)
T 3d7j_A           22 FSITVRDHIXIAHSFRG-DVFGPAQRLHGATFLVDATFRREQLDEDNIVVDIGLATQELGAVVGALNYRNLDNEPDFAGV  100 (152)
T ss_dssp             EEEEEEEEEEEEECCCS-GGGGGGGSSEEEEEEEEEEEEESSCCTTSSSSCHHHHHHHHHHHHHTTTTEEGGGCGGGTTS
T ss_pred             EEEEEEEEEEEEEECCC-CCCCCCCCCCCCEEEEEEEEEEEECCCCCEEECHHHHHHHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             99999899996878589-88987678544369999999988415588484299988888888887742313345101125


Q ss_pred             CCCHHHHHHHHHHHHHHHCCC-----------CEEEEEEECCCCEEEEEC
Q ss_conf             665568999999999851142-----------127999985995599750
Q gi|254781032|r   79 NPTAENIAIWIWKRLSTSLSI-----------LSSVRVYETPMSWVEYQG  117 (118)
Q Consensus        79 nPT~Enia~~i~~~l~~~l~~-----------l~~V~v~Et~~~~a~Y~G  117 (118)
                      |||+||||+|||+++++.|++           +.+|+|+|||++||+|+|
T Consensus       101 ~pT~E~la~~i~~~l~~~L~~~~~~~~~~~~~l~~v~v~Etp~~~a~y~~  150 (152)
T 3d7j_A          101 NTSTEFLAKVIADRLAERVHKGALGEGARGLAGLTVTLHESHVAWASYER  150 (152)
T ss_dssp             CCCHHHHHHHHHHHHHHHHHTTTTCGGGGGCCEEEEEEECSSSEEEEEEE
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEEEECCCCEEEEEC
T ss_conf             87278999999999999765421233567549999999918995899816


No 3  
>>2g64_A Putative 6-pyruvoyl tetrahydrobiopterin synthase; tetrahydrobiopterin biosynthesis, phosphate elimination, pterine synthesis; 1.80A {Caenorhabditis elegans} (A:)
Probab=100.00  E-value=3.3e-41  Score=240.96  Aligned_cols=117  Identities=32%  Similarity=0.563  Sum_probs=108.2

Q ss_pred             CEEEEEEEEECCEECCCCCC----------CCCCCCCCCCCEEEEEEEEECCCCCCEEEEEHHHHHHHHHHHHHHHHHHH
Q ss_conf             97999999971212279998----------77635676734899999993368875488629999999988877531332
Q gi|254781032|r    1 MKITQAFTFEAAHRLPRVPK----------THKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHC   70 (118)
Q Consensus         1 m~itk~~~F~aaH~l~~~~~----------~~kc~~lHGH~y~v~v~~~g~~~~~~G~viDf~~lk~~~~~i~~~lDH~~   70 (118)
                      ++|+|+++|+|||||+++..          .++|+++|||||+|+|++.|+.+++.|||+||++||+++++|+++|||++
T Consensus         7 ~~i~~~~~F~aaH~l~~~~~~~~~~~~~~~~~~c~~lHGHty~v~v~i~g~~l~~~g~v~DF~~lk~~~~~i~~~lDH~~   86 (140)
T 2g64_A            7 VTMERVDSFSAAHRLHSEKLSDAENKETFGKCNNSNGHGHNYVWKVKLRGEVDPTSGMVYDLAKLKKEMSLVLDTVDHRN   86 (140)
T ss_dssp             EEEEEEEEEEEEECCCCTTSCHHHHHHHHGGGGCTTCEEEEEEEEEEEEEECCTTTCCSSCHHHHHHHHHHHHHTTTTEE
T ss_pred             EEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEECCCCCCEEEEHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999974324488876611176567767898998971899999994038867838619999999999988743565


Q ss_pred             CC-CCCCCC--CCCHHHHHHHHHHHHHHHCCC---CEEEEEEECCCCEEEEEC
Q ss_conf             03-355433--665568999999999851142---127999985995599750
Q gi|254781032|r   71 LN-EIEELE--NPTAENIAIWIWKRLSTSLSI---LSSVRVYETPMSWVEYQG  117 (118)
Q Consensus        71 Ln-d~~~~~--nPT~Enia~~i~~~l~~~l~~---l~~V~v~Et~~~~a~Y~G  117 (118)
                      || +++++.  |||+||||+|||++|++.+++   |.+|+|+|||++||+|+|
T Consensus        87 l~~~~~~l~~~~pT~E~la~~i~~~l~~~l~~~~~l~~V~i~Et~~~~a~y~~  139 (140)
T 2g64_A           87 LDKDVEFFKTTVSTSENVAIYMFEKLKSVMSNPSVLYKVTIEETPKNIFTYKG  139 (140)
T ss_dssp             HHHHCGGGGTSCCCHHHHHHHHHHHHHHHCSSGGGEEEEEEEEETTEEEEECC
T ss_pred             HCCCCHHHCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEEEEECCCCEEEEEC
T ss_conf             50225545146754899999999999975578855899999977998899969


No 4  
>>1b66_A 6-pyruvoyl tetrahydropterin synthase; tetrahydrobiopterin biosynthesis, phosphate elimination, pterine synthesis; HET: BIO; 1.90A {Rattus rattus} (A:)
Probab=100.00  E-value=1.7e-40  Score=237.07  Aligned_cols=117  Identities=34%  Similarity=0.705  Sum_probs=106.2

Q ss_pred             CEEEEEEEEECCEECCCCCC--------CCCCCC--CCCCCEEEEEEEEECCCCCCEEEEEHHHHHHHHHH-HHHHHHHH
Q ss_conf             97999999971212279998--------776356--76734899999993368875488629999999988-87753133
Q gi|254781032|r    1 MKITQAFTFEAAHRLPRVPK--------THKCHR--MHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP-LLEKLDHH   69 (118)
Q Consensus         1 m~itk~~~F~aaH~l~~~~~--------~~kc~~--lHGH~y~v~v~~~g~~~~~~G~viDf~~lk~~~~~-i~~~lDH~   69 (118)
                      |+|+|+++|+|||+|+++.+        .|+|.+  +|||||+|+|++.|+.+++.|||+||++||++++. |+++|||+
T Consensus         7 ~~i~k~~~F~aaH~l~~~~~~~~~~~~~~g~c~~~~lHGH~y~v~v~~~g~~l~~~g~v~DF~~lk~~~~~~i~~~lDH~   86 (140)
T 1b66_A            7 ARLSRLVSFSASHRLHSPSLSAEENLKVFGKCNNPNGHGHNYKVVVTIHGEIDPVTGMVMNLTDLKEYMEEAIMKPLDHK   86 (140)
T ss_dssp             EEEEEEEEEEEEECCCCTTSCHHHHHHHHGGGGCTTCEEEEEEEEEEEEEECCTTTCCSSCHHHHHHHHHHHTHHHHTTE
T ss_pred             EEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEECCCCCCEEEEHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999972337379877701065357767998998982899999996017767808778999999998554165220


Q ss_pred             HCC-CCCCCC--CCCHHHHHHHHHHHHHHHCCC--CEEEEEEECCCCEEEEEC
Q ss_conf             203-355433--665568999999999851142--127999985995599750
Q gi|254781032|r   70 CLN-EIEELE--NPTAENIAIWIWKRLSTSLSI--LSSVRVYETPMSWVEYQG  117 (118)
Q Consensus        70 ~Ln-d~~~~~--nPT~Enia~~i~~~l~~~l~~--l~~V~v~Et~~~~a~Y~G  117 (118)
                      +|| +.+.+.  |||+||||+|||++|++.+++  |.+|+|+|||++||+|+|
T Consensus        87 ~Ln~~~~~~~~~~pT~E~lA~~i~~~l~~~l~~~~l~~V~i~Et~~~~a~y~~  139 (140)
T 1b66_A           87 NLDLDVPYFADVVSTTENVAVYIWENLQRLLPVGALYKVKVYETDNNIVVYKG  139 (140)
T ss_dssp             EHHHHCGGGTSSCCCHHHHHHHHHHHHHHHSCTTCEEEEEEEEETTEEEEECC
T ss_pred             HCCCCCHHHCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCEEEEEC
T ss_conf             20466754415795199999999999985488464579999968998899937


No 5  
>>2dj6_A Hypothetical protein PH0634; 6-pyruvoyl tetrahydrobiopterin synthase (PTPS), X-RAY diffraction, structural genomics, NPPSFA; 2.10A {Pyrococcus horikoshii OT3} PDB: 2dtt_A* (A:)
Probab=100.00  E-value=3.5e-39  Score=230.12  Aligned_cols=109  Identities=35%  Similarity=0.615  Sum_probs=101.9

Q ss_pred             CEEEEEEEEECCEECCCCCCCCCCCCCCCCCEEEEEEEEECCCCCCEEEEEHHHHHHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             97999999971212279998776356767348999999933688754886299999999888775313320335543366
Q gi|254781032|r    1 MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEELENP   80 (118)
Q Consensus         1 m~itk~~~F~aaH~l~~~~~~~kc~~lHGH~y~v~v~~~g~~~~~~G~viDf~~lk~~~~~i~~~lDH~~Lnd~~~~~nP   80 (118)
                      ++|+|+++|+|||+|+   ..|+|+++|||||+|+|+++|+.++  |||+||+++|+++++++++|||++||++++  ||
T Consensus         3 ~~i~~~~~f~aaH~l~---~~g~c~~lHGHsy~v~v~i~~~~~d--G~v~DF~~lk~~~~~i~~~lDH~~Ln~~~~--~p   75 (115)
T 2dj6_A            3 SRIIVRTSFDAAHAVK---VGDHWEDVHGHTFFLEVAIEGEIKN--GYVMDFLELRKIVEEITKELDHRNLNNIFE--NP   75 (115)
T ss_dssp             EEEEEEEEEEEBCC-------------CCEEEEEEEEEECCCBT--TBSSCHHHHHHHHHHHHTTTTTSBHHHHCS--SC
T ss_pred             EEEEEEEEEECCCCCC---CCCCCCCCCCCEEEEEEEEEEECCC--CCEEEHHHHHHHHHHHHHHHCHHHHCCCCC--CC
T ss_conf             8999999999513148---9998467868718999999960656--837709999999999987625233214689--89


Q ss_pred             CHHHHHHHHHHHHHHHCCC---CEEEEEEECCCCEEEEE
Q ss_conf             5568999999999851142---12799998599559975
Q gi|254781032|r   81 TAENIAIWIWKRLSTSLSI---LSSVRVYETPMSWVEYQ  116 (118)
Q Consensus        81 T~Enia~~i~~~l~~~l~~---l~~V~v~Et~~~~a~Y~  116 (118)
                      |+||||+||++++++.+++   +.+|+|+|||++||+|+
T Consensus        76 TaE~la~~i~~~l~~~l~~~~~l~~V~v~Et~~~~a~ye  114 (115)
T 2dj6_A           76 TTENIALWIGERIRDKLPPYVKLKRVVLWEGKDNGVELE  114 (115)
T ss_dssp             CHHHHHHHHHHHHHHHCCTTCEEEEEEEEESSSEEEEEE
T ss_pred             CHHHHHHHHHHHHHHHCCCCCEEEEEEEEECCCCEEEEE
T ss_conf             867899999999997477784699999998999689995


No 6  
>>3jyg_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein structure initiative; 1.95A {Wolinella succinogenes} (A:)
Probab=100.00  E-value=1.8e-36  Score=215.57  Aligned_cols=116  Identities=29%  Similarity=0.442  Sum_probs=103.2

Q ss_pred             CEEEEEEEEECCEECCCCC--------CCCCCCCCCCCCEEEEEEEEECCCCCCEEEEEHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             9799999997121227999--------87763567673489999999336887548862999999998887753133203
Q gi|254781032|r    1 MKITQAFTFEAAHRLPRVP--------KTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLN   72 (118)
Q Consensus         1 m~itk~~~F~aaH~l~~~~--------~~~kc~~lHGH~y~v~v~~~g~~~~~~G~viDf~~lk~~~~~i~~~lDH~~Ln   72 (118)
                      ++|+|++.|+|||||++..        ..|||+++|||||.|+|+++|+.++ .|||+||+++|+++++++++|||++||
T Consensus         5 ~~i~~~~~F~aaH~l~~~~~~~~~~~~~~gkc~~lHGHsy~v~v~l~g~~~~-~GmviDF~~lK~~~k~i~~~lDH~~L~   83 (188)
T 3jyg_A            5 YQIAKEFDFCYGHRVWSQELNPDFSLDPCLSCRHLHGHQGKVIVHLESRELQ-RGXVTDFAHLNWFKRFIDEVLDHRFII   83 (188)
T ss_dssp             EEEEEEEEEEEEECCTTCCCCHHHHSCCCCGGGSSEEEEEEEEEEEEESSCB-TTBSSCGGGGHHHHHHHHHHTTTEEEE
T ss_pred             EEEEEEEEEECCCCCCCCCCCHHHCCCCCCCCCCCCCCEEEEEEEEEEEECC-CCCEEEHHHHHHHHHHHHHHCCCCEEE
T ss_conf             9999999996774837876554235777888489727707999999978378-773660999999999886767813020


Q ss_pred             CCCC------------------------------------------------CCCCCHHHHHHHHHHHHHHHCCC----C
Q ss_conf             3554------------------------------------------------33665568999999999851142----1
Q gi|254781032|r   73 EIEE------------------------------------------------LENPTAENIAIWIWKRLSTSLSI----L  100 (118)
Q Consensus        73 d~~~------------------------------------------------~~nPT~Enia~~i~~~l~~~l~~----l  100 (118)
                      +.++                                                -.+||+|+||+||+++|+++|+.    +
T Consensus        84 ~~~dp~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~v~~~~~~TaE~la~~~~~~l~~~l~~~~v~~  163 (188)
T 3jyg_A           84 DIDDPLFPTLLPHFADKSALVWXEEGYARVDFERIKGESSPILELYESFVVVRFVPTSESIASWLLELLRSRIQPLGVKV  163 (188)
T ss_dssp             ETTCTTHHHHSGGGTTSCSEEECTTSEEEECGGGGTTCCHHHHHHHHHEEEESSCCCHHHHHHHHHHHHHHHCGGGTCEE
T ss_pred             CCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             65771566665410222211112233321000222222222224565158842785399999999999986446687489


Q ss_pred             EEEEEEECCCCEEEEEC
Q ss_conf             27999985995599750
Q gi|254781032|r  101 SSVRVYETPMSWVEYQG  117 (118)
Q Consensus       101 ~~V~v~Et~~~~a~Y~G  117 (118)
                      .+|+|+|||++||+|+.
T Consensus       164 ~~v~v~Et~~~~A~y~~  180 (188)
T 3jyg_A          164 SSVEFLETPKSRARVYN  180 (188)
T ss_dssp             EEEEEEEETTEEEEEEE
T ss_pred             EEEEEEECCCEEEEEEE
T ss_conf             99999975992899980


No 7  
>>2a0s_A 6-pyruvoyl tetrahydropterin synthase; SGPP, structural genomics, PSI, protein structure initiative, PTPS; HET: BIO; 2.20A {Plasmodium vivax} (A:)
Probab=100.00  E-value=5.6e-36  Score=212.97  Aligned_cols=113  Identities=24%  Similarity=0.456  Sum_probs=101.4

Q ss_pred             CEEEEEEEEECCEECCCCCCCCCCCCCCCCCEEEEEEEEECCCCCCEEEEEHHHHHHHHHHHHHHHHHHHCCCC-CCC--
Q ss_conf             97999999971212279998776356767348999999933688754886299999999888775313320335-543--
Q gi|254781032|r    1 MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEI-EEL--   77 (118)
Q Consensus         1 m~itk~~~F~aaH~l~~~~~~~kc~~lHGH~y~v~v~~~g~~~~~~G~viDf~~lk~~~~~i~~~lDH~~Lnd~-~~~--   77 (118)
                      |+|+++++|+|||+++   ..|||+++|||||+|+|+++|+.+ +.|||+||+++|+++++++++|||++||+. +++  
T Consensus        24 ~~i~~~~~f~aAH~l~---~~gkc~~lHGHsy~v~v~i~geld-~~GmViDF~~lK~~ik~i~~~lDH~~L~~~~~~~~~   99 (180)
T 2a0s_A           24 LVESPLFSFNCAHFIA---FKGFRETLHGHNYNVSLRLRGNIQ-GDGYVIDFSILKEKVRKVCKQLDHHFILPMYSDVLN   99 (180)
T ss_dssp             EEEEEEEEEEEEECCE---ETTEECCCEEEEEEEEEEEEEECC-TTSCSSCHHHHHHHHHHHHHHHSSSEEEETTCSSCE
T ss_pred             EEECCEEEEECCCCCC---CCCCCCCCCCCCEEEEEEEEEECC-CCCCHHCHHHHHHHHHHHHHHCCHHHHCCCCCCCHH
T ss_conf             9962167895674178---799857872895899999997728-677300899999999999985783541566683022


Q ss_pred             ------------------------------CCCCHHHHHHHHHHHHHHHCC---------CCEEEEEEECCCCEEEEEC
Q ss_conf             ------------------------------366556899999999985114---------2127999985995599750
Q gi|254781032|r   78 ------------------------------ENPTAENIAIWIWKRLSTSLS---------ILSSVRVYETPMSWVEYQG  117 (118)
Q Consensus        78 ------------------------------~nPT~Enia~~i~~~l~~~l~---------~l~~V~v~Et~~~~a~Y~G  117 (118)
                                                    .+||+|++|++|++++++.|+         .+.+|+|+|||++||+|++
T Consensus       100 ~~~t~e~~~~~~~~~l~~~~p~~~~~~~~~~~~T~E~la~~i~~~l~~~L~~~~~~~~~v~~~~V~v~Et~~~~A~y~~  178 (180)
T 2a0s_A          100 IQEVNDNFKITCEDNSEYSFPKRDCVQIPIKHSSTEEIGLYILNQLIEEIDLPFLKTRSVNYMEVTVSESPSQKATVHR  178 (180)
T ss_dssp             EEEETTEEEEECTTCCEEEEEGGGEEEESCSSCCHHHHHHHHHHHHHHHHCHHHHHHTTCCEEEEEEEEETTEEEEEEE
T ss_pred             HHHCCCCCEEEECCCCEECCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEEECCCCCEEEEEE
T ss_conf             2320331001104541001136508882688888999999999999986451125656359999999809998899984


No 8  
>>1y13_A PTPS, 6-pyruvoyl tetrahydropterin synthase; structural genomics of pathogenic protozoa consortium, SGPP, structural genomics, PSI; HET: BIO; 2.20A {Plasmodium falciparum} (A:)
Probab=100.00  E-value=4.1e-35  Score=208.31  Aligned_cols=113  Identities=26%  Similarity=0.421  Sum_probs=100.6

Q ss_pred             CEEEEEEEEECCEECCCCCCCCCCCCCCCCCEEEEEEEEECCCCCCEEEEEHHHHHHHHHHHHHHHHHHHCCCC-CCC--
Q ss_conf             97999999971212279998776356767348999999933688754886299999999888775313320335-543--
Q gi|254781032|r    1 MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEI-EEL--   77 (118)
Q Consensus         1 m~itk~~~F~aaH~l~~~~~~~kc~~lHGH~y~v~v~~~g~~~~~~G~viDf~~lk~~~~~i~~~lDH~~Lnd~-~~~--   77 (118)
                      ++|++++.|+|||+++   ..|+|+++|||||.|+|+++|+.+ ..|||+||+++|+++++++++|||++||+. ++|  
T Consensus        25 ~~i~~~~~F~aaH~l~---~~g~c~~lHGH~y~V~v~i~~~ld-~~GmvvDF~~lk~~~~~v~~~lDH~~L~~~~~~~~~  100 (181)
T 1y13_A           25 SVESPSFSFNCAHFIA---YNGFRETLHGHNYNVSLKVRGYVR-DDGYVIDFSILKEKVKKVCNKLDHHFILPIYSDVLK  100 (181)
T ss_dssp             EEEEEEEEEEEEECCE---ETTEECCCEEEEEEEEEEEEEECC-TTSCSSCHHHHHHHHHHHHHHHSSSEEEETTCSSEE
T ss_pred             EEECCEEEEECCCCCC---CCCCCCCCCCCCEEEEEEEEEECC-CCCCCCCHHHHHHHHHHHHHHCCCCEECCCCCCHHH
T ss_conf             9966516893641288---899848973896799999998738-777532799999999999997885221676782033


Q ss_pred             ------------------------------CCCCHHHHHHHHHHHHHHHCC---------CCEEEEEEECCCCEEEEEC
Q ss_conf             ------------------------------366556899999999985114---------2127999985995599750
Q gi|254781032|r   78 ------------------------------ENPTAENIAIWIWKRLSTSLS---------ILSSVRVYETPMSWVEYQG  117 (118)
Q Consensus        78 ------------------------------~nPT~Enia~~i~~~l~~~l~---------~l~~V~v~Et~~~~a~Y~G  117 (118)
                                                    .+||+|++|+++++.|.+.+.         .+.+|+|+|||++||+|+|
T Consensus       101 ~~~t~E~i~~~i~~~l~~~~p~~~~~~~~~~~~T~E~la~~~~~~l~~~~~~~~~~~~~~~~~~V~v~Et~~~~A~y~~  179 (181)
T 1y13_A          101 FENVKNNIKIICEDNSEYSFPERDCIKLPIKHSSTEEIGQYILNQLIEEXDVSLLKSRHIHYIEISVSESPTQKAIVHK  179 (181)
T ss_dssp             EEEETTEEEEEETTSCEEEEEGGGEEEESCSSCCHHHHHHHHHHHHHHHHCHHHHHHTTCCEEEEEEEEETTEEEEEEE
T ss_pred             HHHCCCCHHEEECCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEEEECCCCCEEEEEE
T ss_conf             3320231100103552003466407883578888899999999999875550125567669999999837998999998


No 9  
>>3jyg_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein structure initiative; 1.95A {Wolinella succinogenes} (A:)
Probab=93.99  E-value=0.002  Score=38.76  Aligned_cols=44  Identities=16%  Similarity=0.089  Sum_probs=33.2

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEE------------EECCCCEEEEEC
Q ss_conf             55433665568999999999851142127999------------985995599750
Q gi|254781032|r   74 IEELENPTAENIAIWIWKRLSTSLSILSSVRV------------YETPMSWVEYQG  117 (118)
Q Consensus        74 ~~~~~nPT~Enia~~i~~~l~~~l~~l~~V~v------------~Et~~~~a~Y~G  117 (118)
                      +.+..|||+|++|+|++++++..++.+..+++            +|++.+++.|.+
T Consensus        82 L~~~~dp~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~v~~~~  137 (188)
T 3jyg_A           82 IIDIDDPLFPTLLPHFADKSALVWXEEGYARVDFERIKGESSPILELYESFVVVRF  137 (188)
T ss_dssp             EEETTCTTHHHHSGGGTTSCSEEECTTSEEEECGGGGTTCCHHHHHHHHHEEEESS
T ss_pred             EECCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECC
T ss_conf             20657715666654102222111122333210002222222222245651588427


No 10 
>>1y13_A PTPS, 6-pyruvoyl tetrahydropterin synthase; structural genomics of pathogenic protozoa consortium, SGPP, structural genomics, PSI; HET: BIO; 2.20A {Plasmodium falciparum} (A:)
Probab=66.90  E-value=0.09  Score=29.96  Aligned_cols=27  Identities=15%  Similarity=0.049  Sum_probs=22.8

Q ss_pred             CHHHHHHHHHHHHHHHCCCCEEEEEEE
Q ss_conf             556899999999985114212799998
Q gi|254781032|r   81 TAENIAIWIWKRLSTSLSILSSVRVYE  107 (118)
Q Consensus        81 T~Enia~~i~~~l~~~l~~l~~V~v~E  107 (118)
                      |+||+|+|||++++..+|...++.+..
T Consensus       104 t~E~i~~~i~~~l~~~~p~~~~~~~~~  130 (181)
T 1y13_A          104 VKNNIKIICEDNSEYSFPERDCIKLPI  130 (181)
T ss_dssp             ETTEEEEEETTSCEEEEEGGGEEEESC
T ss_pred             CCCCHHEEECCCCCCCCCCCCEEEECC
T ss_conf             023110010355200346640788357


No 11 
>>1oao_C CODH, carbon monoxide dehydrogenase alpha subunit; electron transfer, oxidoreductase, acetyl-COA formation, WOOD/ljungdahl pathway; 1.90A {Moorella thermoacetica} (C:325-497)
Probab=34.15  E-value=29  Score=16.52  Aligned_cols=70  Identities=19%  Similarity=0.235  Sum_probs=44.7

Q ss_pred             EEEEECCCCC--------CEEEEEHH--HHHHHHHHHHHHHHHHHCCCCCCCC-------------------CCCHHHHH
Q ss_conf             9999336887--------54886299--9999998887753133203355433-------------------66556899
Q gi|254781032|r   36 LVMEGDVDPK--------TGFVDDFF--NIEQYFSPLLEKLDHHCLNEIEELE-------------------NPTAENIA   86 (118)
Q Consensus        36 v~~~g~~~~~--------~G~viDf~--~lk~~~~~i~~~lDH~~Lnd~~~~~-------------------nPT~Enia   86 (118)
                      |++-||.+++        .|+++...  .++.-++++++.--|.++|-..++.                   .=+.+.|.
T Consensus        42 I~viGPDi~e~e~g~~~p~~iiv~vaG~~me~D~e~vlERr~h~~~ny~eG~Mh~~QRd~~WvRISK~A~~kG~~l~~iG  121 (173)
T 1oao_C           42 IEVIGPDIDQIPEGSKLPLGILVDIYGRKMQADFEGVLERRIHDFINYGEGLWHTGQRNINWLRVSKDAVAKGFRFKNYG  121 (173)
T ss_dssp             EEEESCCGGGSCTTEECCEEEEEEEECTTCCGGGHHHHHHHHHHHHHTBTTEEEEEETTEEEEEEEHHHHHHTCCTHHHH
T ss_pred             EEEECCCHHHCCCCCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHCEEEEECCCCEEEEEECHHHHHCCCCHHHHH
T ss_conf             89968885645667767549999850633562278999999988987505169833675389996278986698678899


Q ss_pred             HHHHHHHHHHCCC-CEEEEE
Q ss_conf             9999999851142-127999
Q gi|254781032|r   87 IWIWKRLSTSLSI-LSSVRV  105 (118)
Q Consensus        87 ~~i~~~l~~~l~~-l~~V~v  105 (118)
                      +-+..+++..+|. +.++.|
T Consensus       122 ~~l~~~~k~efp~vi~kv~V  141 (173)
T 1oao_C          122 EILVAKMKEEFPAIVDRVQV  141 (173)
T ss_dssp             HHHHHHHHHHSBTTBSEEEE
T ss_pred             HHHHHHHHHHHHHHHHEEEE
T ss_conf             99999998774645447899


No 12 
>>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} (A:1-143,A:373-418)
Probab=25.07  E-value=51  Score=15.24  Aligned_cols=50  Identities=26%  Similarity=0.444  Sum_probs=32.7

Q ss_pred             CCEEEEEHHHHHHHHHHHHHH-H-----HHHHCCCCCCCCCC-CHHHHHHHHHHHHH
Q ss_conf             754886299999999888775-3-----13320335543366-55689999999998
Q gi|254781032|r   45 KTGFVDDFFNIEQYFSPLLEK-L-----DHHCLNEIEELENP-TAENIAIWIWKRLS   94 (118)
Q Consensus        45 ~~G~viDf~~lk~~~~~i~~~-l-----DH~~Lnd~~~~~nP-T~Enia~~i~~~l~   94 (118)
                      +.|+++|...++.+++.+... +     +|..|-.-+.+..| .-|.++..+||.+.
T Consensus        79 ~~G~i~nwd~~e~l~~~~~~~~l~v~p~~~pilltEp~~~~~~~Rek~~EilFE~~~  135 (189)
T 1k8k_A           79 RHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFN  135 (189)
T ss_dssp             ETTEESCHHHHHHHHHHHHHTTTCCCGGGCCEEEEECTTCCHHHHHHHHHHHHHTSC
T ss_pred             CCCEECCHHHHHHHHHHHHHHCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCC
T ss_conf             388167899999999999765048798888379975899979999999999666577


No 13 
>>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoplasm, cytoskeleton, nucleotide-binding; HET: ATP; 3.78A {Schizosaccharomyces pombe} (A:1-173,A:382-427)
Probab=22.90  E-value=41  Score=15.71  Aligned_cols=50  Identities=26%  Similarity=0.450  Sum_probs=29.6

Q ss_pred             CCEEEEEHHHHHHHHHHHHHH-H-----HHHHCCCCCCCCCC-CHHHHHHHHHHHHH
Q ss_conf             754886299999999888775-3-----13320335543366-55689999999998
Q gi|254781032|r   45 KTGFVDDFFNIEQYFSPLLEK-L-----DHHCLNEIEELENP-TAENIAIWIWKRLS   94 (118)
Q Consensus        45 ~~G~viDf~~lk~~~~~i~~~-l-----DH~~Lnd~~~~~nP-T~Enia~~i~~~l~   94 (118)
                      +.|.++|...++.+++.+... +     +|..|-.-+.+-.| .-|.++..+||.+.
T Consensus        95 ~~G~v~dwd~~e~i~~~~~~~~l~~~p~e~pilltEp~~~~~~~Rek~~EilFE~f~  151 (219)
T 3dwl_A           95 RHGQIENWDHMERFWQQSLFKYLRCEPEDHYFLLTEPPLNPPENRENTAEIMFESFN  151 (219)
T ss_dssp             ETTEECCHHHHHHHHHHHHHTTSCCCGGGCEEEEEECTTCCHHHHHHHHHHHTTTTC
T ss_pred             CCCEECCHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHCCC
T ss_conf             489857899999999987445407684447245523766789999999999874168


No 14 
>>2cg8_A Dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase; lyase/transferase, folate biosynthesis, pyrophosphokinase, lyase; 2.9A {Streptococcus pneumoniae} (A:1-119)
Probab=22.15  E-value=63  Score=14.74  Aligned_cols=84  Identities=14%  Similarity=0.184  Sum_probs=56.0

Q ss_pred             EEEEECCEECCCCCCCCCCCCCCCCCEEEEEEEEECC-----CCCCEEEEEHHHHHHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             9999712122799987763567673489999999336-----88754886299999999888775313320335543366
Q gi|254781032|r    6 AFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDV-----DPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEELENP   80 (118)
Q Consensus         6 ~~~F~aaH~l~~~~~~~kc~~lHGH~y~v~v~~~g~~-----~~~~G~viDf~~lk~~~~~i~~~lDH~~Lnd~~~~~nP   80 (118)
                      ...|.+-|=+   ..   -++.+|-...+.+++.-+.     .+.-+-.+||..+-+.+..+++.           -.--
T Consensus         8 ~l~~~~~iGv---~~---~Er~~~Q~v~idl~~~~~~~~a~~~D~l~~tidY~~l~~~i~~~~~~-----------~~f~   70 (119)
T 2cg8_A            8 DLEMFAYHGL---FP---SEKELGQKFIVSAILSYDMTKAATDLDLTASVHYGELCQQWTTWFQE-----------TSED   70 (119)
T ss_dssp             EEEEEECCCS---SH---HHHHHCEEEEEEEEEEECCHHHHC-------CCHHHHHHHHHHHHHS-----------CCCS
T ss_pred             CEEEEEEECC---CH---HHHCCCCEEEEEEEEEECCCCCCCCCCCHHCCCHHHHHHHHHHHHHC-----------CCCC
T ss_conf             5699999697---98---99579986999999997440134566511120699999999999726-----------8804


Q ss_pred             CHHHHHHHHHHHHHHHCCCCEEEEEE
Q ss_conf             55689999999998511421279999
Q gi|254781032|r   81 TAENIAIWIWKRLSTSLSILSSVRVY  106 (118)
Q Consensus        81 T~Enia~~i~~~l~~~l~~l~~V~v~  106 (118)
                      +.|.+|..|.+.+....+.+.+|+|.
T Consensus        71 llE~la~~I~~~i~~~~~~v~~v~v~   96 (119)
T 2cg8_A           71 LIETVAYKLVERTFESYPLVQEMKLE   96 (119)
T ss_dssp             CHHHHHHHHHHHHHHHCTTCCEEEEE
T ss_pred             CHHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             19999999999999769971099999


Done!