HHsearch results for GI: 254781032 and protein with PDBid: 3jyg_A

>3jyg_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein structure initiative; 1.95A {Wolinella succinogenes}
Probab=100.00  E-value=1.3e-39  Score=231.56  Aligned_cols=116  Identities=29%  Similarity=0.444  Sum_probs=103.0

Q ss_pred             CEEEEEEEEECCEECCCCCC--------CCCCCCCCCCCEEEEEEEEECCCCCCEEEEEHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             97999999971212279998--------7763567673489999999336887548862999999998887753133203
Q gi|254781032|r    1 MKITQAFTFEAAHRLPRVPK--------THKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLN   72 (118)
Q Consensus         1 m~itk~~~F~aaH~l~~~~~--------~~kc~~lHGH~y~v~v~~~g~~~~~~G~viDf~~lk~~~~~i~~~lDH~~Ln   72 (118)
                      ++|+|+++|+|||||++..+        .|||+++|||||.|+|+++|+.++ .|||+||+++|+++++|++.|||++|+
T Consensus         5 ~~I~k~~~F~aaHrl~~~~~~~~~~~~~~gkC~~lHGH~y~v~V~l~g~~~d-~gmViDFg~lK~~~~~i~~~lDH~~L~   83 (188)
T 3jyg_A            5 YQIAKEFDFCYGHRVWSQELNPDFSLDPCLSCRHLHGHQGKVIVHLESRELQ-RGMVTDFAHLNWFKRFIDEVLDHRFII   83 (188)
T ss_dssp             EEEEEEEEEEEEECCTTCCCCHHHHSCCCCGGGSSEEEEEEEEEEEEESSCB-TTBSSCGGGGHHHHHHHHHHTTTEEEE
T ss_pred             EEEEEEEEEECCCCCCCCCCCHHHCCCCCCCCCCCCCCCEEEEEEEEEECCC-CCCEEEHHHHHHHHHHHHHHHCCCEEE
T ss_conf             9999999997711847876653224678887489618977999999976588-770889999999999999874710360


Q ss_pred             CCCC------------------------------------------------CCCCCHHHHHHHHHHHHHHHCC----CC
Q ss_conf             3554------------------------------------------------3366556899999999985114----21
Q gi|254781032|r   73 EIEE------------------------------------------------LENPTAENIAIWIWKRLSTSLS----IL  100 (118)
Q Consensus        73 d~~~------------------------------------------------~~nPT~Enia~~i~~~l~~~l~----~l  100 (118)
                      +..+                                                ..+||+|+||+||+++|++.++    .+
T Consensus        84 ~~~dp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pTaE~lA~~i~~~l~~~l~~~~v~~  163 (188)
T 3jyg_A           84 DIDDPLFPTLLPHFADKSALVWMEEGYARVDFERIKGESSPILELYESFVVVRFVPTSESIASWLLELLRSRIQPLGVKV  163 (188)
T ss_dssp             ETTCTTHHHHSGGGTTSCSEEECTTSEEEECGGGGTTCCHHHHHHHHHEEEESSCCCHHHHHHHHHHHHHHHCGGGTCEE
T ss_pred             CCCCHHHHHHHHHCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             56871566565421344200001234333210112221222113455147614896789999999999986436687299


Q ss_pred             EEEEEEECCCCEEEEEC
Q ss_conf             27999985995599750
Q gi|254781032|r  101 SSVRVYETPMSWVEYQG  117 (118)
Q Consensus       101 ~~V~v~Et~~~~a~Y~G  117 (118)
                      .+|+|||||++||+|+|
T Consensus       164 ~~V~v~Etp~~~A~y~~  180 (188)
T 3jyg_A          164 SSVEFLETPKSRARVYN  180 (188)
T ss_dssp             EEEEEEEETTEEEEEEE
T ss_pred             EEEEEEECCCCEEEEEE
T ss_conf             99999965994899982