HHsearch results for GI: 254781032 and protein with PDBid: 1b66_A

>1b66_A 6-pyruvoyl tetrahydropterin synthase; tetrahydrobiopterin biosynthesis, phosphate elimination, pterine synthesis; HET: BIO; 1.90A {Rattus rattus} SCOP: d.96.1.2 PDB: 1b6z_A 1gtq_A 3i2b_A
Probab=100.00  E-value=3.6e-44  Score=255.90  Aligned_cols=117  Identities=34%  Similarity=0.710  Sum_probs=109.0

Q ss_pred             CEEEEEEEEECCEECCCCCCC--------CCCCCC--CCCCEEEEEEEEECCCCCCEEEEEHHHHHHHHH-HHHHHHHHH
Q ss_conf             979999999712122799987--------763567--673489999999336887548862999999998-887753133
Q gi|254781032|r    1 MKITQAFTFEAAHRLPRVPKT--------HKCHRM--HGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS-PLLEKLDHH   69 (118)
Q Consensus         1 m~itk~~~F~aaH~l~~~~~~--------~kc~~l--HGH~y~v~v~~~g~~~~~~G~viDf~~lk~~~~-~i~~~lDH~   69 (118)
                      ++|||+++|+|||||+++.++        |||+++  |||||+|+|++.|+.+++.|||+||++||++++ +|+++|||+
T Consensus         7 ~~itk~~~F~AaHrl~~~~~s~~~n~~~~GkC~~~~~HGHty~veV~v~g~~~~~~GmviDf~~lk~~~~~~I~~~lDH~   86 (140)
T 1b66_A            7 ARLSRLVSFSASHRLHSPSLSAEENLKVFGKCNNPNGHGHNYKVVVTIHGEIDPVTGMVMNLTDLKEYMEEAIMKPLDHK   86 (140)
T ss_dssp             EEEEEEEEEEEEECCCCTTSCHHHHHHHHGGGGCTTCEEEEEEEEEEEEEECCTTTCCSSCHHHHHHHHHHHTHHHHTTE
T ss_pred             EEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEECCCCCEEEEHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999972436489887700066456667898898996799999996407878818789999999999887687640


Q ss_pred             HCC-CCCCCC--CCCHHHHHHHHHHHHHHHCC--CCEEEEEEECCCCEEEEEC
Q ss_conf             203-355433--66556899999999985114--2127999985995599750
Q gi|254781032|r   70 CLN-EIEELE--NPTAENIAIWIWKRLSTSLS--ILSSVRVYETPMSWVEYQG  117 (118)
Q Consensus        70 ~Ln-d~~~~~--nPT~Enia~~i~~~l~~~l~--~l~~V~v~Et~~~~a~Y~G  117 (118)
                      +|| ++|+|.  |||+||||+|||++|++.+|  .|.+|+|||||++||+|+|
T Consensus        87 ~Ln~~~p~~~~~~PTaE~lA~~i~~~l~~~l~~~~l~~V~v~Et~~~~a~Y~g  139 (140)
T 1b66_A           87 NLDLDVPYFADVVSTTENVAVYIWENLQRLLPVGALYKVKVYETDNNIVVYKG  139 (140)
T ss_dssp             EHHHHCGGGTSSCCCHHHHHHHHHHHHHHHSCTTCEEEEEEEEETTEEEEECC
T ss_pred             HCCCCCHHHCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCEEEEEC
T ss_conf             01243666605685089999999999985488363679999968998899938