BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781032|ref|YP_003065445.1| hypothetical protein
CLIBASIA_04670 [Candidatus Liberibacter asiaticus str. psy62]
         (118 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|115378962|ref|ZP_01466095.1| 6-pyruvoyl tetrahydropterin synthase family [Stigmatella aurantiaca
           DW4/3-1]
 gi|115364038|gb|EAU63140.1| 6-pyruvoyl tetrahydropterin synthase family [Stigmatella aurantiaca
           DW4/3-1]
          Length = 775

 Score =  162 bits (411), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 62/116 (53%), Positives = 83/116 (71%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I + FTFEAAHRLP VP  HKC R+HGHS+RVE+ + G V   +G++ DF ++++ F+P
Sbjct: 657 EIFKEFTFEAAHRLPNVPPGHKCFRLHGHSFRVEVHVRGPVSEPSGWIMDFADLKEAFTP 716

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           L  +LDH+ LNEIE L+NPT+EN+A WIW+RL   L  LS + V ET  S   YQG
Sbjct: 717 LHAQLDHNYLNEIEGLKNPTSENLARWIWQRLRPGLPQLSRIVVRETCTSGCVYQG 772


>gi|302558411|ref|ZP_07310753.1| queuosine biosynthesis protein QueD [Streptomyces griseoflavus
           Tu4000]
 gi|302476029|gb|EFL39122.1| queuosine biosynthesis protein QueD [Streptomyces griseoflavus
           Tu4000]
          Length = 118

 Score =  159 bits (404), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 86/117 (73%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + FTFEAAHRLPRVP+ HKC R+HGHSY+V + +E  VDP+ G+V DF +I+Q F 
Sbjct: 1   MEIFREFTFEAAHRLPRVPEGHKCARLHGHSYKVTVHVEAPVDPEAGWVMDFGDIKQAFK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+  +LDH  LN+IE LENPT+EN+A WIW R++  L  LS++ V ET  S   Y+G
Sbjct: 61  PIDAQLDHFYLNDIEGLENPTSENLARWIWDRMTAELPALSAITVRETCTSGCTYRG 117


>gi|85814033|emb|CAF31449.1| putative gentamicin production protein [Micromonospora echinospora]
          Length = 117

 Score =  158 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 86/117 (73%), Gaps = 1/117 (0%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + FTFEAAHRLP VP+ HKC R+HGHSYRV + + GDVDP+ G+V DF ++++ F 
Sbjct: 1   MEIFREFTFEAAHRLPNVPEGHKCARLHGHSYRVAVHVSGDVDPQAGWVMDFGDLKRAFE 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ ++LDHH LNE+  LENPT+E +A WIW RL+  L  LS+V V ET  S   Y+G
Sbjct: 61  PVRDQLDHHYLNEVPGLENPTSETLARWIWDRLADRLP-LSAVSVRETCTSGCVYRG 116


>gi|119504681|ref|ZP_01626760.1| queuosine biosynthesis protein QueD [marine gamma proteobacterium
           HTCC2080]
 gi|119459703|gb|EAW40799.1| queuosine biosynthesis protein QueD [marine gamma proteobacterium
           HTCC2080]
          Length = 118

 Score =  158 bits (399), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 84/117 (71%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M++ + F FEAAHRLP VP+ HKC R+HGHS+ V L + GDVDP TG++ DF +I+  F+
Sbjct: 1   MELYKDFRFEAAHRLPNVPEGHKCARLHGHSFLVRLTISGDVDPHTGWLMDFDDIKNAFA 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PLL++LDH+ LN++  LENPT+E +A WIW RL  +L  L+SV + ET      Y+G
Sbjct: 61  PLLDQLDHYYLNDVPGLENPTSEILAKWIWDRLKPNLPELASVEIRETCTVGCTYRG 117


>gi|254481594|ref|ZP_05094838.1| queuosine biosynthesis protein QueD [marine gamma proteobacterium
           HTCC2148]
 gi|214038222|gb|EEB78885.1| queuosine biosynthesis protein QueD [marine gamma proteobacterium
           HTCC2148]
          Length = 118

 Score =  156 bits (396), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 79/117 (67%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + F FEAAHRLP VP  HKC R+HGHS++V L + GD    +G+V DF  I+  F 
Sbjct: 1   MEIYKEFHFEAAHRLPNVPAGHKCARLHGHSFQVRLSVRGDALEPSGWVMDFGEIKSAFK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ E+LDH+ LN+I  LENPT+ENIA WIW+ L  +L  LS V + ET  S   Y+G
Sbjct: 61  PIYEQLDHYYLNDISGLENPTSENIARWIWQHLKPALPALSRVEIRETCTSGCIYEG 117


>gi|85813928|emb|CAF31557.1| putative fortimicin production protein [Micromonospora
           olivasterospora]
          Length = 118

 Score =  156 bits (396), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 86/117 (73%), Gaps = 1/117 (0%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + FTFEAAHRLP VP+ HKC R+HGHSYRV + + GDVDP +G+V DF ++++   
Sbjct: 1   MEIFREFTFEAAHRLPNVPEGHKCARLHGHSYRVTVHVSGDVDPHSGWVMDFGDLKKAVE 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ ++LDHH LNE+  LENPT+E +A WIW RL+ SL  LS+V V ET  S   Y+G
Sbjct: 61  PIRDRLDHHYLNEVPGLENPTSEVLARWIWDRLAGSLP-LSAVGVRETCTSGCVYRG 116


>gi|15597862|ref|NP_251356.1| 6-pyruvoyl tetrahydrobiopterin synthase [Pseudomonas aeruginosa
           PAO1]
 gi|107102187|ref|ZP_01366105.1| hypothetical protein PaerPA_01003238 [Pseudomonas aeruginosa PACS2]
 gi|116050653|ref|YP_790528.1| putative 6-pyruvoyl-tetrahydropterin synthase [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|152989185|ref|YP_001347897.1| queuosine biosynthesis protein QueD [Pseudomonas aeruginosa PA7]
 gi|218891172|ref|YP_002440038.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Pseudomonas
           aeruginosa LESB58]
 gi|254235648|ref|ZP_04928971.1| hypothetical protein PACG_01580 [Pseudomonas aeruginosa C3719]
 gi|254241094|ref|ZP_04934416.1| hypothetical protein PA2G_01780 [Pseudomonas aeruginosa 2192]
 gi|296388872|ref|ZP_06878347.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Pseudomonas
           aeruginosa PAb1]
 gi|313107707|ref|ZP_07793889.1| putative 6-pyruvoyl-tetrahydropterin synthase [Pseudomonas
           aeruginosa 39016]
 gi|9948737|gb|AAG06054.1|AE004695_7 probable 6-pyruvoyl tetrahydrobiopterin synthase [Pseudomonas
           aeruginosa PAO1]
 gi|115585874|gb|ABJ11889.1| putative 6-pyruvoyl-tetrahydropterin synthase [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|126167579|gb|EAZ53090.1| hypothetical protein PACG_01580 [Pseudomonas aeruginosa C3719]
 gi|126194472|gb|EAZ58535.1| hypothetical protein PA2G_01780 [Pseudomonas aeruginosa 2192]
 gi|150964343|gb|ABR86368.1| queuosine biosynthesis protein QueD [Pseudomonas aeruginosa PA7]
 gi|218771397|emb|CAW27164.1| probable 6-pyruvoyl tetrahydrobiopterin synthase [Pseudomonas
           aeruginosa LESB58]
 gi|310880391|gb|EFQ38985.1| putative 6-pyruvoyl-tetrahydropterin synthase [Pseudomonas
           aeruginosa 39016]
          Length = 118

 Score =  156 bits (395), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 64/117 (54%), Positives = 87/117 (74%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M++ + FTFE+AHRLP VP+ HKC R+HGHS+RV + +EG+VDP TG++ DF  I+  F 
Sbjct: 1   MELFKEFTFESAHRLPHVPEGHKCGRLHGHSFRVAIHIEGEVDPHTGWIRDFAEIKAIFK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ E+LDH+ LN+I  LENPT+EN+  WIW++L   L  LS VRV+ET  S  EY+G
Sbjct: 61  PIYEQLDHNYLNDIPGLENPTSENLCRWIWQQLKPLLPELSKVRVHETCTSGCEYRG 117


>gi|182679141|ref|YP_001833287.1| queuosine biosynthesis protein QueD [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182635024|gb|ACB95798.1| queuosine biosynthesis protein QueD [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 117

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 81/117 (69%), Positives = 91/117 (77%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MKITQAF FEAAHRLP+VP+ H+C  +HGHSYRVEL +EG VDP TGFV DFF+IE  F 
Sbjct: 1   MKITQAFHFEAAHRLPKVPEGHRCANLHGHSYRVELYLEGPVDPDTGFVIDFFDIEAVFG 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PLL +LDHH LNEIE LENPTAE IA+WIW R+  SL  L  V VYETP  W EY+G
Sbjct: 61  PLLHRLDHHYLNEIEGLENPTAELIAVWIWDRVKPSLPQLVKVIVYETPDCWAEYEG 117


>gi|319788059|ref|YP_004147534.1| hypothetical protein Psesu_2471 [Pseudoxanthomonas suwonensis 11-1]
 gi|317466571|gb|ADV28303.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Pseudoxanthomonas suwonensis 11-1]
          Length = 117

 Score =  155 bits (393), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 87/117 (74%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + FT EAAHRLP VP+ HKC R+HGHS+RVEL +EG VDP+ G+V DF +++  F 
Sbjct: 1   MEIFKVFTLEAAHRLPNVPQGHKCSRLHGHSFRVELHVEGPVDPQAGWVMDFADLKAAFK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PL E+LDHH LN+I  L+NPT+EN+A WIW +L  ++ +LS V V+ET  S   Y+G
Sbjct: 61  PLYEQLDHHYLNDIPGLDNPTSENLAAWIWDKLKPAVPLLSEVVVHETCTSGCRYRG 117


>gi|238919077|ref|YP_002932591.1| queuosine biosynthesis protein QueD, [Edwardsiella ictaluri 93-146]
 gi|238868645|gb|ACR68356.1| queuosine biosynthesis protein QueD, putative [Edwardsiella
           ictaluri 93-146]
          Length = 120

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 59/115 (51%), Positives = 82/115 (71%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAHRLP VP+ HKC R+HGHS+ V + + G+VDP TG+V DF +++  F P+
Sbjct: 5   LFKEFQFEAAHRLPHVPQGHKCGRLHGHSFLVRIEITGEVDPHTGWVMDFADLKARFQPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDHH LNE+  LENPT+E +A WIW +L   L +LS+VRV ET  +   Y+G
Sbjct: 65  YDQLDHHYLNEVAGLENPTSEVLARWIWDQLKPRLPLLSAVRVKETCTAGCTYRG 119


>gi|312113238|ref|YP_004010834.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311218367|gb|ADP69735.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 118

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 79/117 (67%), Positives = 93/117 (79%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MK+TQ+F FEAAHRLP V  TH C R+HGHSYRVEL +EG VDP+TGFV DFF+IE  F 
Sbjct: 1   MKVTQSFRFEAAHRLPFVKDTHPCRRVHGHSYRVELQLEGPVDPETGFVVDFFDIEAAFG 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PLL++LDH+ LNE+E LENPTAENIA WIW R+  +L  L++VRVYETP  W EY G
Sbjct: 61  PLLKRLDHYYLNEVEGLENPTAENIAAWIWDRVKDALPQLTAVRVYETPECWAEYNG 117


>gi|242238308|ref|YP_002986489.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Dickeya dadantii Ech703]
 gi|242130365|gb|ACS84667.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Dickeya dadantii Ech703]
          Length = 121

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 59/115 (51%), Positives = 81/115 (70%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAHRLP VP+ HKC R+HGHS+ V L + G+VDP TG+V DF  ++  F P+
Sbjct: 5   LFKDFQFEAAHRLPHVPEGHKCGRLHGHSFMVRLEVTGEVDPHTGWVMDFAELKAVFKPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDH+ LN+I  LENPT+E +A WIW++L  SL  LS+V V ET  +   Y+G
Sbjct: 65  WQRLDHYYLNDIPGLENPTSEVLAQWIWQQLKPSLPELSAVTVKETCTAGCVYRG 119


>gi|86742065|ref|YP_482465.1| putative 6-pyruvoyl tetrahydropterin synthase [Frankia sp. CcI3]
 gi|86568927|gb|ABD12736.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Frankia sp. CcI3]
          Length = 124

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 62/117 (52%), Positives = 84/117 (71%), Gaps = 1/117 (0%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + FTFEAAHRLP VP+ HKC R+HGHS+R+ + + G VDP+ G+V DF ++   F+
Sbjct: 1   MEIFREFTFEAAHRLPEVPEGHKCARLHGHSFRIAIQVVGPVDPRAGWVMDFADLRAAFA 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PL ++LDH  LNE+  L+NPT+EN+A WIW RL+  L  LS+V V ET  S   Y+G
Sbjct: 61  PLHDQLDHRYLNEVPGLDNPTSENLARWIWDRLAGELP-LSAVTVRETCTSGCIYRG 116


>gi|71737210|ref|YP_275300.1| 6-pyruvoyl tetrahydrobiopterin synthase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257485463|ref|ZP_05639504.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Pseudomonas
           syringae pv. tabaci ATCC 11528]
 gi|298487566|ref|ZP_07005608.1| 6-pyruvoyl tetrahydrobiopterin synthase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|71557763|gb|AAZ36974.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|298157950|gb|EFH99028.1| 6-pyruvoyl tetrahydrobiopterin synthase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320323810|gb|EFW79894.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Pseudomonas
           syringae pv. glycinea str. B076]
 gi|320327948|gb|EFW83953.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Pseudomonas
           syringae pv. glycinea str. race 4]
 gi|330883011|gb|EGH17160.1| 6-pyruvoyl tetrahydrobiopterin synthase [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330889637|gb|EGH22298.1| 6-pyruvoyl tetrahydrobiopterin synthase [Pseudomonas syringae pv.
           mori str. 301020]
 gi|330989769|gb|EGH87872.1| 6-pyruvoyl tetrahydrobiopterin synthase [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331010705|gb|EGH90761.1| 6-pyruvoyl tetrahydrobiopterin synthase [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 118

 Score =  154 bits (391), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 85/117 (72%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + FTFE+AHRLP VP+ HKC R+HGHS+RV + + G VDP TG++ DF  I+  F 
Sbjct: 1   MEIFKEFTFESAHRLPHVPEGHKCGRLHGHSFRVGIHLAGKVDPHTGWIRDFSEIKAIFK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PL E+LDH+ LN+I  LENPT+EN+A WIW  L   L  LS+VR++ET  S  EY+G
Sbjct: 61  PLYERLDHNYLNDIPGLENPTSENLAKWIWDELKPLLPELSAVRIHETCTSGCEYRG 117


>gi|126031480|pdb|2OBA|A Chain A, Pseudomonas Aeruginosa 6-Pyruvoyl Tetrahydrobiopterin
           Synthase
 gi|126031481|pdb|2OBA|B Chain B, Pseudomonas Aeruginosa 6-Pyruvoyl Tetrahydrobiopterin
           Synthase
 gi|126031482|pdb|2OBA|C Chain C, Pseudomonas Aeruginosa 6-Pyruvoyl Tetrahydrobiopterin
           Synthase
 gi|126031483|pdb|2OBA|D Chain D, Pseudomonas Aeruginosa 6-Pyruvoyl Tetrahydrobiopterin
           Synthase
 gi|126031484|pdb|2OBA|E Chain E, Pseudomonas Aeruginosa 6-Pyruvoyl Tetrahydrobiopterin
           Synthase
 gi|126031485|pdb|2OBA|F Chain F, Pseudomonas Aeruginosa 6-Pyruvoyl Tetrahydrobiopterin
           Synthase
          Length = 138

 Score =  154 bits (391), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 63/116 (54%), Positives = 86/116 (74%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ + FTFE+AHRLP VP+ HKC R+HGHS+RV + +EG+VDP TG++ DF  I+  F P
Sbjct: 22  ELFKEFTFESAHRLPHVPEGHKCGRLHGHSFRVAIHIEGEVDPHTGWIRDFAEIKAIFKP 81

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           + E+LDH+ LN+I  LENPT+EN+  WIW++L   L  LS VRV+ET  S  EY+G
Sbjct: 82  IYEQLDHNYLNDIPGLENPTSENLCRWIWQQLKPLLPELSKVRVHETCTSGCEYRG 137


>gi|254781032|ref|YP_003065445.1| hypothetical protein CLIBASIA_04670 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040709|gb|ACT57505.1| hypothetical protein CLIBASIA_04670 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 118

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 118/118 (100%), Positives = 118/118 (100%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS
Sbjct: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQGF 118
           PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQGF
Sbjct: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQGF 118


>gi|119475910|ref|ZP_01616262.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [marine gamma
           proteobacterium HTCC2143]
 gi|119450537|gb|EAW31771.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [marine gamma
           proteobacterium HTCC2143]
          Length = 118

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 63/117 (53%), Positives = 84/117 (71%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + FTFEAAH LP VP  HKC R+HGHS+   + + GDVDP+TG++ DF  ++ +F+
Sbjct: 1   MEIYKEFTFEAAHLLPNVPDGHKCGRLHGHSFMARIYVSGDVDPRTGWIIDFSELKAHFA 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ ++LDH+ LN+IE LENPT+EN+A WIW RL   L ILS V + ET  S   YQG
Sbjct: 61  PIYQQLDHYYLNDIEGLENPTSENLARWIWNRLKADLPILSKVEIRETCTSGCIYQG 117


>gi|310818261|ref|YP_003950619.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Stigmatella
           aurantiaca DW4/3-1]
 gi|309391333|gb|ADO68792.1| Putative 6-pyruvoyl tetrahydrobiopterin synthase [Stigmatella
           aurantiaca DW4/3-1]
          Length = 129

 Score =  154 bits (390), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 62/116 (53%), Positives = 83/116 (71%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I + FTFEAAHRLP VP  HKC R+HGHS+RVE+ + G V   +G++ DF ++++ F+P
Sbjct: 11  EIFKEFTFEAAHRLPNVPPGHKCFRLHGHSFRVEVHVRGPVSEPSGWIMDFADLKEAFTP 70

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           L  +LDH+ LNEIE L+NPT+EN+A WIW+RL   L  LS + V ET  S   YQG
Sbjct: 71  LHAQLDHNYLNEIEGLKNPTSENLARWIWQRLRPGLPQLSRIVVRETCTSGCVYQG 126


>gi|88704913|ref|ZP_01102625.1| 6-pyruvoyl tetrahydrobiopterin synthase [Congregibacter litoralis
           KT71]
 gi|88700608|gb|EAQ97715.1| 6-pyruvoyl tetrahydrobiopterin synthase [Congregibacter litoralis
           KT71]
          Length = 122

 Score =  154 bits (390), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 55/117 (47%), Positives = 83/117 (70%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + F FEAAHRLP+VP  HKC R+HGHS+++ + +EG+    +G++ DF +I+    
Sbjct: 1   MEIFKDFHFEAAHRLPQVPPGHKCERLHGHSFQLRVYVEGEPGATSGWIMDFGDIKAACK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P++E+LDH+ LN+IE LENPT+EN+  WIW R+  +L  LS++ + ET  S   Y+G
Sbjct: 61  PVIEQLDHYYLNDIEGLENPTSENLCRWIWDRVLPALPELSAIEIRETCTSGCIYRG 117


>gi|86750981|ref|YP_487477.1| putative 6-pyruvoyl tetrahydropterin synthase [Rhodopseudomonas
           palustris HaA2]
 gi|86574009|gb|ABD08566.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Rhodopseudomonas palustris HaA2]
          Length = 122

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 81/117 (69%), Positives = 92/117 (78%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MKITQAF FEAAH+LP VP+TH+C RMHGHSYRVEL + G ++P TGFV DFF IE  F 
Sbjct: 1   MKITQAFRFEAAHQLPNVPETHRCRRMHGHSYRVELQLSGPINPTTGFVLDFFEIEAAFG 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PLL +LDH+CLN+IE LENPTAENIAIWIW R    L  LS+VRVYETP  W +Y G
Sbjct: 61  PLLARLDHYCLNDIEGLENPTAENIAIWIWDRTKPGLPALSNVRVYETPDCWADYAG 117


>gi|289675465|ref|ZP_06496355.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Pseudomonas
           syringae pv. syringae FF5]
 gi|330900647|gb|EGH32066.1| putative 6-pyruvoyl tetrahydropterin synthase [Pseudomonas syringae
           pv. japonica str. M301072PT]
 gi|330944590|gb|EGH46544.1| 6-pyruvoyl tetrahydrobiopterin synthase [Pseudomonas syringae pv.
           pisi str. 1704B]
 gi|330954539|gb|EGH54799.1| putative 6-pyruvoyl tetrahydropterin synthase [Pseudomonas syringae
           Cit 7]
 gi|330981349|gb|EGH79452.1| putative 6-pyruvoyl tetrahydropterin synthase [Pseudomonas syringae
           pv. aptata str. DSM 50252]
          Length = 118

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 85/117 (72%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + FTFE+AHRLP VP+ HKC R+HGHS+RV + + G VDP TG++ DF  I+  F 
Sbjct: 1   MEIFKEFTFESAHRLPHVPEGHKCGRLHGHSFRVGIHLAGKVDPHTGWIRDFSEIKAIFK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PL E+LDH+ LN+I  LENPT+EN+A WIW  L   L  LS+VR++ET  S  EY+G
Sbjct: 61  PLYERLDHNYLNDIPGLENPTSENLAKWIWNELKPLLPELSAVRIHETCTSGCEYRG 117


>gi|170720968|ref|YP_001748656.1| queuosine biosynthesis protein QueD [Pseudomonas putida W619]
 gi|169758971|gb|ACA72287.1| queuosine biosynthesis protein QueD [Pseudomonas putida W619]
          Length = 118

 Score =  154 bits (389), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 62/117 (52%), Positives = 83/117 (70%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + FTFE+AHRLP VP  HKC R+HGHS++V L + G +DP TG++ DF  I+  F 
Sbjct: 1   MEIFKEFTFESAHRLPNVPAGHKCGRLHGHSFKVGLHLTGPLDPHTGWIRDFSEIKAIFK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ E+LDH+ LN+I  LENPT+E IA WIW+++   L  LS VR++ET  S  EY G
Sbjct: 61  PIYEQLDHNYLNDIPGLENPTSEVIAKWIWEQVKPLLPELSKVRIHETCTSGCEYSG 117


>gi|190572657|ref|YP_001970502.1| putative 6-pyruvoyl tetrahydrobiopterin synthase family protein
           [Stenotrophomonas maltophilia K279a]
 gi|190010579|emb|CAQ44188.1| putative 6-pyruvoyl tetrahydrobiopterin synthase family protein
           [Stenotrophomonas maltophilia K279a]
          Length = 120

 Score =  154 bits (389), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 83/117 (70%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + F  EAAHRLP VP  HKC R+HGHS+RVEL +EG+   +TG++ DF +++  F 
Sbjct: 1   MEIFKVFMLEAAHRLPNVPPGHKCARLHGHSFRVELKVEGEPGAQTGWIMDFGDVKAAFQ 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ ++LDHH LN+I  LENPT+EN+A+WIW  L  SL  LS + V+ET  S   Y+G
Sbjct: 61  PIYDRLDHHYLNDIPGLENPTSENLAVWIWNELKPSLPALSEITVHETCTSGCRYRG 117


>gi|297183267|gb|ADI19405.1| 6-pyruvoyl-tetrahydropterin synthase [uncultured Pseudomonadales
           bacterium HF0500_12O04]
          Length = 118

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 85/117 (72%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + FTFE+AHRLP VP+ HKC R+HGHS++V + + GD+DP TG++ DF  I+  F 
Sbjct: 1   MEIFKEFTFESAHRLPFVPEGHKCGRLHGHSFKVAIHLSGDIDPATGWIRDFSEIKAIFK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PL E+LDH+ LN+I  LENPT+E +A WIW++L   L  LS++R++ET  S   Y G
Sbjct: 61  PLYEQLDHNYLNDIPGLENPTSEVLAKWIWQQLKPLLPELSAIRIHETCTSGCIYYG 117


>gi|269138403|ref|YP_003295103.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Edwardsiella
           tarda EIB202]
 gi|267984063|gb|ACY83892.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Edwardsiella
           tarda EIB202]
 gi|304558430|gb|ADM41094.1| Queuosine biosynthesis QueD [Edwardsiella tarda FL6-60]
          Length = 120

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 60/115 (52%), Positives = 82/115 (71%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAHRLP VP+ HKC R+HGHS+ V + + G+VDP TG+V DF +++  F P+
Sbjct: 5   LFKEFQFEAAHRLPHVPQGHKCGRLHGHSFLVRIEITGEVDPYTGWVMDFADLKARFQPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDHH LNEI  LENPT+E +A WIW +L   L +LS+VRV ET  +   Y+G
Sbjct: 65  YDQLDHHYLNEIAGLENPTSEVLARWIWDQLKPCLPLLSAVRVKETCTAGCTYRG 119


>gi|108763260|ref|YP_634985.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Myxococcus
           xanthus DK 1622]
 gi|108467140|gb|ABF92325.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Myxococcus
           xanthus DK 1622]
          Length = 120

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 68/117 (58%), Positives = 84/117 (71%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M I + FTFEAAHRLP VP  HKC R+HGHSYRVE+ + G V  ++G+V DF +I++ F 
Sbjct: 1   MDIFKEFTFEAAHRLPNVPPGHKCSRLHGHSYRVEIHVRGPVGSQSGWVMDFSDIKEAFE 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PL  KLDH+ LNE+E LENPT+EN++ WIWKRL   L +LS V V ET  S   YQG
Sbjct: 61  PLRLKLDHYYLNEVEGLENPTSENLSRWIWKRLRPGLPLLSRVVVRETCTSGCIYQG 117


>gi|330503683|ref|YP_004380552.1| putative 6-pyruvoyl tetrahydropterin synthase [Pseudomonas
           mendocina NK-01]
 gi|328917969|gb|AEB58800.1| putative 6-pyruvoyl tetrahydropterin synthase [Pseudomonas
           mendocina NK-01]
          Length = 118

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 85/117 (72%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M++ + F FEAAHRLP VP+ HKC R+HGHS+RV + +EG+VDP TG++ DF  I+  F 
Sbjct: 1   MELFKEFIFEAAHRLPHVPEGHKCGRLHGHSFRVAIYIEGEVDPHTGWIRDFSEIKAIFK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+  +LDH+ LN+I  LENPT+E +A WIW+++   L  LS VR++ET  S  EY+G
Sbjct: 61  PIYGQLDHNYLNDIPGLENPTSEVLAKWIWQQVKPLLPELSRVRIHETCTSGCEYRG 117


>gi|90417045|ref|ZP_01224973.1| 6-pyruvoyl tetrahydrobiopterin synthase [marine gamma
           proteobacterium HTCC2207]
 gi|90331061|gb|EAS46317.1| 6-pyruvoyl tetrahydrobiopterin synthase [marine gamma
           proteobacterium HTCC2207]
          Length = 117

 Score =  153 bits (388), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 58/117 (49%), Positives = 85/117 (72%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + F+ EAAHRLP VP+ HKC R+HGHS+ V + +EG V  ++G++ DF +I+  F+
Sbjct: 1   MQIYKEFSIEAAHRLPNVPEGHKCSRLHGHSFLVTVAVEGPVGEQSGWIMDFGDIKAAFA 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ ++LDHH LN+I+ LENPT+EN+AIWIW+ L   L +LS + + ET  S   Y+G
Sbjct: 61  PIYDQLDHHYLNDIDGLENPTSENLAIWIWQHLKPVLPLLSCITIKETCTSGCVYRG 117


>gi|330958137|gb|EGH58397.1| 6-pyruvoyl tetrahydrobiopterin synthase [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 118

 Score =  153 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 86/117 (73%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + FTFE+AH LP VP+ HKC R+HGHS+RV + + G VDP TG++ DF  I+  F 
Sbjct: 1   MEIFKEFTFESAHLLPNVPEGHKCGRLHGHSFRVGIHLAGKVDPHTGWIRDFSEIKAIFK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PL E+LDHH LN+I  LENPT+EN+A WIW++L   L  LS+VR++ET  S  EY+G
Sbjct: 61  PLYERLDHHYLNDIPGLENPTSENLAKWIWEKLKPLLPELSAVRIHETCTSGCEYRG 117


>gi|66046444|ref|YP_236285.1| putative 6-pyruvoyl tetrahydropterin synthase [Pseudomonas syringae
           pv. syringae B728a]
 gi|63257151|gb|AAY38247.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Pseudomonas syringae pv. syringae B728a]
          Length = 118

 Score =  153 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 85/117 (72%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + FTFE+AHRLP VP+ HKC R+HGHS+RV + + G VDP TG++ DF  I+  F 
Sbjct: 1   MEIFKEFTFESAHRLPHVPEGHKCGRLHGHSFRVGIHLAGKVDPHTGWIRDFSEIKAIFK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PL E+LDH+ LN+I  LENPT+EN+A WIW  L   L  LS+VR++ET  S  EY+G
Sbjct: 61  PLYERLDHNYLNDIPGLENPTSENLAKWIWSELKPLLPELSAVRIHETCTSGCEYRG 117


>gi|194364254|ref|YP_002026864.1| queuosine biosynthesis protein QueD [Stenotrophomonas maltophilia
           R551-3]
 gi|194347058|gb|ACF50181.1| queuosine biosynthesis protein QueD [Stenotrophomonas maltophilia
           R551-3]
          Length = 120

 Score =  153 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 83/117 (70%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + F  EAAHRLP VP  HKC R+HGHS+RVEL +EG+   +TG++ DF +++  F 
Sbjct: 1   MEIFKVFMLEAAHRLPNVPPGHKCARLHGHSFRVELKVEGEPGAQTGWIMDFGDVKAAFQ 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ ++LDHH LN+I  LENPT+EN+A+WIW  L  SL  LS + V+ET  S   Y+G
Sbjct: 61  PIYDRLDHHYLNDIPGLENPTSENLAVWIWNELKPSLPALSEITVHETCTSGCRYRG 117


>gi|104781054|ref|YP_607552.1| 6-pyruvoyl tetrahydrobiopterin synthase SscR [Pseudomonas
           entomophila L48]
 gi|95110041|emb|CAK14746.1| putative 6-pyruvoyl tetrahydrobiopterin synthase SscR [Pseudomonas
           entomophila L48]
          Length = 118

 Score =  153 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 62/117 (52%), Positives = 83/117 (70%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + FTFE+AHRLP VP  HKC R+HGHS++V L + G +DP TG++ DF  I+  F 
Sbjct: 1   MEIFKEFTFESAHRLPNVPAGHKCGRLHGHSFKVALHLTGPLDPHTGWIRDFSEIKAIFK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ E+LDH+ LN+I  LENPT+E IA WIW+++   L  LS VR++ET  S  EY G
Sbjct: 61  PIYEQLDHNYLNDIPGLENPTSEVIAKWIWEQVKPLLPELSKVRIHETCTSGCEYTG 117


>gi|254522611|ref|ZP_05134666.1| queuosine biosynthesis protein QueD [Stenotrophomonas sp. SKA14]
 gi|219720202|gb|EED38727.1| queuosine biosynthesis protein QueD [Stenotrophomonas sp. SKA14]
          Length = 120

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 62/117 (52%), Positives = 83/117 (70%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + F  EAAHRLP VP  HKC R+HGHS+RVEL +EG+   +TG++ DF +++  F 
Sbjct: 1   MEIFKVFMLEAAHRLPNVPPGHKCARLHGHSFRVELKVEGEPGAQTGWIMDFGDVKAAFQ 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ E+LDHH LN+I  LENPT+EN+A+WIW  L  SL  LS + V+ET  S   Y+G
Sbjct: 61  PIYERLDHHYLNDIPGLENPTSENLAVWIWNELKPSLPALSEITVHETCTSGCRYRG 117


>gi|329893797|ref|ZP_08269885.1| Queuosine biosynthesis QueD, PTPS-I [gamma proteobacterium
           IMCC3088]
 gi|328923520|gb|EGG30834.1| Queuosine biosynthesis QueD, PTPS-I [gamma proteobacterium
           IMCC3088]
          Length = 122

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 53/117 (45%), Positives = 81/117 (69%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + F FEAAHRLP VPK HKC R+HGHS+++ + + GD  P   ++ DF ++++  +
Sbjct: 1   MQIYKDFHFEAAHRLPNVPKGHKCARLHGHSFQLRITVAGDAPPPMNWIMDFGDLKKVVN 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P++++LDH+ LN+I  LENPT+E +  W+W++LS SL  L S+ + ET  S   Y G
Sbjct: 61  PIIDQLDHYYLNDIPGLENPTSERLCEWLWEKLSPSLPQLYSIELKETCTSGCLYTG 117


>gi|237797230|ref|ZP_04585691.1| 6-pyruvoyl tetrahydrobiopterin synthase [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331020080|gb|EGI00137.1| 6-pyruvoyl tetrahydrobiopterin synthase [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 118

 Score =  153 bits (387), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 64/117 (54%), Positives = 84/117 (71%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + FTFE+AH LP VP+ HKC R+HGHS+RV + + G VDP TG++ DF  I+  F 
Sbjct: 1   MEIFKEFTFESAHLLPNVPEGHKCGRLHGHSFRVGIHLAGKVDPHTGWIRDFSEIKAIFK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PL E+LDHH LN+I  LENPT+EN+A WIW  L   L  LS++R++ET  S  EY+G
Sbjct: 61  PLYERLDHHYLNDIPGLENPTSENLAKWIWDELKPLLPELSAIRIHETCTSGCEYRG 117


>gi|146307018|ref|YP_001187483.1| putative 6-pyruvoyl tetrahydropterin synthase [Pseudomonas
           mendocina ymp]
 gi|145575219|gb|ABP84751.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Pseudomonas mendocina ymp]
          Length = 118

 Score =  153 bits (387), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 63/117 (53%), Positives = 86/117 (73%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M++ + F FEAAHRLP VP+ HKC R+HGHS+RV L +EG+VDP TG++ DF  I+  F 
Sbjct: 1   MELFKEFIFEAAHRLPHVPEGHKCGRLHGHSFRVALYIEGEVDPYTGWIRDFSEIKAIFK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ E+LDH+ LN+I  LENPT+E +A WIW+++   L  LS VR++ET  S  EY+G
Sbjct: 61  PIYEQLDHNYLNDIPGLENPTSEVLAKWIWQQVKPLLPELSRVRIHETCTSGCEYRG 117


>gi|271501833|ref|YP_003334859.1| 6-pyruvoyl tetrahydropterin synthase [Dickeya dadantii Ech586]
 gi|270345388|gb|ACZ78153.1| 6-pyruvoyl tetrahydropterin synthase [Dickeya dadantii Ech586]
          Length = 122

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 61/115 (53%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAHRLP VP  HKC R+HGHS+ V L + G+VDP TG+V DF  ++  F P 
Sbjct: 5   LFKDFQFEAAHRLPHVPDGHKCGRLHGHSFMVRLEITGEVDPYTGWVMDFAELKAAFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LNEI  LENPT+E +A WIW++L  +L +LS+V V ET  +   Y+G
Sbjct: 65  WERLDHHYLNEIPGLENPTSEVLARWIWQQLKPTLPLLSAVTVKETCTAGCIYRG 119


>gi|146282665|ref|YP_001172818.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Pseudomonas
           stutzeri A1501]
 gi|145570870|gb|ABP79976.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Pseudomonas
           stutzeri A1501]
          Length = 140

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 64/116 (55%), Positives = 83/116 (71%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I + FTFE+AHRLP VP+ HKC R+HGHS+RV L + G VDP TG++ DF  ++  F P
Sbjct: 24  EIFKEFTFESAHRLPHVPQGHKCGRLHGHSFRVALYISGPVDPHTGWIRDFGELKSIFKP 83

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           L E+LDH+ LN+I  LENPT+EN+A WIW  L   L  LS VR++ET  S  EY+G
Sbjct: 84  LYERLDHNYLNDIPGLENPTSENLAKWIWNELKPLLPELSRVRIHETCTSGCEYRG 139


>gi|254514629|ref|ZP_05126690.1| queuosine biosynthesis protein QueD [gamma proteobacterium NOR5-3]
 gi|219676872|gb|EED33237.1| queuosine biosynthesis protein QueD [gamma proteobacterium NOR5-3]
          Length = 117

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 56/117 (47%), Positives = 81/117 (69%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + F FEAAHRLP+VP  HKC R+HGHS+++ + + G+    TG++ DF +I+    
Sbjct: 1   MEIFKDFHFEAAHRLPKVPAGHKCERLHGHSFQLRVYVAGEPGEATGWIMDFGDIKAACK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P++ +LDH+ LN+IE LENPT+EN+  WIW+RL  +L  LS V + ET  S   Y+G
Sbjct: 61  PVIAQLDHYYLNDIEGLENPTSENLCRWIWERLLPALPTLSGVEIRETCTSGCVYRG 117


>gi|285019481|ref|YP_003377192.1| 6-pyruvoyltetrahydropterin synthase [Xanthomonas albilineans GPE
           PC73]
 gi|283474699|emb|CBA17198.1| probable 6-pyruvoyltetrahydropterin synthase protein [Xanthomonas
           albilineans]
          Length = 120

 Score =  153 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 68/117 (58%), Positives = 86/117 (73%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M I + FT EAAHRLP VP  HKC R+HGHS+RVEL + G+ DP+TG++ DF +I+  F 
Sbjct: 1   MDIFKVFTLEAAHRLPNVPPGHKCARLHGHSFRVELHVSGEPDPETGWLVDFGDIKAAFL 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PL E+LDHH LN+IE LENPT+E +A+WIW+RL   L ILS V V+ET  S   Y+G
Sbjct: 61  PLYEQLDHHYLNDIEGLENPTSERLAVWIWERLKPVLPILSEVVVHETCTSGCRYRG 117


>gi|289626743|ref|ZP_06459697.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Pseudomonas
           syringae pv. aesculi str. NCPPB3681]
 gi|289648662|ref|ZP_06480005.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Pseudomonas
           syringae pv. aesculi str. 2250]
 gi|330870525|gb|EGH05234.1| 6-pyruvoyl tetrahydrobiopterin synthase [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 118

 Score =  153 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 84/117 (71%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + FTFE+AHRLP VP+ HKC R+HGHS+RV + + G VDP TG++ DF  I+  F 
Sbjct: 1   MEIFKEFTFESAHRLPHVPEGHKCGRLHGHSFRVGIHLAGKVDPHTGWIRDFSEIKAIFK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PL E+LDH+ LN+I  LENPT+EN+A WIW  L   L  LS VR++ET  S  EY+G
Sbjct: 61  PLYERLDHNYLNDIPGLENPTSENLAKWIWDELKPLLPELSVVRIHETCTSGCEYRG 117


>gi|307132358|ref|YP_003884374.1| 6-carboxy-5,6,7,8-tetrahydropterin synthase [Dickeya dadantii 3937]
 gi|306529887|gb|ADM99817.1| 6-carboxy-5,6,7,8-tetrahydropterin synthase [Dickeya dadantii 3937]
          Length = 122

 Score =  153 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 60/115 (52%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAHRLP VP  HKC R+HGHS+ V L + G+VDP TG+V DF  ++  F P 
Sbjct: 5   LFKDFQFEAAHRLPHVPNGHKCGRLHGHSFMVRLEITGEVDPYTGWVMDFAELKAAFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+I  LENPT+E +A WIW++L  +L +LS+V V ET  +   Y+G
Sbjct: 65  WERLDHHYLNDIPGLENPTSEVLARWIWQQLKPTLPLLSAVTVKETCTAGCVYRG 119


>gi|330971678|gb|EGH71744.1| putative 6-pyruvoyl tetrahydropterin synthase [Pseudomonas syringae
           pv. aceris str. M302273PT]
          Length = 118

 Score =  152 bits (385), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 64/117 (54%), Positives = 85/117 (72%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + FTFE+AHRLP VP+ HKC R+HGHS+RV + + G VDP TG++ DF  I+  F 
Sbjct: 1   MEIFKEFTFESAHRLPHVPEGHKCGRLHGHSFRVGIHLAGKVDPHTGWIRDFSEIKVIFK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PL E+LDH+ LN+I  L+NPT+EN+A WIW  L   L  LS+VR++ET  S  EY+G
Sbjct: 61  PLYERLDHNYLNDIPGLDNPTSENLAKWIWNELKPLLPELSAVRIHETCTSGCEYRG 117


>gi|312960049|ref|ZP_07774562.1| 6-pyruvoyl tetrahydropterin synthase [Pseudomonas fluorescens WH6]
 gi|311285706|gb|EFQ64274.1| 6-pyruvoyl tetrahydropterin synthase [Pseudomonas fluorescens WH6]
          Length = 118

 Score =  152 bits (385), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 83/117 (70%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + FTFE+AHRLP VP  HKC R+HGHS++V + + GD+DP TG++ DF  I+  F 
Sbjct: 1   MEIFKEFTFESAHRLPHVPDGHKCGRLHGHSFKVAIHLSGDLDPHTGWIRDFSEIKAIFK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PL E+LDH+ LN+I  LENPT+E +A WIW  L   L  LS++R++ET  S   Y+G
Sbjct: 61  PLYERLDHNYLNDIPGLENPTSEVLAKWIWNELKPLLPELSAIRIHETCTSGCIYRG 117


>gi|325915752|ref|ZP_08178054.1| queuosine biosynthesis protein QueD [Xanthomonas vesicatoria ATCC
           35937]
 gi|325538016|gb|EGD09710.1| queuosine biosynthesis protein QueD [Xanthomonas vesicatoria ATCC
           35937]
          Length = 122

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 62/117 (52%), Positives = 82/117 (70%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M I + FT EAAHRLP VP  HKC R+HGHS+RVEL + G+    TG++ DF +I+  F 
Sbjct: 6   MDIFKVFTLEAAHRLPNVPPGHKCARLHGHSFRVELHVSGEPGADTGWIMDFGDIKAAFK 65

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ ++LDHH LN+IE LENPT+E +AIWIW +L  +L  LS + V+ET  S   Y+G
Sbjct: 66  PIYDRLDHHYLNDIEGLENPTSERLAIWIWDQLKPALPQLSEIVVHETCTSGCRYRG 122


>gi|302185044|ref|ZP_07261717.1| putative 6-pyruvoyl tetrahydropterin synthase [Pseudomonas syringae
           pv. syringae 642]
          Length = 134

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 64/116 (55%), Positives = 84/116 (72%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I + FTFE+AHRLP VP+ HKC R+HGHS+RV + + G VDP TG++ DF  I+  F P
Sbjct: 18  EIFKEFTFESAHRLPHVPEGHKCGRLHGHSFRVGIHLAGKVDPHTGWIRDFSEIKAIFKP 77

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           L E+LDH+ LN+I  LENPT+EN+A WIW  L   L  LS+VR++ET  S  EY+G
Sbjct: 78  LYERLDHNYLNDIPGLENPTSENLAKWIWNELKPLLPELSAVRIHETCTSGCEYRG 133


>gi|170748386|ref|YP_001754646.1| queuosine biosynthesis protein QueD [Methylobacterium radiotolerans
           JCM 2831]
 gi|170654908|gb|ACB23963.1| queuosine biosynthesis protein QueD [Methylobacterium radiotolerans
           JCM 2831]
          Length = 118

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 87/117 (74%), Positives = 96/117 (82%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MKITQAFTFEAAHRLP VP+TH+CHRMHGHSYRVEL + G VDP+TG+V DF++IE  F 
Sbjct: 1   MKITQAFTFEAAHRLPNVPETHRCHRMHGHSYRVELTVAGPVDPRTGWVIDFYDIESIFG 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PLL +LDHHCLNEIE LENPTAENIA WIW RL   L  L+ VRV ETPMSW EY G
Sbjct: 61  PLLARLDHHCLNEIEGLENPTAENIAAWIWHRLRPDLPGLALVRVAETPMSWAEYDG 117


>gi|226944934|ref|YP_002800007.1| 6-pyruvoyltetrahydropterin synthase [Azotobacter vinelandii DJ]
 gi|226719861|gb|ACO79032.1| 6-pyruvoyltetrahydropterin synthase [Azotobacter vinelandii DJ]
          Length = 118

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 67/117 (57%), Positives = 88/117 (75%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M++ + F FEAAHRLPRVP  HKC R+HGHS+RV + +EG+VDP TG++ DF  I++ F 
Sbjct: 1   MELFKEFVFEAAHRLPRVPAGHKCGRLHGHSFRVAIYIEGEVDPHTGWIRDFSEIKEIFK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ E+LDHH LNEIE LENPT+E +A WIW++L   L  LS VR++ET  S  EY+G
Sbjct: 61  PIYERLDHHYLNEIEGLENPTSEILAKWIWRQLKPLLPELSRVRIHETCTSGCEYRG 117


>gi|229589614|ref|YP_002871733.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Pseudomonas
           fluorescens SBW25]
 gi|229361480|emb|CAY48356.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Pseudomonas
           fluorescens SBW25]
          Length = 118

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 84/117 (71%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + FTFE+AHRLP VP+ HKC R+HGHS++V + + GD+DP TG++ DF  I+  F 
Sbjct: 1   MEIFKEFTFESAHRLPHVPEGHKCGRLHGHSFKVAIHLSGDLDPHTGWIRDFSEIKAIFK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PL E+LDH+ LN+I  LENPT+E +A WIW  L   L  LS++R++ET  S   Y+G
Sbjct: 61  PLYERLDHNYLNDIPGLENPTSEVLAKWIWNELKPLLPELSAIRIHETCTSGCIYRG 117


>gi|149278923|ref|ZP_01885057.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Pedobacter sp.
           BAL39]
 gi|149230202|gb|EDM35587.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Pedobacter sp.
           BAL39]
          Length = 117

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 49/117 (41%), Positives = 81/117 (69%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M I + F+F++AH LP VP +HKC RMHGH+Y++ + + G  DP +G+V DF ++++   
Sbjct: 1   MIIYKKFSFDSAHYLPLVPASHKCGRMHGHTYQLTVYLSGTPDPHSGWVADFGDLKRGIQ 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P ++ LDH  LN+I  LENPT+EN+++W+W+++      L+ + + ETP + V Y+G
Sbjct: 61  PFVDLLDHRLLNDIPGLENPTSENLSVWLWQKIKPVFPALAKIELSETPGTGVIYEG 117


>gi|311281158|ref|YP_003943389.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Enterobacter cloacae SCF1]
 gi|308750353|gb|ADO50105.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Enterobacter cloacae SCF1]
          Length = 120

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 57/115 (49%), Positives = 82/115 (71%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 5   LYKDFTFEAAHRLPNVPEGHKCGRLHGHSFVVRLEITGEVDPHTGWIIDFAELKAIFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           L++LDH+ LN+I  LENPT+E +A W+W+++   L +LS+V V ET  +   Y+G
Sbjct: 65  LDRLDHYYLNDIPGLENPTSEVLAEWVWQQIKPQLPLLSAVVVKETCTAGCIYRG 119


>gi|226229288|ref|YP_002763394.1| 6-pyruvoyl tetrahydropterin synthase family protein [Gemmatimonas
           aurantiaca T-27]
 gi|226092479|dbj|BAH40924.1| 6-pyruvoyl tetrahydropterin synthase family protein [Gemmatimonas
           aurantiaca T-27]
          Length = 127

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 60/116 (51%), Positives = 84/116 (72%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I + FT EAAHRLP VP+ HKC R+HGHS+ +EL + G +DP  G+V DF +I+  F P
Sbjct: 6   EIHKQFTIEAAHRLPHVPEGHKCARLHGHSFGIELRVRGPLDPTLGWVMDFADIKSAFKP 65

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           + ++LDHH LN+I  LENPT+E +A+WIW++L  +L  LS+V + ET  S  EY+G
Sbjct: 66  IYDRLDHHYLNDIPGLENPTSERLAVWIWEQLVPALPQLSAVIIRETCTSGCEYRG 121


>gi|325276882|ref|ZP_08142575.1| queuosine biosynthesis protein QueD [Pseudomonas sp. TJI-51]
 gi|324097987|gb|EGB96140.1| queuosine biosynthesis protein QueD [Pseudomonas sp. TJI-51]
          Length = 118

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 82/117 (70%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + FTFE+AHRLP VP  HKC R+HGHS++V L + G +DP TG++ DF  ++  F 
Sbjct: 1   MEIFKEFTFESAHRLPHVPAGHKCGRLHGHSFKVGLHLTGPLDPHTGWIRDFAEVKAIFK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ E+LDH+ LN+I  LENPT+E IA WIW ++   L  LS VR++ET  S  EY G
Sbjct: 61  PIYEQLDHNYLNDIPGLENPTSEVIAKWIWDQVKPLLPELSKVRIHETCTSGCEYYG 117


>gi|120601648|ref|YP_966048.1| 6-pyruvoyl tetrahydropterin synthase [Desulfovibrio vulgaris DP4]
 gi|120561877|gb|ABM27621.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfovibrio vulgaris DP4]
          Length = 120

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 84/117 (71%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M++    +F+AAHRLP VP+ HKC  +HGH++ VE+ + G +D   G+V DF ++++   
Sbjct: 1   MELFVTLSFDAAHRLPCVPQGHKCGNLHGHTFSVEVHLAGPLDGDNGWVMDFGDVKRVAR 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P++++LDH  LN+IE LENPT+ENIA W+W+RL TSL +LS V V E+P S   Y+G
Sbjct: 61  PVVDQLDHAYLNDIEGLENPTSENIARWLWERLVTSLPLLSKVVVRESPTSGAVYRG 117


>gi|330875754|gb|EGH09903.1| 6-pyruvoyl tetrahydrobiopterin synthase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 140

 Score =  151 bits (383), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 62/116 (53%), Positives = 83/116 (71%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I + FTFE+AH LP VP+ HKC R+HGHS+RV + + G VDP TG++ DF  I+  F P
Sbjct: 24  EIFKEFTFESAHLLPHVPEGHKCGRLHGHSFRVGIHLAGKVDPHTGWIRDFSEIKAIFKP 83

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           L E+LDH+ LN+I  LENPT+EN+A WIW  L   L  LS++R++ET  S  EY+G
Sbjct: 84  LYERLDHNYLNDIPGLENPTSENLAKWIWNELKPLLPELSAIRIHETCTSGCEYRG 139


>gi|46581061|ref|YP_011869.1| 6-pyruvoyl tetrahydrobiopterin synthase [Desulfovibrio vulgaris
           str. Hildenborough]
 gi|46450482|gb|AAS97129.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|311234738|gb|ADP87592.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfovibrio vulgaris RCH1]
          Length = 120

 Score =  151 bits (383), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 58/117 (49%), Positives = 84/117 (71%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M++    +F+AAHRLP VPK HKC  +HGH++ VE+ + G +D   G+V DF ++++   
Sbjct: 1   MELFVTLSFDAAHRLPCVPKGHKCGNLHGHTFSVEVHLAGPLDGDNGWVMDFGDVKRVAR 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P++++LDH  LN+IE LENPT+ENIA W+W+RL TSL +LS V V E+P S   Y+G
Sbjct: 61  PVVDQLDHAYLNDIEGLENPTSENIARWLWERLVTSLPLLSKVVVRESPTSGAVYRG 117


>gi|21244339|ref|NP_643921.1| 6-pyruvoyl tetrahydrobiopterin synthase [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|21109994|gb|AAM38457.1| 6-pyruvoyl tetrahydrobiopterin synthase [Xanthomonas axonopodis pv.
           citri str. 306]
          Length = 120

 Score =  151 bits (383), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 63/117 (53%), Positives = 84/117 (71%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M I + FT EAAHRLP VP  HKC R+HGHS+RVEL + G+   +TG++ DF +I+  F 
Sbjct: 4   MDIFKVFTLEAAHRLPNVPPGHKCARLHGHSFRVELHVSGEPGAETGWIMDFGDIKAAFQ 63

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ ++LDHH LNEIE LENPT+E +AIWIW++L  +L  LS + V+ET  S   Y+G
Sbjct: 64  PIYDRLDHHYLNEIEGLENPTSERLAIWIWQQLKPALPQLSEIVVHETCTSGCRYRG 120


>gi|85058493|ref|YP_454195.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Sodalis
           glossinidius str. 'morsitans']
 gi|84779013|dbj|BAE73790.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Sodalis
           glossinidius str. 'morsitans']
          Length = 120

 Score =  151 bits (383), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 57/115 (49%), Positives = 82/115 (71%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFE+AHRLP VP  HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P+
Sbjct: 5   LYKDFTFESAHRLPHVPAGHKCGRLHGHSFLVRLEVTGEVDPHTGWIMDFAELKAAFQPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           L++LDH+ +NEI  LENPT+E +A WIW++L   L +LS+V + ET  +   Y+G
Sbjct: 65  LDRLDHYYINEIPGLENPTSEVLAQWIWQQLKPQLPLLSAVTLKETCTAGCVYRG 119


>gi|21230064|ref|NP_635981.1| 6-pyruvoyl tetrahydrobiopterin synthase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66769943|ref|YP_244705.1| 6-pyruvoyl tetrahydrobiopterin synthase [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|78049290|ref|YP_365465.1| 6-pyruvoyl tetrahydrobiopterin synthase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|166713489|ref|ZP_02244696.1| 6-pyruvoyl tetrahydrobiopterin synthase [Xanthomonas oryzae pv.
           oryzicola BLS256]
 gi|188993156|ref|YP_001905166.1| 6-pyruvoyl tetrahydrobiopterin synthase [Xanthomonas campestris pv.
           campestris str. B100]
 gi|325928525|ref|ZP_08189713.1| queuosine biosynthesis protein QueD [Xanthomonas perforans 91-118]
 gi|21111588|gb|AAM39905.1| 6-pyruvoyl tetrahydrobiopterin synthase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66575275|gb|AAY50685.1| 6-pyruvoyl tetrahydrobiopterin synthase [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|78037720|emb|CAJ25465.1| 6-pyruvoyl tetrahydrobiopterin synthase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|167734916|emb|CAP53128.1| 6-pyruvoyl tetrahydrobiopterin synthase [Xanthomonas campestris pv.
           campestris]
 gi|325541064|gb|EGD12618.1| queuosine biosynthesis protein QueD [Xanthomonas perforans 91-118]
          Length = 117

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 62/117 (52%), Positives = 84/117 (71%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M I + FT EAAHRLP VP  HKC R+HGHS+RVEL + G+   +TG++ DF +I+  F 
Sbjct: 1   MDIFKVFTLEAAHRLPNVPPGHKCARLHGHSFRVELHVSGEPGAETGWIMDFGDIKAAFQ 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ ++LDHH LN+IE LENPT+E +AIWIW++L  +L  LS + V+ET  S   Y+G
Sbjct: 61  PIYDRLDHHYLNDIEGLENPTSERLAIWIWQQLKPALPQLSEIVVHETCTSGCRYRG 117


>gi|289665421|ref|ZP_06487002.1| 6-pyruvoyl tetrahydrobiopterin synthase [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289668396|ref|ZP_06489471.1| 6-pyruvoyl tetrahydrobiopterin synthase [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 117

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 84/117 (71%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M I + FT EAAHRLP VP  HKC R+HGHS+RVEL + G+   +TG++ DF +I+  F 
Sbjct: 1   MDIFKVFTLEAAHRLPNVPPGHKCARLHGHSFRVELHVSGEPGAETGWIMDFGDIKAAFQ 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ ++LDHH LN+I+ LENPT+E +AIWIW++L  +L  LS + V+ET  S   Y+G
Sbjct: 61  PIYDRLDHHYLNDIDGLENPTSERLAIWIWQQLKPALPQLSEIVVHETCTSGCRYRG 117


>gi|294625535|ref|ZP_06704162.1| 6-pyruvoyl tetrahydrobiopterin synthase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292600149|gb|EFF44259.1| 6-pyruvoyl tetrahydrobiopterin synthase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 120

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 63/117 (53%), Positives = 84/117 (71%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M I + FT EAAHRLP VP  HKC R+HGHS+RVEL + G+   +TG++ DF +I+  F 
Sbjct: 4   MDIFKVFTLEAAHRLPNVPPGHKCARLHGHSFRVELHVSGEPGAETGWIMDFGDIKAAFQ 63

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ ++LDHH LNEIE LENPT+E +AIWIW++L  +L  LS + V+ET  S   Y+G
Sbjct: 64  PIYDRLDHHYLNEIEGLENPTSERLAIWIWQQLKPALPQLSEIVVHETCTSGCRYRG 120


>gi|308049095|ref|YP_003912661.1| preQ(0) biosynthesis protein QueD [Ferrimonas balearica DSM 9799]
 gi|307631285|gb|ADN75587.1| preQ(0) biosynthesis protein QueD [Ferrimonas balearica DSM 9799]
          Length = 122

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 61/116 (52%), Positives = 80/116 (68%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I + FTFEAAH+LP VP  HKC R+HGHS+ V + + GDVDP TG+V DF  ++ +F P
Sbjct: 4   EIYKEFTFEAAHKLPHVPAGHKCGRLHGHSFLVRISVAGDVDPHTGWVMDFAELKAHFKP 63

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           + E+LDHH LN+I  LENPT+E +A W+W  L  SL  LS V + ET  S   Y+G
Sbjct: 64  IWERLDHHYLNDIPGLENPTSEVLAKWVWAELKPSLPQLSEVAIKETCTSGCIYRG 119


>gi|84622356|ref|YP_449728.1| 6-pyruvoyl tetrahydrobiopterin synthase [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|188578676|ref|YP_001915605.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Xanthomonas
           oryzae pv. oryzae PXO99A]
 gi|84366296|dbj|BAE67454.1| 6-pyruvoyl tetrahydrobiopterin synthase [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|188523128|gb|ACD61073.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Xanthomonas
           oryzae pv. oryzae PXO99A]
          Length = 120

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 62/117 (52%), Positives = 84/117 (71%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M I + FT EAAHRLP VP  HKC R+HGHS+RVEL + G+   +TG++ DF +I+  F 
Sbjct: 4   MDIFKVFTLEAAHRLPNVPPGHKCARLHGHSFRVELHVSGEPGAETGWIMDFGDIKAAFQ 63

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ ++LDHH LN+IE LENPT+E +AIWIW++L  +L  LS + V+ET  S   Y+G
Sbjct: 64  PIYDRLDHHYLNDIEGLENPTSERLAIWIWQQLKPTLPQLSEIVVHETCTSGCRYRG 120


>gi|115525938|ref|YP_782849.1| putative 6-pyruvoyl tetrahydropterin synthase [Rhodopseudomonas
           palustris BisA53]
 gi|115519885|gb|ABJ07869.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Rhodopseudomonas palustris BisA53]
          Length = 118

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 81/117 (69%), Positives = 93/117 (79%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MKITQAF FEAAHRLP VP TH+CHRMHGHSYRVEL ++G VDP +GFV DFF+IE  F 
Sbjct: 1   MKITQAFRFEAAHRLPNVPPTHRCHRMHGHSYRVELELQGPVDPVSGFVVDFFDIEAAFG 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            LL +LDH+CLN++E LENPTAENIAIWIW+R   SL  L+ VRV+ET   W EY G
Sbjct: 61  GLLARLDHYCLNDVEGLENPTAENIAIWIWQRTKPSLPQLARVRVFETADCWAEYDG 117


>gi|91975957|ref|YP_568616.1| putative 6-pyruvoyl tetrahydropterin synthase [Rhodopseudomonas
           palustris BisB5]
 gi|91682413|gb|ABE38715.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Rhodopseudomonas palustris BisB5]
          Length = 122

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 84/117 (71%), Positives = 94/117 (80%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MKITQAF FEAAH+LP VP+TH+C RMHGHSYRVEL + G V+P TGFV DFF IE  F 
Sbjct: 1   MKITQAFRFEAAHQLPNVPETHRCRRMHGHSYRVELQLSGPVNPTTGFVLDFFEIEATFG 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PLL +LDH+CLN+IE LENPTAENIAIWIW R   SLS LS+VRVYETP  W +Y G
Sbjct: 61  PLLARLDHYCLNDIEGLENPTAENIAIWIWTRTKPSLSALSNVRVYETPDCWADYAG 117


>gi|152968325|ref|YP_001364109.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Kineococcus radiotolerans SRS30216]
 gi|151362842|gb|ABS05845.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Kineococcus radiotolerans SRS30216]
          Length = 123

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 88/117 (75%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + FTFEAAHRLP VP  HKC R+HGHSYRV + + G  DP  G+V DF ++++  +
Sbjct: 1   MEIFREFTFEAAHRLPHVPAGHKCARLHGHSYRVSVHVNGLPDPLLGWVMDFGDLKKLVA 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P++E+LDH+ LNE+E L+NPT+E +A W+W++LS +L++LS+V V ET  S   Y+G
Sbjct: 61  PVIERLDHYYLNEVEGLDNPTSEVLARWMWQQLSPTLALLSAVTVRETCTSGATYRG 117


>gi|325921304|ref|ZP_08183164.1| queuosine biosynthesis protein QueD [Xanthomonas gardneri ATCC
           19865]
 gi|325548271|gb|EGD19265.1| queuosine biosynthesis protein QueD [Xanthomonas gardneri ATCC
           19865]
          Length = 120

 Score =  151 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 84/117 (71%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M I + FT EAAHRLP VP  HKC R+HGHS+R+EL + G+   +TG++ DF +I+  F 
Sbjct: 4   MDIFKVFTLEAAHRLPNVPPGHKCARLHGHSFRIELHVSGEPGAETGWIMDFGDIKAAFQ 63

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ ++LDHH LN+IE LENPT+E +AIWIW++L  +L  LS + V+ET  S   Y+G
Sbjct: 64  PIYDRLDHHYLNDIEGLENPTSERLAIWIWQQLKPALPQLSEIVVHETCTSGCRYRG 120


>gi|170744630|ref|YP_001773285.1| queuosine biosynthesis protein QueD [Methylobacterium sp. 4-46]
 gi|168198904|gb|ACA20851.1| queuosine biosynthesis protein QueD [Methylobacterium sp. 4-46]
          Length = 118

 Score =  151 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 82/117 (70%), Positives = 99/117 (84%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MKITQAFTFEAAH LP VP+TH+C RMHGHSYRVEL ++G VDP+TG+V DFF++E  F+
Sbjct: 1   MKITQAFTFEAAHWLPNVPETHRCRRMHGHSYRVELTLDGPVDPRTGWVVDFFDVESAFA 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PLL +LDHHCLNE+  LENPTAE+IAIWIW+R   +L  L+SV+V+ETPMSW EY G
Sbjct: 61  PLLAELDHHCLNEVPGLENPTAEHIAIWIWRRARPALPALASVKVFETPMSWAEYDG 117


>gi|110806611|ref|YP_690131.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Shigella flexneri
           5 str. 8401]
 gi|254037814|ref|ZP_04871872.1| conserved hypothetical protein [Escherichia sp. 1_1_43]
 gi|332280570|ref|ZP_08392983.1| conserved hypothetical protein [Shigella sp. D9]
 gi|110616159|gb|ABF04826.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Shigella flexneri
           5 str. 8401]
 gi|226839438|gb|EEH71459.1| conserved hypothetical protein [Escherichia sp. 1_1_43]
 gi|281602130|gb|ADA75114.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Shigella flexneri
           2002017]
 gi|323377370|gb|ADX49638.1| 6-pyruvoyl tetrahydropterin synthase [Escherichia coli KO11]
 gi|332102922|gb|EGJ06268.1| conserved hypothetical protein [Shigella sp. D9]
          Length = 149

 Score =  151 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 34  LFKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIIDFAELKAAFKPT 93

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+I  LENPT+E +A WIW ++   + +LS+V V ET  +   Y+G
Sbjct: 94  YERLDHHYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCIYRG 148


>gi|58580392|ref|YP_199408.1| 6-pyruvoyl tetrahydrobiopterin synthase [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|58424986|gb|AAW74023.1| 6-pyruvoyl tetrahydrobiopterin synthase [Xanthomonas oryzae pv.
           oryzae KACC10331]
          Length = 152

 Score =  151 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 62/117 (52%), Positives = 84/117 (71%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M I + FT EAAHRLP VP  HKC R+HGHS+RVEL + G+   +TG++ DF +I+  F 
Sbjct: 36  MDIFKVFTLEAAHRLPNVPPGHKCARLHGHSFRVELHVSGEPGAETGWIMDFGDIKAAFQ 95

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ ++LDHH LN+IE LENPT+E +AIWIW++L  +L  LS + V+ET  S   Y+G
Sbjct: 96  PIYDRLDHHYLNDIEGLENPTSERLAIWIWQQLKPTLPQLSEIVVHETCTSGCRYRG 152


>gi|148548636|ref|YP_001268738.1| putative 6-pyruvoyl tetrahydropterin synthase [Pseudomonas putida
           F1]
 gi|148512694|gb|ABQ79554.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Pseudomonas putida F1]
          Length = 118

 Score =  151 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 59/117 (50%), Positives = 83/117 (70%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + FTFE+AHRLP VP+ HKC R+HGHS++V L + G +DP TG++ DF  ++  F 
Sbjct: 1   MEIFKEFTFESAHRLPHVPEGHKCGRLHGHSFKVGLHLTGPLDPHTGWIRDFAEVKAIFK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ ++LDH+ LN+I  LENPT+E IA WIW ++   +  LS VR++ET  S  EY G
Sbjct: 61  PIYDQLDHNYLNDIPGLENPTSEVIAKWIWDQVKPLMPELSKVRIHETCTSGCEYSG 117


>gi|77459998|ref|YP_349505.1| putative 6-pyruvoyl tetrahydropterin synthase [Pseudomonas
           fluorescens Pf0-1]
 gi|77384001|gb|ABA75514.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Pseudomonas
           fluorescens Pf0-1]
          Length = 118

 Score =  150 bits (380), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 60/117 (51%), Positives = 83/117 (70%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + FTFE+AHRLP VP  HKC R+HGHS++V + + GD+DP TG++ DF  I+  F 
Sbjct: 1   MEIFKEFTFESAHRLPHVPDGHKCGRLHGHSFKVAIHLSGDLDPHTGWIRDFSEIKAIFK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PL E+LDH+ LN+I  LENPT+E +A +IW  L   L  LS++R++ET  S   Y+G
Sbjct: 61  PLYERLDHNYLNDIPGLENPTSEVLAKFIWNELKPLLPELSAIRIHETCTSGCIYRG 117


>gi|312171333|emb|CBX79592.1| K01737 6-pyruvoyl tetrahydrobiopterin synthase [Erwinia amylovora
           ATCC BAA-2158]
          Length = 155

 Score =  150 bits (380), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 56/115 (48%), Positives = 79/115 (68%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAH LP VP  HKC R+HGHS+ V L + G+VD  TG+V DF  I+  F P+
Sbjct: 41  LFKEFQFEAAHHLPHVPAGHKCGRLHGHSFMVRLEITGEVDAHTGWVMDFSEIKSAFKPV 100

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDH+ LN+I  LENPT+E +A WIW+++  +L +LS+V V ET  +   Y+G
Sbjct: 101 YDRLDHYYLNDIPGLENPTSEVLAEWIWQQMKPALPLLSAVMVKETCTAGCVYRG 155


>gi|90425303|ref|YP_533673.1| putative 6-pyruvoyl tetrahydropterin synthase [Rhodopseudomonas
           palustris BisB18]
 gi|90107317|gb|ABD89354.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Rhodopseudomonas palustris BisB18]
          Length = 122

 Score =  150 bits (380), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 78/117 (66%), Positives = 92/117 (78%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MKITQAF+FEAAHRLP VP  H+CHRMHGHSYRVEL + G VDP +GFV DFF IE  F 
Sbjct: 1   MKITQAFSFEAAHRLPHVPAQHRCHRMHGHSYRVELQLRGPVDPTSGFVVDFFEIEAAFG 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+L  LDH+CLNE++ LENPTAENIA+WIW+R+  +L  LS V+V+ET   W EY G
Sbjct: 61  PVLASLDHYCLNEVDGLENPTAENIALWIWQRVKPALPQLSQVKVFETADCWAEYDG 117


>gi|28870594|ref|NP_793213.1| 6-pyruvoyl tetrahydrobiopterin synthase [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213970016|ref|ZP_03398148.1| 6-pyruvoyl tetrahydrobiopterin synthase [Pseudomonas syringae pv.
           tomato T1]
 gi|301381371|ref|ZP_07229789.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Pseudomonas
           syringae pv. tomato Max13]
 gi|302062142|ref|ZP_07253683.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Pseudomonas
           syringae pv. tomato K40]
 gi|302130452|ref|ZP_07256442.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Pseudomonas
           syringae pv. tomato NCPPB 1108]
 gi|28853842|gb|AAO56908.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|213925120|gb|EEB58683.1| 6-pyruvoyl tetrahydrobiopterin synthase [Pseudomonas syringae pv.
           tomato T1]
 gi|331019839|gb|EGH99895.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Pseudomonas
           syringae pv. lachrymans str. M302278PT]
          Length = 118

 Score =  150 bits (380), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 63/117 (53%), Positives = 83/117 (70%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + FTFE+AH LP VP  HKC R+HGHS+RV + + G VDP TG++ DF  I+  F 
Sbjct: 1   MEIFKEFTFESAHLLPHVPAGHKCGRLHGHSFRVGIHLAGKVDPHTGWIRDFSEIKAIFK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PL E+LDH+ LN+I  LENPT+EN+A WIW  L   L  LS++R++ET  S  EY+G
Sbjct: 61  PLYERLDHNYLNDIPGLENPTSENLAKWIWNELKPLLPELSAIRIHETCTSGCEYRG 117


>gi|294635387|ref|ZP_06713881.1| queuosine biosynthesis protein QueD [Edwardsiella tarda ATCC 23685]
 gi|291091274|gb|EFE23835.1| queuosine biosynthesis protein QueD [Edwardsiella tarda ATCC 23685]
          Length = 120

 Score =  150 bits (380), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 59/115 (51%), Positives = 82/115 (71%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAHRLP VP+ HKC R+HGHS+ V + + G+VDP TG+V DF +++  F P+
Sbjct: 5   LFKEFQFEAAHRLPHVPQGHKCGRLHGHSFLVRIEISGEVDPHTGWVMDFADLKARFQPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDHH LNEI  LENPT+E +A WIW++L   L +LS+V V ET  +   Y+G
Sbjct: 65  YDQLDHHYLNEITGLENPTSEVLAHWIWQQLKPRLPLLSAVMVKETCTAGCTYRG 119


>gi|26249163|ref|NP_755203.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           CFT073]
 gi|91212126|ref|YP_542112.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           UTI89]
 gi|237706612|ref|ZP_04537093.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|26109570|gb|AAN81773.1|AE016765_175 Putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           CFT073]
 gi|91073700|gb|ABE08581.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           UTI89]
 gi|226899652|gb|EEH85911.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
          Length = 149

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 34  LFKDFTFEAAHRLPHVPQGHKCGRLHGHSFMVRLEITGEVDPHTGWIIDFAELKAAFKPT 93

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+I  LENPT+E +A WIW ++   + +LS+V V ET  +   Y+G
Sbjct: 94  YERLDHHYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCIYRG 148


>gi|294664309|ref|ZP_06729676.1| 6-pyruvoyl tetrahydrobiopterin synthase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292605918|gb|EFF49202.1| 6-pyruvoyl tetrahydrobiopterin synthase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 120

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 62/117 (52%), Positives = 83/117 (70%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M I + FT EAAHRLP VP  HKC R+HGHS+RVEL + G+   +TG++ DF +I+  F 
Sbjct: 4   MDIFKVFTLEAAHRLPNVPPGHKCARLHGHSFRVELHVSGEPGAETGWIMDFGDIKAAFQ 63

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ ++LDHH LNEIE L NPT+E +AIWIW++L  +L  LS + V+ET  S   Y+G
Sbjct: 64  PIYDRLDHHYLNEIEGLGNPTSERLAIWIWQQLKPALPQLSEIVVHETCTSGCRYRG 120


>gi|315122372|ref|YP_004062861.1| hypothetical protein CKC_03120 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495774|gb|ADR52373.1| hypothetical protein CKC_03120 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 118

 Score =  150 bits (379), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 106/117 (90%), Positives = 113/117 (96%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MKITQAFTFEAAH+LP VPKTHKC+RMHGHSYRVELVMEGDVDPKTGFVDDFFNIE+YF+
Sbjct: 1   MKITQAFTFEAAHKLPYVPKTHKCYRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEKYFA 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PLLEKLDHHCLNE+E+L+NPTAENIAIWIWKRL  SL ILSSVRVYETPMSWVEYQG
Sbjct: 61  PLLEKLDHHCLNEVEDLDNPTAENIAIWIWKRLFDSLPILSSVRVYETPMSWVEYQG 117


>gi|291284093|ref|YP_003500911.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           O55:H7 str. CB9615]
 gi|290763966|gb|ADD57927.1| Putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           O55:H7 str. CB9615]
          Length = 149

 Score =  150 bits (379), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 34  LFKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIIDFAELKAAFKPT 93

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+I  LENPT+E +A WIW ++   + +LS+V V ET  +   Y+G
Sbjct: 94  YERLDHHYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCIYRG 148


>gi|251788460|ref|YP_003003181.1| 6-pyruvoyl tetrahydropterin synthase [Dickeya zeae Ech1591]
 gi|247537081|gb|ACT05702.1| 6-pyruvoyl tetrahydropterin synthase [Dickeya zeae Ech1591]
          Length = 122

 Score =  150 bits (379), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 60/115 (52%), Positives = 81/115 (70%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAHRLP VP  HKC R+HGHS+ V L + G+VDP TG+V DF  ++  F P 
Sbjct: 5   LFKDFQFEAAHRLPHVPDGHKCGRLHGHSFMVRLEITGEVDPYTGWVMDFAELKAAFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+I+ LENPT+E +A WIW++L  +L +LS+V V ET  +   Y+G
Sbjct: 65  WEQLDHHYLNDIQGLENPTSEVLAHWIWQQLKPTLPLLSAVTVKETCTAGCVYRG 119


>gi|238797156|ref|ZP_04640658.1| 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia mollaretii ATCC
           43969]
 gi|238719003|gb|EEQ10817.1| 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia mollaretii ATCC
           43969]
          Length = 119

 Score =  150 bits (379), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 56/115 (48%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAHRLP VP+ HKC R+HGHS+ V + + G+VD  +G+V DF  ++  F+P+
Sbjct: 5   LFKDFQFEAAHRLPHVPEGHKCGRLHGHSFMVRIEVTGEVDAHSGWVMDFAELKSAFNPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDH+ LN+I  LENPT+E +A WIW++L   L  LS+V V ET  +   Y+G
Sbjct: 65  WERLDHNYLNDIPGLENPTSEVLASWIWQQLKPQLPELSAVMVKETCSAGCVYRG 119


>gi|284009094|emb|CBA76079.1| 6-pyruvoyl tetrahydrobiopterin synthase [Arsenophonus nasoniae]
          Length = 131

 Score =  149 bits (378), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 61/115 (53%), Positives = 81/115 (70%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           I + F FEAAHRLP VP  HKC R+HGHS+ V L + G++DP+TG+V DF +I + F PL
Sbjct: 16  IFKDFQFEAAHRLPHVPAGHKCGRLHGHSFMVRLELTGEIDPQTGWVVDFSDISKAFKPL 75

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDHH LN+IE LENPT+E IA WIW ++   L  LSS+ + ET  +   Y+G
Sbjct: 76  WQQLDHHYLNDIEGLENPTSEVIARWIWHKMKPMLPQLSSIMIKETCNAGCIYRG 130


>gi|316935171|ref|YP_004110153.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Rhodopseudomonas palustris DX-1]
 gi|315602885|gb|ADU45420.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Rhodopseudomonas palustris DX-1]
          Length = 120

 Score =  149 bits (378), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 81/117 (69%), Positives = 90/117 (76%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MKITQAF FEAAH LP VP+TH+C RMHGHSYRVEL + G VDP TGFV DFF IE  F 
Sbjct: 1   MKITQAFRFEAAHYLPNVPETHRCKRMHGHSYRVELQLSGPVDPLTGFVVDFFEIEAAFG 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PLL++LDHHCLNEIE L+NPTAENIA+WIW+R    L  L  VRVYET   W +Y G
Sbjct: 61  PLLKRLDHHCLNEIEGLDNPTAENIAVWIWQRTKPELPQLCGVRVYETSDCWADYAG 117


>gi|157369054|ref|YP_001477043.1| putative 6-pyruvoyl tetrahydropterin synthase [Serratia
           proteamaculans 568]
 gi|157320818|gb|ABV39915.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Serratia proteamaculans 568]
          Length = 119

 Score =  149 bits (378), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 57/115 (49%), Positives = 79/115 (68%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAHRLP V + HKC R+HGHS+ V L + G+VD  TG+V DF  ++  FSP+
Sbjct: 5   LFKDFQFEAAHRLPNVAEGHKCGRLHGHSFMVRLEVTGEVDAHTGWVMDFAELKAVFSPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDH+ LN+I  LENPT+E +A WIW++L   L  L++V V ET  +   Y+G
Sbjct: 65  WERLDHNYLNDIPGLENPTSEVLAAWIWQQLKPQLPELTAVMVKETCTAGCVYKG 119


>gi|70731375|ref|YP_261116.1| 6-pyruvoyl tetrahydrobiopterin synthase [Pseudomonas fluorescens
           Pf-5]
 gi|68345674|gb|AAY93280.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Pseudomonas
           fluorescens Pf-5]
          Length = 118

 Score =  149 bits (378), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 60/117 (51%), Positives = 83/117 (70%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + FTFE+AHRLP VP+ HKC R+HGHS++V + + G+VD  TG++ DF  I+  F 
Sbjct: 1   MEIFKEFTFESAHRLPFVPEGHKCGRLHGHSFKVAIHLSGEVDAHTGWIRDFSEIKAIFK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PL E+LDH+ LN+I  LENPT+E +A WIW  L   L  LS++R++ET  S   Y+G
Sbjct: 61  PLYERLDHNYLNDIPGLENPTSEVLAKWIWNELKPLLPELSAIRIHETCTSGCIYRG 117


>gi|26989065|ref|NP_744490.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Pseudomonas
           putida KT2440]
 gi|24983893|gb|AAN67954.1|AE016428_2 6-pyruvoyl tetrahydrobiopterin synthase, putative [Pseudomonas
           putida KT2440]
 gi|313499575|gb|ADR60941.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Pseudomonas
           putida BIRD-1]
          Length = 118

 Score =  149 bits (378), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 59/117 (50%), Positives = 83/117 (70%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + FTFE+AHRLP VP+ HKC R+HGHS++V L + G +DP TG++ DF  ++  F 
Sbjct: 1   MEIFKEFTFESAHRLPHVPEGHKCGRLHGHSFKVGLHLTGPLDPHTGWIRDFAEVKAIFK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ ++LDH+ LN+I  LENPT+E IA WIW ++   +  LS VR++ET  S  EY G
Sbjct: 61  PIYDQLDHNYLNDIPGLENPTSEVIAKWIWDQVKPLMPELSKVRIHETCTSGCEYTG 117


>gi|218886224|ref|YP_002435545.1| queuosine biosynthesis protein QueD [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218757178|gb|ACL08077.1| queuosine biosynthesis protein QueD [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 122

 Score =  149 bits (378), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 53/117 (45%), Positives = 75/117 (64%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M I    TF+AAHRLP VP+ HKC  +HGH++ VE+   G V   TG+V DF ++++   
Sbjct: 1   MDIFVTLTFDAAHRLPCVPQGHKCGNLHGHTFTVEVHARGPVGGDTGWVMDFGDLKRLAK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P++++LDH  LN+I  LENPT+E IA W+W+ L   L  L  + V E+P S   Y+G
Sbjct: 61  PVMDRLDHAYLNDIPGLENPTSECIARWLWRELKPGLPQLCRLVVRESPTSGAVYEG 117


>gi|238750570|ref|ZP_04612070.1| 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia rohdei ATCC
           43380]
 gi|238786799|ref|ZP_04630600.1| 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia frederiksenii
           ATCC 33641]
 gi|238711218|gb|EEQ03436.1| 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia rohdei ATCC
           43380]
 gi|238725167|gb|EEQ16806.1| 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia frederiksenii
           ATCC 33641]
          Length = 119

 Score =  149 bits (378), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 56/115 (48%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAHRLP VP+ HKC R+HGHS+ + + + G+VD  +G+V DF +++  F P+
Sbjct: 5   LFKDFQFEAAHRLPHVPEGHKCGRLHGHSFMIRIEVTGEVDAHSGWVMDFADLKAAFKPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+I  LENPT+E +A WIW++L   L  LS+V V ET  +   Y+G
Sbjct: 65  WERLDHHYLNDIPGLENPTSEVLASWIWQQLKPQLPELSAVMVKETCSAGCVYRG 119


>gi|293392805|ref|ZP_06637123.1| queuosine biosynthesis protein QueD [Serratia odorifera DSM 4582]
 gi|291424664|gb|EFE97875.1| queuosine biosynthesis protein QueD [Serratia odorifera DSM 4582]
          Length = 119

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 59/115 (51%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAHRLP VP+ HKC R+HGHS+ V L + G+VD  TG+V DF  ++  F+P+
Sbjct: 5   LFKDFQFEAAHRLPHVPEGHKCGRLHGHSFMVRLEVTGEVDAYTGWVMDFAELKAVFTPV 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+I  LENPT+E +A WIW++L   L  LS+V V ET  +   Y+G
Sbjct: 65  WERLDHHYLNDIPGLENPTSEVLAAWIWQQLKPQLPELSAVMVKETCTAGCVYKG 119


>gi|304414038|ref|ZP_07395406.1| 6-pyruvoyl-tetrahydropterin synthase (PTPS) [Candidatus Regiella
           insecticola LSR1]
 gi|304283252|gb|EFL91648.1| 6-pyruvoyl-tetrahydropterin synthase (PTPS) [Candidatus Regiella
           insecticola LSR1]
          Length = 129

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 57/115 (49%), Positives = 81/115 (70%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAHRLP VP+ HKC R+HGHS+ + L + G+VDP  G++ DF  ++  F P+
Sbjct: 14  LFKDFQFEAAHRLPNVPEGHKCGRLHGHSFSLRLEVTGEVDPTFGWIMDFAALKTQFEPI 73

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           L++LDH+ LNEIE LENPT+E +A WIW++L   L  LS+V + ET  +   Y+G
Sbjct: 74  LQRLDHNYLNEIEGLENPTSEVLAAWIWQQLKPKLPELSAVTIKETCSTGCVYRG 128


>gi|167032950|ref|YP_001668181.1| queuosine biosynthesis protein QueD [Pseudomonas putida GB-1]
 gi|166859438|gb|ABY97845.1| queuosine biosynthesis protein QueD [Pseudomonas putida GB-1]
          Length = 118

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 60/117 (51%), Positives = 83/117 (70%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + FTFE+AHRLP VP+ HKC R+HGHS++V L + G +DP TG++ DF  ++  F 
Sbjct: 1   MEIFKEFTFESAHRLPHVPEGHKCGRLHGHSFKVGLHLTGPLDPHTGWIRDFAEVKAIFK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ E+LDH+ LN+I  LENPT+E IA WIW ++   +  LS VR++ET  S  EY G
Sbjct: 61  PIYEQLDHNYLNDIPGLENPTSEVIAKWIWDQVKPLMPELSKVRIHETCTSGCEYTG 117


>gi|22124730|ref|NP_668153.1| 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia pestis KIM 10]
 gi|45440172|ref|NP_991711.1| sulfite reductase, alpha subunit [Yersinia pestis biovar Microtus
           str. 91001]
 gi|153949713|ref|YP_001402269.1| 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia
           pseudotuberculosis IP 31758]
 gi|167399014|ref|ZP_02304538.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|21957547|gb|AAM84404.1|AE013684_6 putative 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia pestis
           KIM 10]
 gi|45435028|gb|AAS60588.1| sulfite reductase, alpha subunit [Yersinia pestis biovar Microtus
           str. 91001]
 gi|152961208|gb|ABS48669.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia
           pseudotuberculosis IP 31758]
 gi|167051518|gb|EDR62926.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia pestis
           biovar Antiqua str. UG05-0454]
          Length = 121

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 57/115 (49%), Positives = 79/115 (68%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAHRLP VP+ HKC R+HGHS+ V L + G+VD  +G+V DF  ++  F P+
Sbjct: 7   LFKDFQFEAAHRLPHVPEGHKCGRLHGHSFMVRLEVTGEVDAHSGWVMDFAALKAVFQPI 66

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+I  LENPT+E +A WIW++L   L  LS+V + ET  +   Y+G
Sbjct: 67  WERLDHHYLNDIPGLENPTSEVLARWIWQQLKPQLPELSAVMIKETCSAGCVYRG 121


>gi|325496186|gb|EGC94045.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia
           fergusonii ECD227]
          Length = 161

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 46  LFKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIIDFAELKAAFKPT 105

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+I  LENPT+E +A WIW ++   + +LS+V V ET  +   Y+G
Sbjct: 106 YERLDHHYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCIYRG 160


>gi|194431611|ref|ZP_03063902.1| queuosine biosynthesis protein QueD [Shigella dysenteriae 1012]
 gi|194419967|gb|EDX36045.1| queuosine biosynthesis protein QueD [Shigella dysenteriae 1012]
          Length = 149

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 57/115 (49%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP+ HKC R+HGHS+ V L + G+V+P TG++ DF  ++  F P 
Sbjct: 34  LFKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVNPHTGWIIDFAELKAAFKPT 93

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+I  LENPT+E +A WIW ++   + +LS+V V ET  +   Y+G
Sbjct: 94  YERLDHHYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCIYRG 148


>gi|157148303|ref|YP_001455622.1| hypothetical protein CKO_04120 [Citrobacter koseri ATCC BAA-895]
 gi|157085508|gb|ABV15186.1| hypothetical protein CKO_04120 [Citrobacter koseri ATCC BAA-895]
          Length = 120

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 57/115 (49%), Positives = 81/115 (70%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP+ HKC R+HGHS+ V L + GDVDP TG++ DF  ++  F P 
Sbjct: 5   LFKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGDVDPHTGWIMDFAELKAAFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDH+ LN+I  LENPT+E +A WIW ++  ++ +LS+V V ET  +   Y+G
Sbjct: 65  YDRLDHYYLNDIPGLENPTSEVLAKWIWDQVKPAVPLLSAVMVKETCTAGCVYRG 119


>gi|51595108|ref|YP_069299.1| 6-pyruvoyl tetrahydrobiopterin synthase family protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|108808862|ref|YP_652778.1| putative 6-pyruvoyl tetrahydrobiopterin synthase family protein
           [Yersinia pestis Antiqua]
 gi|108810884|ref|YP_646651.1| 6-pyruvoyl tetrahydrobiopterin synthase family protein [Yersinia
           pestis Nepal516]
 gi|145600243|ref|YP_001164319.1| 6-pyruvoyl tetrahydrobiopterin synthase family protein [Yersinia
           pestis Pestoides F]
 gi|153997584|ref|ZP_02022684.1| putative 6-pyruvoyl tetrahydrobiopterin synthase family protein
           [Yersinia pestis CA88-4125]
 gi|162419775|ref|YP_001605538.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia pestis
           Angola]
 gi|165925833|ref|ZP_02221665.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165936798|ref|ZP_02225365.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|166010029|ref|ZP_02230927.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166214078|ref|ZP_02240113.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|167420632|ref|ZP_02312385.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167423363|ref|ZP_02315116.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|167470706|ref|ZP_02335410.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia pestis
           FV-1]
 gi|186894120|ref|YP_001871232.1| queuosine biosynthesis protein QueD [Yersinia pseudotuberculosis
           PB1/+]
 gi|218930390|ref|YP_002348265.1| putative 6-pyruvoyl tetrahydrobiopterin synthase family protein
           [Yersinia pestis CO92]
 gi|229839003|ref|ZP_04459162.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229896483|ref|ZP_04511651.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Yersinia pestis
           Pestoides A]
 gi|229899571|ref|ZP_04514712.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229901095|ref|ZP_04516218.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Yersinia pestis
           Nepal516]
 gi|270489274|ref|ZP_06206348.1| queuosine biosynthesis protein QueD [Yersinia pestis KIM D27]
 gi|294505080|ref|YP_003569142.1| 6-pyruvoyl tetrahydrobiopterin synthase family protein [Yersinia
           pestis Z176003]
 gi|51588390|emb|CAH19998.1| putative 6-pyruvoyl tetrahydrobiopterin synthase family protein
           [Yersinia pseudotuberculosis IP 32953]
 gi|108774532|gb|ABG17051.1| 6-pyruvoyl tetrahydrobiopterin synthase family protein [Yersinia
           pestis Nepal516]
 gi|108780775|gb|ABG14833.1| putative 6-pyruvoyl tetrahydrobiopterin synthase family protein
           [Yersinia pestis Antiqua]
 gi|115349001|emb|CAL21962.1| putative 6-pyruvoyl tetrahydrobiopterin synthase family protein
           [Yersinia pestis CO92]
 gi|145211939|gb|ABP41346.1| 6-pyruvoyl tetrahydrobiopterin synthase family protein [Yersinia
           pestis Pestoides F]
 gi|149289221|gb|EDM39301.1| putative 6-pyruvoyl tetrahydrobiopterin synthase family protein
           [Yersinia pestis CA88-4125]
 gi|162352590|gb|ABX86538.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia pestis
           Angola]
 gi|165915447|gb|EDR34057.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|165922445|gb|EDR39622.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165990936|gb|EDR43237.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166204709|gb|EDR49189.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|166961438|gb|EDR57459.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167057533|gb|EDR67279.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|186697146|gb|ACC87775.1| queuosine biosynthesis protein QueD [Yersinia pseudotuberculosis
           PB1/+]
 gi|229681820|gb|EEO77913.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Yersinia pestis
           Nepal516]
 gi|229687063|gb|EEO79138.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229695369|gb|EEO85416.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229700557|gb|EEO88588.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Yersinia pestis
           Pestoides A]
 gi|262363140|gb|ACY59861.1| 6-pyruvoyl tetrahydrobiopterin synthase family protein [Yersinia
           pestis D106004]
 gi|262367070|gb|ACY63627.1| 6-pyruvoyl tetrahydrobiopterin synthase family protein [Yersinia
           pestis D182038]
 gi|270337778|gb|EFA48555.1| queuosine biosynthesis protein QueD [Yersinia pestis KIM D27]
 gi|294355539|gb|ADE65880.1| 6-pyruvoyl tetrahydrobiopterin synthase family protein [Yersinia
           pestis Z176003]
 gi|320016569|gb|ADW00141.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia pestis
           biovar Medievalis str. Harbin 35]
          Length = 119

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 57/115 (49%), Positives = 79/115 (68%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAHRLP VP+ HKC R+HGHS+ V L + G+VD  +G+V DF  ++  F P+
Sbjct: 5   LFKDFQFEAAHRLPHVPEGHKCGRLHGHSFMVRLEVTGEVDAHSGWVMDFAALKAVFQPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+I  LENPT+E +A WIW++L   L  LS+V + ET  +   Y+G
Sbjct: 65  WERLDHHYLNDIPGLENPTSEVLARWIWQQLKPQLPELSAVMIKETCSAGCVYRG 119


>gi|238898787|ref|YP_002924469.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
 gi|229466547|gb|ACQ68321.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
          Length = 126

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 57/115 (49%), Positives = 79/115 (68%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAHRLP VP+ HKC R+HGHS+ V L + G +D K+G++ DF +++  F P+
Sbjct: 5   LFKEFQFEAAHRLPYVPEGHKCRRLHGHSFVVRLEIIGKIDTKSGWIMDFADLKAAFQPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
             KLDH  LN+IE LENPT+E +A+WIW RL   L  LSS+ + ET  +   Y+G
Sbjct: 65  WNKLDHQYLNDIEGLENPTSELLAVWIWDRLKPKLPQLSSITIKETCSAGCIYRG 119


>gi|238754505|ref|ZP_04615860.1| 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia ruckeri ATCC
           29473]
 gi|238707334|gb|EEP99696.1| 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia ruckeri ATCC
           29473]
          Length = 120

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 56/115 (48%), Positives = 78/115 (67%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAHRLP V + HKC R+HGHS+ V L + G+VD  +G+V DF  ++  F P+
Sbjct: 6   LFKDFQFEAAHRLPNVAEGHKCGRLHGHSFMVRLEVTGEVDAHSGWVMDFAELKAAFQPI 65

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDHH LN+I  LENPT+E +A WIW++L   L  LS+V V ET  +   Y+G
Sbjct: 66  WDRLDHHYLNDIAGLENPTSEVLAAWIWQQLKPQLPELSAVMVKETCSAGCIYRG 120


>gi|270264012|ref|ZP_06192280.1| hypothetical protein SOD_f02260 [Serratia odorifera 4Rx13]
 gi|270042205|gb|EFA15301.1| hypothetical protein SOD_f02260 [Serratia odorifera 4Rx13]
          Length = 119

 Score =  149 bits (376), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 60/115 (52%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAHRLP VP+ HKC R+HGHS+ V L + G+VD  TG+V DF  ++  FSP+
Sbjct: 5   LFKDFQFEAAHRLPHVPEGHKCGRLHGHSFMVRLEVTGEVDAHTGWVMDFAELKAVFSPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+I  LENPT+E +A WIW++L   L  LS+V V ET  +   Y+G
Sbjct: 65  WERLDHHYLNDIPGLENPTSEVLAAWIWQQLKPQLPELSAVMVKETCSAGCVYKG 119


>gi|322614205|gb|EFY11139.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322621705|gb|EFY18558.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322624006|gb|EFY20840.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322628900|gb|EFY25682.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322633375|gb|EFY30117.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322636049|gb|EFY32757.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322639597|gb|EFY36284.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322644303|gb|EFY40846.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322649814|gb|EFY46238.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322653527|gb|EFY49856.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322657621|gb|EFY53890.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322664532|gb|EFY60726.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322667354|gb|EFY63518.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322671241|gb|EFY67366.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322677863|gb|EFY73926.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322681037|gb|EFY77070.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322686298|gb|EFY82281.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323196124|gb|EFZ81286.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323198021|gb|EFZ83142.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323205091|gb|EFZ90070.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323207737|gb|EFZ92683.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323209877|gb|EFZ94792.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323214806|gb|EFZ99554.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323222535|gb|EGA06900.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323226415|gb|EGA10623.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323230706|gb|EGA14824.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323234943|gb|EGA19029.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323238982|gb|EGA23032.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323244661|gb|EGA28667.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323249829|gb|EGA33730.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323251047|gb|EGA34922.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323257215|gb|EGA40915.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323263281|gb|EGA46818.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323267532|gb|EGA51016.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323271059|gb|EGA54487.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
          Length = 120

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 55/115 (47%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF +++  F P 
Sbjct: 5   LYKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIMDFADLKAAFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDH+ LN+I  L NPT+E +A WIW ++   + +LS+V V ET  +   Y+G
Sbjct: 65  YDRLDHYYLNDIPGLSNPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCIYRG 119


>gi|188580424|ref|YP_001923869.1| queuosine biosynthesis protein QueD [Methylobacterium populi BJ001]
 gi|179343922|gb|ACB79334.1| queuosine biosynthesis protein QueD [Methylobacterium populi BJ001]
          Length = 118

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 84/117 (71%), Positives = 99/117 (84%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MKITQAFTFEAAHRLP VP+TH+CHRMHGHSYRVEL + G VDP TG+V DF++IE  F+
Sbjct: 1   MKITQAFTFEAAHRLPNVPETHRCHRMHGHSYRVELTVAGAVDPTTGWVVDFYDIESAFA 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PLLE+LDHHCLNEIE LENPTAE+IA WIW R   ++  L+SVR++ETP SW EY+G
Sbjct: 61  PLLERLDHHCLNEIEGLENPTAEHIAAWIWHRAKPAIPGLASVRIFETPYSWAEYEG 117


>gi|163850655|ref|YP_001638698.1| queuosine biosynthesis protein QueD [Methylobacterium extorquens
           PA1]
 gi|218529379|ref|YP_002420195.1| queuosine biosynthesis protein QueD [Methylobacterium
           chloromethanicum CM4]
 gi|240137709|ref|YP_002962180.1| putative 6-pyruvol tetrahydrobiopterin synthase [Methylobacterium
           extorquens AM1]
 gi|254560279|ref|YP_003067374.1| 6-pyruvol tetrahydrobiopterin synthase [Methylobacterium extorquens
           DM4]
 gi|163662260|gb|ABY29627.1| queuosine biosynthesis protein QueD [Methylobacterium extorquens
           PA1]
 gi|218521682|gb|ACK82267.1| queuosine biosynthesis protein QueD [Methylobacterium
           chloromethanicum CM4]
 gi|240007677|gb|ACS38903.1| putative 6-pyruvol tetrahydrobiopterin synthase [Methylobacterium
           extorquens AM1]
 gi|254267557|emb|CAX23399.1| putative 6-pyruvol tetrahydrobiopterin synthase [Methylobacterium
           extorquens DM4]
          Length = 118

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 84/117 (71%), Positives = 99/117 (84%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MKITQAFTFEAAHRLP VP+TH+CHRMHGHSYRVEL + G VDP +G+V DF++IE  F+
Sbjct: 1   MKITQAFTFEAAHRLPNVPQTHRCHRMHGHSYRVELTVSGAVDPTSGWVVDFYDIESAFA 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PLLE+LDHHCLNEIE LENPTAE+IA WIW R   ++  LSSVR++ETP SW EY+G
Sbjct: 61  PLLERLDHHCLNEIEGLENPTAEHIAAWIWHRAKPAIPGLSSVRIFETPYSWAEYEG 117


>gi|322831396|ref|YP_004211423.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Rahnella sp. Y9602]
 gi|321166597|gb|ADW72296.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Rahnella sp. Y9602]
          Length = 119

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 79/115 (68%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAH LP VP  HKC R+HGHS+ V L + G+VDP TG+V DF  ++  F+P 
Sbjct: 5   LFKDFQFEAAHHLPHVPAGHKCGRLHGHSFTVRLEITGEVDPHTGWVMDFAELKAAFNPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           L++LDH+ LN+I  LENPT+E +A WIW  +   L +LS+VRV ET  +   Y+G
Sbjct: 65  LDRLDHYNLNDIPGLENPTSEVLAAWIWNEMKPKLPLLSAVRVKETCTAGCVYKG 119


>gi|16761721|ref|NP_457338.1| 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|16766255|ref|NP_461870.1| 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|29143205|ref|NP_806547.1| 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56414894|ref|YP_151969.1| 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62181450|ref|YP_217867.1| putative synthase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161501997|ref|YP_001569109.1| hypothetical protein SARI_00013 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|167550194|ref|ZP_02343951.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|167993193|ref|ZP_02574288.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|168231030|ref|ZP_02656088.1| 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168235991|ref|ZP_02661049.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168242695|ref|ZP_02667627.1| 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168261916|ref|ZP_02683889.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|168463905|ref|ZP_02697822.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168820343|ref|ZP_02832343.1| 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194445925|ref|YP_002042191.1| 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194449237|ref|YP_002046907.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194472851|ref|ZP_03078835.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194738118|ref|YP_002115898.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197247377|ref|YP_002147848.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197263107|ref|ZP_03163181.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197363822|ref|YP_002143459.1| 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|198244543|ref|YP_002216916.1| 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200388847|ref|ZP_03215459.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204928214|ref|ZP_03219414.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205353889|ref|YP_002227690.1| 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207858209|ref|YP_002244860.1| 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|213022665|ref|ZP_03337112.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Typhi str. 404ty]
 gi|213163459|ref|ZP_03349169.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213422336|ref|ZP_03355402.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Typhi str. E01-6750]
 gi|213424927|ref|ZP_03357677.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Typhi str. E02-1180]
 gi|213581715|ref|ZP_03363541.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-0664]
 gi|213615974|ref|ZP_03371800.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-2068]
 gi|213648293|ref|ZP_03378346.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Typhi str. J185]
 gi|213852989|ref|ZP_03382521.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Typhi str. M223]
 gi|224584728|ref|YP_002638526.1| 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|238909721|ref|ZP_04653558.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Tennessee str.
           CDC07-0191]
 gi|289829810|ref|ZP_06547325.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|25321857|pir||AH0858 probable 6-pyruvoyltetrahydropterin synthase (EC 4.2.3.12)
           [imported] - Salmonella enterica subsp. enterica serovar
           Typhi (strain CT18)
 gi|16421499|gb|AAL21829.1| putative synthase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|16504022|emb|CAD06055.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Typhi]
 gi|29138838|gb|AAO70407.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
 gi|56129151|gb|AAV78657.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|62129083|gb|AAX66786.1| putative synthase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|160863344|gb|ABX19967.1| hypothetical protein SARI_00013 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|194404588|gb|ACF64810.1| 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194407541|gb|ACF67760.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194459215|gb|EDX48054.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194713620|gb|ACF92841.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195633519|gb|EDX51933.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197095299|emb|CAR60855.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str.
           AKU_12601]
 gi|197211080|gb|ACH48477.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197241362|gb|EDY23982.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197290790|gb|EDY30144.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197939059|gb|ACH76392.1| 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|199605945|gb|EDZ04490.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204322536|gb|EDZ07733.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205273670|emb|CAR38660.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|205324819|gb|EDZ12658.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205328718|gb|EDZ15482.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|205334410|gb|EDZ21174.1| 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205337963|gb|EDZ24727.1| 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205342824|gb|EDZ29588.1| 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205349073|gb|EDZ35704.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206710012|emb|CAR34367.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
 gi|224469255|gb|ACN47085.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
 gi|261248084|emb|CBG25919.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           D23580]
 gi|267995082|gb|ACY89967.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           14028S]
 gi|301159508|emb|CBW19027.1| 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312913968|dbj|BAJ37942.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|320087360|emb|CBY97125.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           2007-60-3289-1]
 gi|322715934|gb|EFZ07505.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Choleraesuis str. A50]
 gi|323131303|gb|ADX18733.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. 4/74]
 gi|326624679|gb|EGE31024.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Dublin str. 3246]
 gi|326629001|gb|EGE35344.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 9]
 gi|332989820|gb|AEF08803.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. UK-1]
          Length = 120

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 55/115 (47%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF +++  F P 
Sbjct: 5   LYKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIMDFADLKAAFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDH+ LN+I  L NPT+E +A WIW ++   + +LS+V V ET  +   Y+G
Sbjct: 65  YDRLDHYYLNDIPGLSNPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCVYRG 119


>gi|46203558|ref|ZP_00209017.1| COG0720: 6-pyruvoyl-tetrahydropterin synthase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 118

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 82/117 (70%), Positives = 98/117 (83%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MKITQAFTFEAAHRLP VP+TH+CHRMHGHSYRVEL + G VDP +G+V DF+ IE  F+
Sbjct: 1   MKITQAFTFEAAHRLPNVPETHRCHRMHGHSYRVELTVAGAVDPDSGWVIDFYEIESAFA 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PLLE+LDHHCLNEIE LENPT E+IA WIW R   ++  L+SVR++ETP+SW EY+G
Sbjct: 61  PLLERLDHHCLNEIEGLENPTGEHIAAWIWHRAKPAIPGLASVRIFETPLSWAEYEG 117


>gi|330965572|gb|EGH65832.1| 6-pyruvoyl tetrahydrobiopterin synthase [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 140

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 62/116 (53%), Positives = 82/116 (70%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I + FTFE+AH LP VP+ HKC R+HGHS+RV + + G VDP TG++ DF  I+  F P
Sbjct: 24  EIFKEFTFESAHLLPHVPEGHKCGRLHGHSFRVGIHLAGKVDPHTGWIRDFSEIKAIFKP 83

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           L E+LDH+ LN+I  LENPT+EN+A WIW  L   L  LS++R++ET  S  EY G
Sbjct: 84  LYERLDHNYLNDIPGLENPTSENLAKWIWNELKPLLPELSAIRIHETCTSGCEYGG 139


>gi|330810826|ref|YP_004355288.1| 6-pyruvoyltetrahydropterin synthase [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327378934|gb|AEA70284.1| 6-pyruvoyltetrahydropterin synthase [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 118

 Score =  148 bits (374), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 82/117 (70%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + FTFE+AHRLP VP  HKC R+HGHS++V + + GD+DP TG++ DF  I+  F 
Sbjct: 1   MEIFKEFTFESAHRLPHVPDGHKCGRLHGHSFKVAIHLSGDIDPHTGWIRDFSEIKAIFK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PL E+LDH+ LN+I  LENPT+E +A WIW  L   L  LS++R++ET  S   Y G
Sbjct: 61  PLYERLDHNYLNDIPGLENPTSEVLAKWIWNELKPLLPELSAIRIHETCTSGCIYHG 117


>gi|283835466|ref|ZP_06355207.1| queuosine biosynthesis protein QueD [Citrobacter youngae ATCC
           29220]
 gi|291068649|gb|EFE06758.1| queuosine biosynthesis protein QueD [Citrobacter youngae ATCC
           29220]
          Length = 120

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 56/115 (48%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 5   LFKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIMDFAELKAAFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDH+ LN+I  LENPT+E +A WIW ++   + +LS+V V ET  +   Y+G
Sbjct: 65  YDRLDHYYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCVYRG 119


>gi|217977589|ref|YP_002361736.1| queuosine biosynthesis protein QueD [Methylocella silvestris BL2]
 gi|217502965|gb|ACK50374.1| queuosine biosynthesis protein QueD [Methylocella silvestris BL2]
          Length = 118

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 81/117 (69%), Positives = 94/117 (80%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MKITQAF FEAAHRLP V +TH+CHR+HGHSYRVEL ++G VDP TGFV DFF+IE  F 
Sbjct: 1   MKITQAFHFEAAHRLPHVAETHRCHRLHGHSYRVELELQGPVDPVTGFVVDFFDIEAAFG 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PLL +LDHH LNEIE LENPTAE IAIWI++R+   L  LS V+V+ETP  W EY+G
Sbjct: 61  PLLARLDHHFLNEIEGLENPTAELIAIWIFERIRGPLPQLSCVKVFETPDCWAEYEG 117


>gi|322615666|gb|EFY12586.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315996572]
 gi|322618726|gb|EFY15615.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-1]
 gi|322621860|gb|EFY18710.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-3]
 gi|322627585|gb|EFY24376.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-4]
 gi|322630891|gb|EFY27655.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-1]
 gi|322637890|gb|EFY34591.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-2]
 gi|322643876|gb|EFY40424.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322651047|gb|EFY47432.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           OH_2009072675]
 gi|322656699|gb|EFY52987.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322659876|gb|EFY56119.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 19N]
 gi|322661914|gb|EFY58130.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           81038-01]
 gi|322666339|gb|EFY62517.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MD_MDA09249507]
 gi|322672758|gb|EFY68869.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 414877]
 gi|322676188|gb|EFY72259.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 366867]
 gi|322680672|gb|EFY76710.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 413180]
 gi|322684434|gb|EFY80438.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 446600]
 gi|323194229|gb|EFZ79426.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           609458-1]
 gi|323197374|gb|EFZ82514.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           556150-1]
 gi|323201508|gb|EFZ86572.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 609460]
 gi|323206022|gb|EFZ90984.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           507440-20]
 gi|323213034|gb|EFZ97836.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 556152]
 gi|323215406|gb|EGA00150.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB101509-0077]
 gi|323219389|gb|EGA03874.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB102109-0047]
 gi|323227693|gb|EGA11847.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB110209-0055]
 gi|323228863|gb|EGA12992.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB111609-0052]
 gi|323236526|gb|EGA20602.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009083312]
 gi|323239974|gb|EGA24021.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009085258]
 gi|323241980|gb|EGA26009.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315731156]
 gi|323247873|gb|EGA31810.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2009159199]
 gi|323251488|gb|EGA35359.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008282]
 gi|323258146|gb|EGA41823.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008283]
 gi|323263711|gb|EGA47232.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008284]
 gi|323265695|gb|EGA49191.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008285]
 gi|323270140|gb|EGA53588.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008287]
          Length = 120

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 56/115 (48%), Positives = 78/115 (67%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP  HKC R+HGHS+ V L + G++D   G++ DF  ++  F P 
Sbjct: 5   LYKDFTFEAAHRLPNVPDGHKCGRLHGHSFVVRLEITGEMDKHAGWIIDFAELKAIFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           L++LDH+ LN+I  LENPT+E +A WIW ++   L ILS+V V ET  +   Y+G
Sbjct: 65  LDRLDHYYLNDIPGLENPTSEVLAQWIWNQVKPQLPILSAVIVKETCSAGCIYRG 119


>gi|220926505|ref|YP_002501807.1| queuosine biosynthesis protein QueD [Methylobacterium nodulans ORS
           2060]
 gi|219951112|gb|ACL61504.1| queuosine biosynthesis protein QueD [Methylobacterium nodulans ORS
           2060]
          Length = 118

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 80/117 (68%), Positives = 97/117 (82%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MKITQAFTFEAAH LP VP+TH+C RMHGHSYRVEL ++G VDP TG+V DF+++E  F+
Sbjct: 1   MKITQAFTFEAAHWLPNVPETHRCRRMHGHSYRVELTLDGPVDPHTGWVVDFYDVEHAFA 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PLL +LDHHCLN++  LENPTAE+IAIWIW R   +L  LSSV+V+ETP+SW EY G
Sbjct: 61  PLLAELDHHCLNDLPGLENPTAEHIAIWIWNRARPALPALSSVKVFETPLSWAEYTG 117


>gi|15803283|ref|NP_289315.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           O157:H7 EDL933]
 gi|15832874|ref|NP_311647.1| 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli O157:H7
           str. Sakai]
 gi|16130672|ref|NP_417245.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Escherichia coli
           str. K-12 substr. MG1655]
 gi|74313335|ref|YP_311754.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Shigella sonnei
           Ss046]
 gi|82545067|ref|YP_409014.1| 6-pyruvoyl tetrahydrobiopterin synthase [Shigella boydii Sb227]
 gi|89109552|ref|AP_003332.1| 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli str. K-12
           substr. W3110]
 gi|157156799|ref|YP_001464087.1| queuosine biosynthesis protein QueD [Escherichia coli E24377A]
 gi|157162215|ref|YP_001459533.1| queuosine biosynthesis protein QueD [Escherichia coli HS]
 gi|170018989|ref|YP_001723943.1| 6-pyruvoyl tetrahydropterin synthase [Escherichia coli ATCC 8739]
 gi|170082339|ref|YP_001731659.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Escherichia coli
           str. K-12 substr. DH10B]
 gi|187732204|ref|YP_001881494.1| queuosine biosynthesis protein QueD [Shigella boydii CDC 3083-94]
 gi|188493968|ref|ZP_03001238.1| putative 6-pyruvoyl tetrahydropterin synthase [Escherichia coli
           53638]
 gi|218547715|ref|YP_002381506.1| 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia fergusonii
           ATCC 35469]
 gi|218555313|ref|YP_002388226.1| 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli IAI1]
 gi|218696364|ref|YP_002404031.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Escherichia coli
           55989]
 gi|238901902|ref|YP_002927698.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Escherichia coli
           BW2952]
 gi|253772384|ref|YP_003035215.1| 6-pyruvoyl tetrahydropterin synthase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254162691|ref|YP_003045799.1| 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli B str.
           REL606]
 gi|254794706|ref|YP_003079543.1| 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli O157:H7
           str. TW14359]
 gi|260845412|ref|YP_003223190.1| 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli O103:H2
           str. 12009]
 gi|260856876|ref|YP_003230767.1| 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli O26:H11
           str. 11368]
 gi|260869445|ref|YP_003235847.1| 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli O111:H-
           str. 11128]
 gi|297516936|ref|ZP_06935322.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           OP50]
 gi|300815820|ref|ZP_07096044.1| queuosine biosynthesis protein QueD [Escherichia coli MS 107-1]
 gi|300820554|ref|ZP_07100705.1| queuosine biosynthesis protein QueD [Escherichia coli MS 119-7]
 gi|300906713|ref|ZP_07124400.1| queuosine biosynthesis protein QueD [Escherichia coli MS 84-1]
 gi|300921452|ref|ZP_07137808.1| queuosine biosynthesis protein QueD [Escherichia coli MS 115-1]
 gi|300925204|ref|ZP_07141107.1| queuosine biosynthesis protein QueD [Escherichia coli MS 182-1]
 gi|300931219|ref|ZP_07146561.1| queuosine biosynthesis protein QueD [Escherichia coli MS 187-1]
 gi|300950491|ref|ZP_07164402.1| queuosine biosynthesis protein QueD [Escherichia coli MS 116-1]
 gi|300958076|ref|ZP_07170238.1| queuosine biosynthesis protein QueD [Escherichia coli MS 175-1]
 gi|301304531|ref|ZP_07210641.1| queuosine biosynthesis protein QueD [Escherichia coli MS 124-1]
 gi|301326190|ref|ZP_07219573.1| queuosine biosynthesis protein QueD [Escherichia coli MS 78-1]
 gi|301643334|ref|ZP_07243395.1| queuosine biosynthesis protein QueD [Escherichia coli MS 146-1]
 gi|307312806|ref|ZP_07592436.1| 6-pyruvoyl tetrahydropterin synthase [Escherichia coli W]
 gi|309795238|ref|ZP_07689657.1| queuosine biosynthesis protein QueD [Escherichia coli MS 145-7]
 gi|331643449|ref|ZP_08344580.1| queuosine biosynthesis protein QueD [Escherichia coli H736]
 gi|331654245|ref|ZP_08355245.1| queuosine biosynthesis protein QueD [Escherichia coli M718]
 gi|331674262|ref|ZP_08375022.1| queuosine biosynthesis protein QueD [Escherichia coli TA280]
 gi|331678750|ref|ZP_08379424.1| queuosine biosynthesis protein QueD [Escherichia coli H591]
 gi|54038916|sp|P65871|QUED_ECO57 RecName: Full=6-carboxy-5,6,7,8-tetrahydropterin synthase;
           Short=CPH4 synthase; AltName: Full=Queuosine
           biosynthesis protein queD
 gi|54038917|sp|P65872|QUED_SHIFL RecName: Full=6-carboxy-5,6,7,8-tetrahydropterin synthase;
           Short=CPH4 synthase; AltName: Full=Queuosine
           biosynthesis protein queD
 gi|54041743|sp|P65870|QUED_ECOLI RecName: Full=6-carboxy-5,6,7,8-tetrahydropterin synthase;
           Short=CPH4 synthase; AltName: Full=Queuosine
           biosynthesis protein queD
 gi|12517226|gb|AAG57873.1|AE005504_5 putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           O157:H7 str. EDL933]
 gi|882658|gb|AAA69275.1| ORF_o121 [Escherichia coli str. K-12 substr. MG1655]
 gi|1789124|gb|AAC75807.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Escherichia coli
           str. K-12 substr. MG1655]
 gi|13363091|dbj|BAB37043.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           O157:H7 str. Sakai]
 gi|73856812|gb|AAZ89519.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Shigella sonnei
           Ss046]
 gi|81246478|gb|ABB67186.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Shigella boydii
           Sb227]
 gi|85675586|dbj|BAE76842.1| 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli str. K12
           substr. W3110]
 gi|157067895|gb|ABV07150.1| queuosine biosynthesis protein QueD [Escherichia coli HS]
 gi|157078829|gb|ABV18537.1| queuosine biosynthesis protein QueD [Escherichia coli E24377A]
 gi|169753917|gb|ACA76616.1| 6-pyruvoyl tetrahydropterin synthase [Escherichia coli ATCC 8739]
 gi|169890174|gb|ACB03881.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Escherichia coli
           str. K-12 substr. DH10B]
 gi|187429196|gb|ACD08470.1| queuosine biosynthesis protein QueD [Shigella boydii CDC 3083-94]
 gi|188489167|gb|EDU64270.1| putative 6-pyruvoyl tetrahydropterin synthase [Escherichia coli
           53638]
 gi|209761618|gb|ACI79121.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli]
 gi|209761620|gb|ACI79122.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli]
 gi|209761622|gb|ACI79123.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli]
 gi|209761624|gb|ACI79124.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli]
 gi|209761626|gb|ACI79125.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli]
 gi|218353096|emb|CAU98921.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Escherichia coli
           55989]
 gi|218355256|emb|CAQ87863.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Escherichia
           fergusonii ATCC 35469]
 gi|218362081|emb|CAQ99690.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Escherichia coli
           IAI1]
 gi|238859892|gb|ACR61890.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Escherichia coli
           BW2952]
 gi|242378313|emb|CAQ33090.1| 6-carboxy-5,6,7,8-tetrahydropterin synthase [Escherichia coli
           BL21(DE3)]
 gi|253323428|gb|ACT28030.1| 6-pyruvoyl tetrahydropterin synthase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253974592|gb|ACT40263.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Escherichia coli B
           str. REL606]
 gi|253978757|gb|ACT44427.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Escherichia coli
           BL21(DE3)]
 gi|254594106|gb|ACT73467.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Escherichia coli
           O157:H7 str. TW14359]
 gi|257755525|dbj|BAI27027.1| 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli O26:H11
           str. 11368]
 gi|257760559|dbj|BAI32056.1| 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli O103:H2
           str. 12009]
 gi|257765801|dbj|BAI37296.1| 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli O111:H-
           str. 11128]
 gi|260448184|gb|ACX38606.1| 6-pyruvoyl tetrahydropterin synthase [Escherichia coli DH1]
 gi|284922702|emb|CBG35790.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           042]
 gi|300315229|gb|EFJ65013.1| queuosine biosynthesis protein QueD [Escherichia coli MS 175-1]
 gi|300401518|gb|EFJ85056.1| queuosine biosynthesis protein QueD [Escherichia coli MS 84-1]
 gi|300411627|gb|EFJ94937.1| queuosine biosynthesis protein QueD [Escherichia coli MS 115-1]
 gi|300418664|gb|EFK01975.1| queuosine biosynthesis protein QueD [Escherichia coli MS 182-1]
 gi|300450187|gb|EFK13807.1| queuosine biosynthesis protein QueD [Escherichia coli MS 116-1]
 gi|300460952|gb|EFK24445.1| queuosine biosynthesis protein QueD [Escherichia coli MS 187-1]
 gi|300526818|gb|EFK47887.1| queuosine biosynthesis protein QueD [Escherichia coli MS 119-7]
 gi|300531749|gb|EFK52811.1| queuosine biosynthesis protein QueD [Escherichia coli MS 107-1]
 gi|300840135|gb|EFK67895.1| queuosine biosynthesis protein QueD [Escherichia coli MS 124-1]
 gi|300847035|gb|EFK74795.1| queuosine biosynthesis protein QueD [Escherichia coli MS 78-1]
 gi|301078272|gb|EFK93078.1| queuosine biosynthesis protein QueD [Escherichia coli MS 146-1]
 gi|306907241|gb|EFN37747.1| 6-pyruvoyl tetrahydropterin synthase [Escherichia coli W]
 gi|308121209|gb|EFO58471.1| queuosine biosynthesis protein QueD [Escherichia coli MS 145-7]
 gi|309703125|emb|CBJ02458.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           ETEC H10407]
 gi|315062047|gb|ADT76374.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Escherichia coli W]
 gi|315137372|dbj|BAJ44531.1| conserved hypothetical protein [Escherichia coli DH1]
 gi|315256622|gb|EFU36590.1| queuosine biosynthesis protein QueD [Escherichia coli MS 85-1]
 gi|320640411|gb|EFX09950.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           O157:H7 str. G5101]
 gi|320656682|gb|EFX24575.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           O55:H7 str. 3256-97 TW 07815]
 gi|323935759|gb|EGB32068.1| 6-pyruvoyl tetrahydropterin synthase [Escherichia coli E1520]
 gi|324016276|gb|EGB85495.1| queuosine biosynthesis protein QueD [Escherichia coli MS 117-3]
 gi|324119806|gb|EGC13685.1| 6-pyruvoyl tetrahydropterin synthase [Escherichia coli E1167]
 gi|331036920|gb|EGI09144.1| queuosine biosynthesis protein QueD [Escherichia coli H736]
 gi|331047627|gb|EGI19704.1| queuosine biosynthesis protein QueD [Escherichia coli M718]
 gi|331068356|gb|EGI39751.1| queuosine biosynthesis protein QueD [Escherichia coli TA280]
 gi|331073580|gb|EGI44901.1| queuosine biosynthesis protein QueD [Escherichia coli H591]
          Length = 121

 Score =  148 bits (373), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 6   LFKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIIDFAELKAAFKPT 65

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+I  LENPT+E +A WIW ++   + +LS+V V ET  +   Y+G
Sbjct: 66  YERLDHHYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCIYRG 120


>gi|56551714|ref|YP_162553.1| queuosine biosynthesis protein QueD [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241762293|ref|ZP_04760374.1| queuosine biosynthesis protein QueD [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|260752711|ref|YP_003225604.1| hypothetical protein Za10_0470 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|6685120|gb|AAF23791.1|AF213822_6 hypothetical protein [Zymomonas mobilis subsp. mobilis ZM4]
 gi|56543288|gb|AAV89442.1| queuosine biosynthesis protein QueD [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241373196|gb|EER62826.1| queuosine biosynthesis protein QueD [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|258552074|gb|ACV75020.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 118

 Score =  148 bits (373), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 76/117 (64%), Positives = 97/117 (82%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+ITQAFTFEAAHRLP VP+TH+C R+HGHSYRVEL +EG V+P+TGFV DFF++E  F 
Sbjct: 1   MRITQAFTFEAAHRLPHVPETHRCRRLHGHSYRVELRLEGAVNPETGFVVDFFDVEHIFG 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+L++LDH+CLN+I  LENPTAENI+ WIW+++   L +L++V VYETP  W EY G
Sbjct: 61  PVLKQLDHYCLNDIPGLENPTAENISQWIWRKIKNDLPLLAAVTVYETPHCWAEYLG 117


>gi|218701249|ref|YP_002408878.1| 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli IAI39]
 gi|300936427|ref|ZP_07151348.1| queuosine biosynthesis protein QueD [Escherichia coli MS 21-1]
 gi|218371235|emb|CAR19066.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Escherichia coli
           IAI39]
 gi|300458427|gb|EFK21920.1| queuosine biosynthesis protein QueD [Escherichia coli MS 21-1]
          Length = 121

 Score =  148 bits (373), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 56/115 (48%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 6   LFKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIIDFAELKAAFKPT 65

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDH+ LN+I  LENPT+E +A WIW ++   + +LS+V V ET  +   Y+G
Sbjct: 66  YDRLDHYYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCIYRG 120


>gi|30064114|ref|NP_838285.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Shigella flexneri
           2a str. 2457T]
 gi|56480179|ref|NP_708563.2| putative 6-pyruvoyl tetrahydrobiopterin synthase [Shigella flexneri
           2a str. 301]
 gi|168755513|ref|ZP_02780520.1| queuosine biosynthesis protein QueD [Escherichia coli O157:H7 str.
           EC4401]
 gi|168762832|ref|ZP_02787839.1| queuosine biosynthesis protein QueD [Escherichia coli O157:H7 str.
           EC4501]
 gi|168768860|ref|ZP_02793867.1| queuosine biosynthesis protein QueD [Escherichia coli O157:H7 str.
           EC4486]
 gi|168774699|ref|ZP_02799706.1| queuosine biosynthesis protein QueD [Escherichia coli O157:H7 str.
           EC4196]
 gi|168778751|ref|ZP_02803758.1| queuosine biosynthesis protein QueD [Escherichia coli O157:H7 str.
           EC4076]
 gi|168788022|ref|ZP_02813029.1| queuosine biosynthesis protein QueD [Escherichia coli O157:H7 str.
           EC869]
 gi|168800153|ref|ZP_02825160.1| queuosine biosynthesis protein QueD [Escherichia coli O157:H7 str.
           EC508]
 gi|170682185|ref|YP_001744918.1| queuosine biosynthesis protein QueD [Escherichia coli SMS-3-5]
 gi|188024939|ref|ZP_02997304.1| queuosine biosynthesis protein QueD [Escherichia coli O157:H7 str.
           EC4113]
 gi|191166821|ref|ZP_03028647.1| queuosine biosynthesis protein QueD [Escherichia coli B7A]
 gi|193065033|ref|ZP_03046108.1| queuosine biosynthesis protein QueD [Escherichia coli E22]
 gi|193069628|ref|ZP_03050580.1| queuosine biosynthesis protein QueD [Escherichia coli E110019]
 gi|194427920|ref|ZP_03060466.1| queuosine biosynthesis protein QueD [Escherichia coli B171]
 gi|194438942|ref|ZP_03071026.1| queuosine biosynthesis protein QueD [Escherichia coli 101-1]
 gi|195939479|ref|ZP_03084861.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           O157:H7 str. EC4024]
 gi|208808354|ref|ZP_03250691.1| queuosine biosynthesis protein QueD [Escherichia coli O157:H7 str.
           EC4206]
 gi|208812280|ref|ZP_03253609.1| queuosine biosynthesis protein QueD [Escherichia coli O157:H7 str.
           EC4045]
 gi|208819761|ref|ZP_03260081.1| queuosine biosynthesis protein QueD [Escherichia coli O157:H7 str.
           EC4042]
 gi|209396419|ref|YP_002272230.1| queuosine biosynthesis protein QueD [Escherichia coli O157:H7 str.
           EC4115]
 gi|209920212|ref|YP_002294296.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           SE11]
 gi|217327100|ref|ZP_03443183.1| queuosine biosynthesis protein QueD [Escherichia coli O157:H7 str.
           TW14588]
 gi|256019449|ref|ZP_05433314.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Shigella sp. D9]
 gi|256024733|ref|ZP_05438598.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia sp.
           4_1_40B]
 gi|261226061|ref|ZP_05940342.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261256683|ref|ZP_05949216.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           O157:H7 str. FRIK966]
 gi|293412113|ref|ZP_06654836.1| 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli B354]
 gi|293449091|ref|ZP_06663512.1| 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli B088]
 gi|301020747|ref|ZP_07184814.1| queuosine biosynthesis protein QueD [Escherichia coli MS 196-1]
 gi|307139449|ref|ZP_07498805.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           H736]
 gi|312973020|ref|ZP_07787193.1| queuosine biosynthesis protein QueD [Escherichia coli 1827-70]
 gi|331669507|ref|ZP_08370353.1| queuosine biosynthesis protein QueD [Escherichia coli TA271]
 gi|30042370|gb|AAP18095.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Shigella flexneri
           2a str. 2457T]
 gi|56383730|gb|AAN44270.2| putative 6-pyruvoyl tetrahydrobiopterin synthase [Shigella flexneri
           2a str. 301]
 gi|170519903|gb|ACB18081.1| queuosine biosynthesis protein QueD [Escherichia coli SMS-3-5]
 gi|187769665|gb|EDU33509.1| queuosine biosynthesis protein QueD [Escherichia coli O157:H7 str.
           EC4196]
 gi|188015773|gb|EDU53895.1| queuosine biosynthesis protein QueD [Escherichia coli O157:H7 str.
           EC4113]
 gi|189003378|gb|EDU72364.1| queuosine biosynthesis protein QueD [Escherichia coli O157:H7 str.
           EC4076]
 gi|189357368|gb|EDU75787.1| queuosine biosynthesis protein QueD [Escherichia coli O157:H7 str.
           EC4401]
 gi|189362073|gb|EDU80492.1| queuosine biosynthesis protein QueD [Escherichia coli O157:H7 str.
           EC4486]
 gi|189366916|gb|EDU85332.1| queuosine biosynthesis protein QueD [Escherichia coli O157:H7 str.
           EC4501]
 gi|189372211|gb|EDU90627.1| queuosine biosynthesis protein QueD [Escherichia coli O157:H7 str.
           EC869]
 gi|189377514|gb|EDU95930.1| queuosine biosynthesis protein QueD [Escherichia coli O157:H7 str.
           EC508]
 gi|190903192|gb|EDV62915.1| queuosine biosynthesis protein QueD [Escherichia coli B7A]
 gi|192927330|gb|EDV81949.1| queuosine biosynthesis protein QueD [Escherichia coli E22]
 gi|192956991|gb|EDV87442.1| queuosine biosynthesis protein QueD [Escherichia coli E110019]
 gi|194414153|gb|EDX30429.1| queuosine biosynthesis protein QueD [Escherichia coli B171]
 gi|194422063|gb|EDX38066.1| queuosine biosynthesis protein QueD [Escherichia coli 101-1]
 gi|208728155|gb|EDZ77756.1| queuosine biosynthesis protein QueD [Escherichia coli O157:H7 str.
           EC4206]
 gi|208733557|gb|EDZ82244.1| queuosine biosynthesis protein QueD [Escherichia coli O157:H7 str.
           EC4045]
 gi|208739884|gb|EDZ87566.1| queuosine biosynthesis protein QueD [Escherichia coli O157:H7 str.
           EC4042]
 gi|209157819|gb|ACI35252.1| queuosine biosynthesis protein QueD [Escherichia coli O157:H7 str.
           EC4115]
 gi|209913471|dbj|BAG78545.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           SE11]
 gi|217319467|gb|EEC27892.1| queuosine biosynthesis protein QueD [Escherichia coli O157:H7 str.
           TW14588]
 gi|291322181|gb|EFE61610.1| 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli B088]
 gi|291468884|gb|EFF11375.1| 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli B354]
 gi|299881768|gb|EFI89979.1| queuosine biosynthesis protein QueD [Escherichia coli MS 196-1]
 gi|310332962|gb|EFQ00176.1| queuosine biosynthesis protein QueD [Escherichia coli 1827-70]
 gi|313647826|gb|EFS12272.1| queuosine biosynthesis protein QueD [Shigella flexneri 2a str.
           2457T]
 gi|315615149|gb|EFU95786.1| queuosine biosynthesis protein QueD [Escherichia coli 3431]
 gi|320174840|gb|EFW49962.1| Queuosine biosynthesis QueD, PTPS-I [Shigella dysenteriae CDC
           74-1112]
 gi|320180802|gb|EFW55725.1| Queuosine biosynthesis QueD, PTPS-I [Shigella boydii ATCC 9905]
 gi|320183534|gb|EFW58381.1| Queuosine biosynthesis QueD, PTPS-I [Shigella flexneri CDC 796-83]
 gi|320189093|gb|EFW63752.1| Queuosine biosynthesis QueD, PTPS-I [Escherichia coli O157:H7 str.
           EC1212]
 gi|320202415|gb|EFW76985.1| Queuosine biosynthesis QueD, PTPS-I [Escherichia coli EC4100B]
 gi|320645956|gb|EFX14937.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           O157:H- str. 493-89]
 gi|320651256|gb|EFX19691.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           O157:H- str. H 2687]
 gi|320662349|gb|EFX29746.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           O55:H7 str. USDA 5905]
 gi|320667401|gb|EFX34359.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           O157:H7 str. LSU-61]
 gi|323154994|gb|EFZ41186.1| queuosine biosynthesis protein QueD [Escherichia coli EPECa14]
 gi|323159921|gb|EFZ45891.1| queuosine biosynthesis protein QueD [Escherichia coli E128010]
 gi|323167210|gb|EFZ52927.1| queuosine biosynthesis protein QueD [Shigella sonnei 53G]
 gi|323172934|gb|EFZ58565.1| queuosine biosynthesis protein QueD [Escherichia coli LT-68]
 gi|323180193|gb|EFZ65745.1| queuosine biosynthesis protein QueD [Escherichia coli 1180]
 gi|323183301|gb|EFZ68698.1| queuosine biosynthesis protein QueD [Escherichia coli 1357]
 gi|323941403|gb|EGB37586.1| 6-pyruvoyl tetrahydropterin synthase [Escherichia coli E482]
 gi|323946439|gb|EGB42466.1| 6-pyruvoyl tetrahydropterin synthase [Escherichia coli H120]
 gi|323960658|gb|EGB56283.1| 6-pyruvoyl tetrahydropterin synthase [Escherichia coli H489]
 gi|323971572|gb|EGB66804.1| 6-pyruvoyl tetrahydropterin synthase [Escherichia coli TA007]
 gi|323978625|gb|EGB73707.1| 6-pyruvoyl tetrahydropterin synthase [Escherichia coli TW10509]
 gi|326339168|gb|EGD62983.1| Queuosine biosynthesis QueD, PTPS-I [Escherichia coli O157:H7 str.
           1044]
 gi|326342949|gb|EGD66717.1| Queuosine biosynthesis QueD, PTPS-I [Escherichia coli O157:H7 str.
           1125]
 gi|331063175|gb|EGI35088.1| queuosine biosynthesis protein QueD [Escherichia coli TA271]
 gi|332087370|gb|EGI92498.1| queuosine biosynthesis protein QueD [Shigella boydii 5216-82]
 gi|332091882|gb|EGI96960.1| queuosine biosynthesis protein QueD [Shigella boydii 3594-74]
 gi|332344654|gb|AEE57988.1| queuosine biosynthesis protein QueD [Escherichia coli UMNK88]
 gi|332753483|gb|EGJ83863.1| queuosine biosynthesis protein QueD [Shigella flexneri 4343-70]
 gi|332753617|gb|EGJ83996.1| queuosine biosynthesis protein QueD [Shigella flexneri K-671]
 gi|332755612|gb|EGJ85975.1| queuosine biosynthesis protein QueD [Shigella flexneri 2747-71]
 gi|332765713|gb|EGJ95926.1| queuosine biosynthesis protein QueD [Shigella flexneri 2930-71]
 gi|332999513|gb|EGK19098.1| queuosine biosynthesis protein QueD [Shigella flexneri VA-6]
 gi|332999986|gb|EGK19569.1| queuosine biosynthesis protein QueD [Shigella flexneri K-218]
 gi|333001112|gb|EGK20682.1| queuosine biosynthesis protein QueD [Shigella flexneri K-272]
 gi|333015342|gb|EGK34682.1| queuosine biosynthesis protein QueD [Shigella flexneri K-304]
 gi|333015383|gb|EGK34722.1| queuosine biosynthesis protein QueD [Shigella flexneri K-227]
          Length = 120

 Score =  148 bits (373), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 5   LFKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIIDFAELKAAFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+I  LENPT+E +A WIW ++   + +LS+V V ET  +   Y+G
Sbjct: 65  YERLDHHYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCIYRG 119


>gi|154247120|ref|YP_001418078.1| putative 6-pyruvoyl tetrahydropterin synthase [Xanthobacter
           autotrophicus Py2]
 gi|154161205|gb|ABS68421.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Xanthobacter autotrophicus Py2]
          Length = 129

 Score =  148 bits (373), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 77/116 (66%), Positives = 93/116 (80%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +ITQ FTFEAAH LP VP+TH+C RMHGHSYRV+L +EG VD  TGFV DFF++E  F P
Sbjct: 13  RITQGFTFEAAHFLPHVPETHRCRRMHGHSYRVDLTLEGPVDAVTGFVVDFFDVEAAFGP 72

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           +L++LDH+CLNE+E LENPTAE IA WIW R+   L +LSSVRVYETP S+ E+ G
Sbjct: 73  VLKQLDHYCLNEVEGLENPTAEIIAAWIWDRVKPVLPLLSSVRVYETPFSFAEFDG 128


>gi|331684387|ref|ZP_08384979.1| queuosine biosynthesis protein QueD [Escherichia coli H299]
 gi|331078002|gb|EGI49208.1| queuosine biosynthesis protein QueD [Escherichia coli H299]
          Length = 120

 Score =  148 bits (373), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 5   LFKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIIDFAELKAAFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+I  LENPT+E +A WIW ++   + +LS+V V ET  +   Y+G
Sbjct: 65  YERLDHHYLNDIPGLENPTSEILAKWIWDQVKPVVPLLSAVMVKETCTAGCIYRG 119


>gi|82778135|ref|YP_404484.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Shigella
           dysenteriae Sd197]
 gi|81242283|gb|ABB62993.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Shigella
           dysenteriae Sd197]
          Length = 121

 Score =  148 bits (373), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 6   LFKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIIDFAELKAAFKPT 65

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+I  LENPT+E +A WIW ++   + +LS+V V ET  +   Y+G
Sbjct: 66  YERLDHHYLNDIPGLENPTSEVLAKWIWDQVKPIVPLLSAVMVKETCTAGCIYRG 120


>gi|238791242|ref|ZP_04634881.1| 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia intermedia ATCC
           29909]
 gi|238729375|gb|EEQ20890.1| 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia intermedia ATCC
           29909]
          Length = 120

 Score =  148 bits (373), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 55/115 (47%), Positives = 79/115 (68%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAHRLP V + HKC R+HGHS+ V + + G+VD  +G+V DF +++  F P+
Sbjct: 5   LFKDFQFEAAHRLPHVAEGHKCGRLHGHSFMVRIEVTGEVDAHSGWVMDFADLKAAFKPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDH+ LN+I  LENPT+E +A WIW++L   L  LS+V V ET  +   Y+G
Sbjct: 65  WERLDHYYLNDIPGLENPTSEVLASWIWQQLKPQLPELSAVMVKETCSAGCVYRG 119


>gi|331664325|ref|ZP_08365231.1| queuosine biosynthesis protein QueD [Escherichia coli TA143]
 gi|323966741|gb|EGB62172.1| 6-pyruvoyl tetrahydropterin synthase [Escherichia coli M863]
 gi|324111399|gb|EGC05381.1| 6-pyruvoyl tetrahydropterin synthase [Escherichia fergusonii B253]
 gi|327251499|gb|EGE63185.1| queuosine biosynthesis protein QueD [Escherichia coli STEC_7v]
 gi|331058256|gb|EGI30237.1| queuosine biosynthesis protein QueD [Escherichia coli TA143]
          Length = 120

 Score =  148 bits (373), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 56/115 (48%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 5   LFKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIIDFAELKAAFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDH+ LN+I  LENPT+E +A WIW ++   + +LS+V V ET  +   Y+G
Sbjct: 65  YDRLDHYYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCIYRG 119


>gi|317049296|ref|YP_004116944.1| hypothetical protein Pat9b_3089 [Pantoea sp. At-9b]
 gi|316950913|gb|ADU70388.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Pantoea sp. At-9b]
          Length = 119

 Score =  148 bits (373), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 57/115 (49%), Positives = 78/115 (67%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAHRLP VP+ HKC R+HGHS+ V L + G+VD  TG+V DF  ++  F+PL
Sbjct: 5   LFKEFQFEAAHRLPHVPEGHKCGRLHGHSFLVRLEITGEVDAYTGWVMDFAELKAAFAPL 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDHH LN+I  LENPT+E +A WIW  +   L  LS+V + ET  +   Y+G
Sbjct: 65  YDRLDHHYLNDIPGLENPTSEVLAKWIWDEMKPILPELSAVMIKETCTAGCVYRG 119


>gi|309786145|ref|ZP_07680773.1| queuosine biosynthesis protein QueD [Shigella dysenteriae 1617]
 gi|308925890|gb|EFP71369.1| queuosine biosynthesis protein QueD [Shigella dysenteriae 1617]
          Length = 120

 Score =  148 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 5   LFKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIIDFAELKAAFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+I  LENPT+E +A WIW ++   + +LS+V V ET  +   Y+G
Sbjct: 65  YERLDHHYLNDIPGLENPTSEVLAKWIWDQVKPIVPLLSAVMVKETCTAGCIYRG 119


>gi|238910660|ref|ZP_04654497.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Salmonella enterica
           subsp. enterica serovar Tennessee str. CDC07-0191]
          Length = 120

 Score =  148 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 79/115 (68%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP  HKC R+HGHS+ V L + G+VD  TG++ DF  ++  F P 
Sbjct: 5   LYKYFTFEAAHRLPNVPDGHKCGRLHGHSFVVRLEITGEVDKHTGWIIDFAELKAIFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           L++LDH+ LN+I  LENPT+E +A WIW ++   L ILS+V V ET  +   Y+G
Sbjct: 65  LDRLDHYYLNDIPGLENPTSEVLAQWIWNQIKPQLPILSAVIVKETCSAGCIYRG 119


>gi|223939024|ref|ZP_03630909.1| queuosine biosynthesis protein QueD [bacterium Ellin514]
 gi|223892320|gb|EEF58796.1| queuosine biosynthesis protein QueD [bacterium Ellin514]
          Length = 120

 Score =  148 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 83/117 (70%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M++ + F FEAAH LP +PKTHKC R+HGHS++ E+V+ G+VDPK G+V D+  I   F 
Sbjct: 3   MELRKTFQFEAAHLLPGLPKTHKCRRLHGHSFKAEIVVSGEVDPKLGWVMDYAEISAAFK 62

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ EKLDHH LNEI  LENPT+E +AIWIWK+L   L  LS V V ET  +   Y+G
Sbjct: 63  PIWEKLDHHYLNEIPGLENPTSEILAIWIWKKLKPKLPQLSEVVVAETCTARCVYRG 119


>gi|110642899|ref|YP_670629.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           536]
 gi|117624992|ref|YP_853980.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Escherichia coli
           APEC O1]
 gi|215488078|ref|YP_002330509.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Escherichia coli
           O127:H6 str. E2348/69]
 gi|218559751|ref|YP_002392664.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Escherichia coli
           S88]
 gi|218690885|ref|YP_002399097.1| 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli ED1a]
 gi|227888301|ref|ZP_04006106.1| 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli 83972]
 gi|300976250|ref|ZP_07173347.1| queuosine biosynthesis protein QueD [Escherichia coli MS 200-1]
 gi|300976778|ref|ZP_07173595.1| queuosine biosynthesis protein QueD [Escherichia coli MS 45-1]
 gi|301049479|ref|ZP_07196437.1| queuosine biosynthesis protein QueD [Escherichia coli MS 185-1]
 gi|331648483|ref|ZP_08349571.1| queuosine biosynthesis protein QueD [Escherichia coli M605]
 gi|110344491|gb|ABG70728.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           536]
 gi|115514116|gb|ABJ02191.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Escherichia coli
           APEC O1]
 gi|215266150|emb|CAS10576.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Escherichia coli
           O127:H6 str. E2348/69]
 gi|218366520|emb|CAR04273.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Escherichia coli
           S88]
 gi|218428449|emb|CAR09375.2| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Escherichia coli
           ED1a]
 gi|222034454|emb|CAP77196.1| 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli LF82]
 gi|227834570|gb|EEJ45036.1| 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli 83972]
 gi|294493823|gb|ADE92579.1| queuosine biosynthesis protein QueD [Escherichia coli IHE3034]
 gi|300298710|gb|EFJ55095.1| queuosine biosynthesis protein QueD [Escherichia coli MS 185-1]
 gi|300308595|gb|EFJ63115.1| queuosine biosynthesis protein QueD [Escherichia coli MS 200-1]
 gi|300409964|gb|EFJ93502.1| queuosine biosynthesis protein QueD [Escherichia coli MS 45-1]
 gi|307554736|gb|ADN47511.1| queuosine biosynthesis protein QueD [Escherichia coli ABU 83972]
 gi|315289238|gb|EFU48633.1| queuosine biosynthesis protein QueD [Escherichia coli MS 110-3]
 gi|315293680|gb|EFU53032.1| queuosine biosynthesis protein QueD [Escherichia coli MS 153-1]
 gi|315298748|gb|EFU58002.1| queuosine biosynthesis protein QueD [Escherichia coli MS 16-3]
 gi|324005724|gb|EGB74943.1| queuosine biosynthesis protein QueD [Escherichia coli MS 57-2]
 gi|324015501|gb|EGB84720.1| queuosine biosynthesis protein QueD [Escherichia coli MS 60-1]
 gi|331042230|gb|EGI14372.1| queuosine biosynthesis protein QueD [Escherichia coli M605]
          Length = 121

 Score =  148 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 6   LFKDFTFEAAHRLPHVPQGHKCGRLHGHSFMVRLEITGEVDPHTGWIIDFAELKAAFKPT 65

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+I  LENPT+E +A WIW ++   + +LS+V V ET  +   Y+G
Sbjct: 66  YERLDHHYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCIYRG 120


>gi|308187938|ref|YP_003932069.1| 6-pyruvoyl tetrahydrobiopterin synthase [Pantoea vagans C9-1]
 gi|308058448|gb|ADO10620.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Pantoea vagans
           C9-1]
          Length = 119

 Score =  148 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 55/115 (47%), Positives = 76/115 (66%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAH LP VP  HKC R+HGHS+ V L + G+VD  TG+V DF  ++  F PL
Sbjct: 5   LFKEFQFEAAHHLPNVPAGHKCGRLHGHSFLVRLEITGEVDAHTGWVMDFAELKAAFKPL 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
             +LDH+ LN+I  LENPT+E +A WIW ++   L +LS+V + ET  +   Y+G
Sbjct: 65  YNRLDHYYLNDIPGLENPTSEVLAKWIWDQMKPQLPLLSAVMIKETCTAGCVYRG 119


>gi|191171128|ref|ZP_03032678.1| queuosine biosynthesis protein QueD [Escherichia coli F11]
 gi|306812360|ref|ZP_07446558.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           NC101]
 gi|312964974|ref|ZP_07779214.1| queuosine biosynthesis protein QueD [Escherichia coli 2362-75]
 gi|331658875|ref|ZP_08359817.1| queuosine biosynthesis protein QueD [Escherichia coli TA206]
 gi|190908428|gb|EDV68017.1| queuosine biosynthesis protein QueD [Escherichia coli F11]
 gi|281179764|dbj|BAI56094.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           SE15]
 gi|305854398|gb|EFM54836.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           NC101]
 gi|307625666|gb|ADN69970.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           UM146]
 gi|312290530|gb|EFR18410.1| queuosine biosynthesis protein QueD [Escherichia coli 2362-75]
 gi|312947290|gb|ADR28117.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           O83:H1 str. NRG 857C]
 gi|320194895|gb|EFW69524.1| Queuosine biosynthesis QueD, PTPS-I [Escherichia coli WV_060327]
 gi|323188823|gb|EFZ74108.1| queuosine biosynthesis protein QueD [Escherichia coli RN587/1]
 gi|323951020|gb|EGB46896.1| 6-pyruvoyl tetrahydropterin synthase [Escherichia coli H252]
 gi|323957227|gb|EGB52951.1| 6-pyruvoyl tetrahydropterin synthase [Escherichia coli H263]
 gi|330908788|gb|EGH37302.1| queuosine biosynthesis QueD, PTPS-I [Escherichia coli AA86]
 gi|331053457|gb|EGI25486.1| queuosine biosynthesis protein QueD [Escherichia coli TA206]
          Length = 120

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 5   LFKDFTFEAAHRLPHVPQGHKCGRLHGHSFMVRLEITGEVDPHTGWIIDFAELKAAFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+I  LENPT+E +A WIW ++   + +LS+V V ET  +   Y+G
Sbjct: 65  YERLDHHYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCIYRG 119


>gi|238786212|ref|ZP_04630160.1| 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia bercovieri ATCC
           43970]
 gi|238712876|gb|EEQ04940.1| 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia bercovieri ATCC
           43970]
          Length = 120

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 56/115 (48%), Positives = 79/115 (68%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAHRLP V   HKC R+HGHS+ V + + G+VD  +G+V DF +++  F+P+
Sbjct: 6   LFKDFQFEAAHRLPHVAAGHKCGRLHGHSFMVRIEVTGEVDAHSGWVMDFADLKAAFNPI 65

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+I  LENPT+E +A WIW++L   L  LS+V V ET  +   Y+G
Sbjct: 66  WERLDHHYLNDIPGLENPTSEVLACWIWQQLKPQLPELSAVMVKETCSAGCVYRG 120


>gi|13474944|ref|NP_106514.1| hypothetical protein mll8751 [Mesorhizobium loti MAFF303099]
 gi|14025700|dbj|BAB52300.1| mll8751 [Mesorhizobium loti MAFF303099]
          Length = 117

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 81/117 (69%), Positives = 94/117 (80%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MKITQAFTFEAAH LPRVP TH+CHR+HGHSYRVEL +EG VDP TGFV DFF++E  F 
Sbjct: 1   MKITQAFTFEAAHCLPRVPATHRCHRIHGHSYRVELRLEGPVDPDTGFVIDFFDVEAVFG 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PLL++LDH  LNEIE L+NPTAENIA+WIW +    L  + SV VYETP+ W EY+G
Sbjct: 61  PLLQRLDHQYLNEIEGLDNPTAENIAVWIWNQTKPLLGQMCSVTVYETPLCWAEYEG 117


>gi|158422695|ref|YP_001523987.1| hypothetical protein AZC_1071 [Azorhizobium caulinodans ORS 571]
 gi|158329584|dbj|BAF87069.1| conserved hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 118

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 85/117 (72%), Positives = 103/117 (88%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MKITQAFTFEAAHRLP VP+TH+C RMHGHSYRVELV++GDVDP TGFV DFF++E  F 
Sbjct: 1   MKITQAFTFEAAHRLPNVPQTHRCFRMHGHSYRVELVLDGDVDPHTGFVVDFFDVEAAFG 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+L++LDH+CLNEIE LENPTAE+IAIWIW+R    L+ L++VRV+ETP+SW EY+G
Sbjct: 61  PVLKRLDHYCLNEIEGLENPTAEHIAIWIWERTKPLLAQLATVRVFETPLSWAEYEG 117


>gi|293416011|ref|ZP_06658651.1| 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli B185]
 gi|291432200|gb|EFF05182.1| 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli B185]
          Length = 120

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 59/115 (51%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VPK HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 5   LFKDFTFEAAHRLPHVPKGHKCGRLHGHSFMVRLEITGEVDPHTGWIIDFAELKAAFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+I  LENPT+E +A WIW ++   + +LS+V V ET  +   Y+G
Sbjct: 65  YERLDHHYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCIYRG 119


>gi|218706261|ref|YP_002413780.1| 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli UMN026]
 gi|293406257|ref|ZP_06650183.1| queuosine biosynthesis QueD [Escherichia coli FVEC1412]
 gi|298381994|ref|ZP_06991591.1| 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli FVEC1302]
 gi|300900979|ref|ZP_07119105.1| queuosine biosynthesis protein QueD [Escherichia coli MS 198-1]
 gi|301027212|ref|ZP_07190575.1| queuosine biosynthesis protein QueD [Escherichia coli MS 69-1]
 gi|218433358|emb|CAR14260.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Escherichia coli
           UMN026]
 gi|291426263|gb|EFE99295.1| queuosine biosynthesis QueD [Escherichia coli FVEC1412]
 gi|298277134|gb|EFI18650.1| 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli FVEC1302]
 gi|300355550|gb|EFJ71420.1| queuosine biosynthesis protein QueD [Escherichia coli MS 198-1]
 gi|300395134|gb|EFJ78672.1| queuosine biosynthesis protein QueD [Escherichia coli MS 69-1]
          Length = 121

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 57/115 (49%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 6   LFKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIIDFAELKAAFKPT 65

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDH+ LN+I  LENPT+E +A WIW ++   + +LS+V V ET  +   Y+G
Sbjct: 66  YERLDHYYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCIYRG 120


>gi|192290250|ref|YP_001990855.1| queuosine biosynthesis protein QueD [Rhodopseudomonas palustris
           TIE-1]
 gi|192283999|gb|ACF00380.1| queuosine biosynthesis protein QueD [Rhodopseudomonas palustris
           TIE-1]
          Length = 120

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 80/117 (68%), Positives = 90/117 (76%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MKITQAF FEAAH LP VP+TH+C RMHGHSYRVEL + G ++P TGFV DFF IE  F 
Sbjct: 1   MKITQAFRFEAAHYLPNVPETHRCKRMHGHSYRVELQLSGPINPVTGFVLDFFEIEAAFG 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PLL++LDH+CLNEIE LENPTAENIAIWIW+R    L  L  VRVYET   W +Y G
Sbjct: 61  PLLKRLDHYCLNEIEGLENPTAENIAIWIWRRTKPELPQLCGVRVYETSDCWADYAG 117


>gi|156932743|ref|YP_001436659.1| hypothetical protein ESA_00532 [Cronobacter sakazakii ATCC BAA-894]
 gi|156530997|gb|ABU75823.1| hypothetical protein ESA_00532 [Cronobacter sakazakii ATCC BAA-894]
          Length = 120

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 55/115 (47%), Positives = 79/115 (68%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAHRLP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P+
Sbjct: 5   LFKDFIFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIIDFAELKAAFKPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            + LDH+ LN+I  LENPT+E +A WIW ++   L +LS+V + ET  +   Y+G
Sbjct: 65  YDSLDHYYLNDIPGLENPTSEVLARWIWDQMKPRLPLLSAVMIKETCTAGCVYRG 119


>gi|170765647|ref|ZP_02900458.1| queuosine biosynthesis protein QueD [Escherichia albertii TW07627]
 gi|170124793|gb|EDS93724.1| queuosine biosynthesis protein QueD [Escherichia albertii TW07627]
          Length = 120

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 5   LFKDFTFEAAHRLPHVPQGHKCGRLHGHSFMVRLEITGEVDPHTGWIIDFAELKAAFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDHH LNEI  LENPT+E +A WIW ++   + +LS+V V ET  +   Y+G
Sbjct: 65  YDRLDHHYLNEIPGLENPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCIYRG 119


>gi|170025658|ref|YP_001722163.1| queuosine biosynthesis protein QueD [Yersinia pseudotuberculosis
           YPIII]
 gi|169752192|gb|ACA69710.1| queuosine biosynthesis protein QueD [Yersinia pseudotuberculosis
           YPIII]
          Length = 119

 Score =  147 bits (372), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAHRLP VP+ HKC R+HGHS+ V L + G+VD  +G+V DF  ++  F P+
Sbjct: 5   LFKDFQFEAAHRLPHVPEGHKCGRLHGHSFMVRLEVTGEVDAHSGWVMDFAALKAVFQPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+I  LENPT+E +A WIW++L   LS LS+V + ET  +   Y+G
Sbjct: 65  WERLDHHYLNDIPGLENPTSEVLARWIWQQLKPQLSELSAVMIKETCSAGCVYRG 119


>gi|39934728|ref|NP_947004.1| putative 6-pyruvoyl tetrahydropterin synthase [Rhodopseudomonas
           palustris CGA009]
 gi|39648578|emb|CAE27099.1| putative 6-pyruvol tetrahydrobiopterin synthase [Rhodopseudomonas
           palustris CGA009]
          Length = 120

 Score =  147 bits (372), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 79/117 (67%), Positives = 90/117 (76%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MKITQAF FEAAH LP VP+TH+C RMHGHSYRVEL + G ++P TGFV DFF IE  F 
Sbjct: 1   MKITQAFRFEAAHYLPNVPETHRCKRMHGHSYRVELQLSGPINPVTGFVLDFFEIEAAFG 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PLL++LDH+CLNE+E LENPTAENIAIWIW+R    L  L  VRVYET   W +Y G
Sbjct: 61  PLLKRLDHYCLNEVEGLENPTAENIAIWIWRRTKPELPQLCGVRVYETSDCWADYAG 117


>gi|193063686|ref|ZP_03044774.1| queuosine biosynthesis protein QueD [Escherichia coli E22]
 gi|260847109|ref|YP_003224887.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           O103:H2 str. 12009]
 gi|192930673|gb|EDV83279.1| queuosine biosynthesis protein QueD [Escherichia coli E22]
 gi|257762256|dbj|BAI33753.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Escherichia coli
           O103:H2 str. 12009]
          Length = 120

 Score =  147 bits (371), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 59/115 (51%), Positives = 81/115 (70%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP+ HKC R+HGHS+ V L + G+VD  TG++ DF  ++  F P 
Sbjct: 5   LYKDFTFEAAHRLPNVPEGHKCGRLHGHSFVVRLEITGEVDKHTGWIIDFAELKAIFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           L++LDH+ LN+I  LENPT+E +A WIW ++ T L ILS+V V ET  +   Y+G
Sbjct: 65  LDRLDHYYLNDIPGLENPTSEVLAKWIWNQVKTQLPILSAVMVKETCSAGCVYRG 119


>gi|332666769|ref|YP_004449557.1| queuosine biosynthesis protein QueD [Haliscomenobacter hydrossis
           DSM 1100]
 gi|332335583|gb|AEE52684.1| queuosine biosynthesis protein QueD [Haliscomenobacter hydrossis
           DSM 1100]
          Length = 118

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 79/117 (67%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M++ + F+F+AAH LP V   HKC  MHGH+Y V +++EG +DP  G+V DF  ++  + 
Sbjct: 1   MELYKEFSFDAAHFLPNVSPDHKCAHMHGHTYYVRILLEGPLDPVLGWVVDFAEVKSAWK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PL + LDH  LN+I  LENPTAE IA+WIW+R+   L +L S+ V ETP + V Y G
Sbjct: 61  PLEKILDHKMLNDIVGLENPTAEIIAVWIWERMKPKLPLLKSIEVKETPTTGVVYSG 117


>gi|332160376|ref|YP_004296953.1| putative 6-pyruvoyl tetrahydrobiopterin synthase family protein
           [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
 gi|318604390|emb|CBY25888.1| queuosine biosynthesis QueD, PTPS-I [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325664606|gb|ADZ41250.1| putative 6-pyruvoyl tetrahydrobiopterin synthase family protein
           [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
 gi|330859865|emb|CBX70196.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia
           enterocolitica W22703]
          Length = 120

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 56/115 (48%), Positives = 78/115 (67%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAH LP VP+ HKC R+HGHS+ V + + G+VD  +G+V DF  ++  F P+
Sbjct: 5   LFKDFQFEAAHLLPHVPEGHKCGRLHGHSFMVRIEVTGEVDAHSGWVMDFAELKAAFKPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+I  LENPT+E +A WIW++L   L  LS+V V ET  +   Y+G
Sbjct: 65  WERLDHHYLNDIPGLENPTSEVLASWIWQQLKPQLPELSAVMVKETCSAGCIYRG 119


>gi|229521408|ref|ZP_04410827.1| queuosine biosynthesis QueD PTPS-I [Vibrio cholerae TM 11079-80]
 gi|229341506|gb|EEO06509.1| queuosine biosynthesis QueD PTPS-I [Vibrio cholerae TM 11079-80]
          Length = 123

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 60/116 (51%), Positives = 82/116 (70%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ + F FEAAH LP VP  HKC R+HGHS+ V L +EG+VDP TG+V DF  I+  F P
Sbjct: 6   ELYKEFMFEAAHHLPHVPAGHKCGRLHGHSFLVRLYVEGEVDPHTGWVVDFAEIKAAFKP 65

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           + ++LDH+ LN+IE LENPT+E +A WIW++L  SL +LS V + ET  +   Y+G
Sbjct: 66  IYDRLDHYYLNDIEGLENPTSEVLAKWIWQQLKPSLPLLSKVEIKETCTAGCIYRG 121


>gi|253988157|ref|YP_003039513.1| 6-pyruvoyl tetrahydrobiopterin synthase [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253779607|emb|CAQ82768.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Photorhabdus
           asymbiotica]
          Length = 120

 Score =  146 bits (370), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 54/115 (46%), Positives = 79/115 (68%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           I + F FEAAHRLP VP+ HKC R+HGHS+ V L + G+VDP +G++ DF +++  F P+
Sbjct: 5   IFKDFQFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHSGWIIDFADLKAIFKPV 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDH  LN+I  LENPT+E ++ WIW ++   +  LS+V V ET  +   ++G
Sbjct: 65  WEQLDHQYLNDIPGLENPTSEVLSAWIWAKVKPKVPQLSAVMVKETCNAGCIFRG 119


>gi|282600227|ref|ZP_05973515.2| queuosine biosynthesis protein QueD [Providencia rustigianii DSM
           4541]
 gi|282566363|gb|EFB71898.1| queuosine biosynthesis protein QueD [Providencia rustigianii DSM
           4541]
          Length = 126

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 81/115 (70%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           I + F FEAAH+LP VP  HKC R+HGHS+ V L + GDVD  TG++ DF +++  F P+
Sbjct: 11  IYKDFQFEAAHKLPHVPAGHKCGRLHGHSFMVRLEITGDVDAHTGWIIDFADVKSAFKPI 70

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+IE LENPT+E ++ WIW+++   L +LS+V V ET  +   Y+G
Sbjct: 71  YERLDHHYLNDIEGLENPTSEVLSRWIWQQVKPLLPLLSAVTVQETCNAGCVYRG 125


>gi|304399224|ref|ZP_07381091.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Pantoea sp. aB]
 gi|304353278|gb|EFM17658.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Pantoea sp. aB]
          Length = 119

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 55/115 (47%), Positives = 76/115 (66%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAH LP VP  HKC R+HGHS+ V L + G+VD  TG+V DF  ++  F PL
Sbjct: 5   LFKEFQFEAAHHLPNVPAGHKCGRLHGHSFLVRLEITGEVDAHTGWVMDFAELKAAFKPL 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
             +LDH+ LN+I  LENPT+E +A WIW ++   L +LS+V + ET  +   Y+G
Sbjct: 65  YNRLDHYYLNDIPGLENPTSEVLAKWIWDQMKPELPLLSAVMIKETCTAGCVYRG 119


>gi|15641312|ref|NP_230944.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio cholerae
           O1 biovar El Tor str. N16961]
 gi|121586547|ref|ZP_01676333.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio cholerae
           2740-80]
 gi|121730131|ref|ZP_01682529.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio cholerae
           V52]
 gi|147674632|ref|YP_001216863.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Vibrio cholerae
           O395]
 gi|153212310|ref|ZP_01948098.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio cholerae
           1587]
 gi|153820104|ref|ZP_01972771.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio cholerae
           NCTC 8457]
 gi|153823525|ref|ZP_01976192.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio cholerae
           B33]
 gi|153826588|ref|ZP_01979255.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio cholerae
           MZO-2]
 gi|153830037|ref|ZP_01982704.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Vibrio cholerae
           623-39]
 gi|227081470|ref|YP_002810021.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Vibrio cholerae
           M66-2]
 gi|229505115|ref|ZP_04394625.1| queuosine biosynthesis QueD PTPS-I [Vibrio cholerae BX 330286]
 gi|229511215|ref|ZP_04400694.1| queuosine biosynthesis QueD PTPS-I [Vibrio cholerae B33]
 gi|229515675|ref|ZP_04405134.1| queuosine biosynthesis QueD PTPS-I [Vibrio cholerae TMA 21]
 gi|229518333|ref|ZP_04407777.1| queuosine biosynthesis QueD PTPS-I [Vibrio cholerae RC9]
 gi|229529619|ref|ZP_04419009.1| queuosine biosynthesis QueD PTPS-I [Vibrio cholerae 12129(1)]
 gi|254226643|ref|ZP_04920222.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio cholerae
           V51]
 gi|254286604|ref|ZP_04961560.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio cholerae
           AM-19226]
 gi|254848421|ref|ZP_05237771.1| 6-pyruvoyl tetrahydrobiopterin synthase [Vibrio cholerae MO10]
 gi|255745695|ref|ZP_05419643.1| queuosine biosynthesis QueD PTPS-I [Vibrio cholera CIRS 101]
 gi|258621497|ref|ZP_05716531.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio mimicus
           VM573]
 gi|262159030|ref|ZP_06030142.1| queuosine biosynthesis QueD PTPS-I [Vibrio cholerae INDRE 91/1]
 gi|262169387|ref|ZP_06037079.1| queuosine biosynthesis QueD PTPS-I [Vibrio cholerae RC27]
 gi|297578882|ref|ZP_06940810.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|298498611|ref|ZP_07008418.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|9655787|gb|AAF94458.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio cholerae
           O1 biovar El Tor str. N16961]
 gi|121549226|gb|EAX59258.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio cholerae
           2740-80]
 gi|121628122|gb|EAX60657.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio cholerae
           V52]
 gi|124116688|gb|EAY35508.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio cholerae
           1587]
 gi|125620812|gb|EAZ49167.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio cholerae
           V51]
 gi|126509356|gb|EAZ71950.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio cholerae
           NCTC 8457]
 gi|126518949|gb|EAZ76172.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio cholerae
           B33]
 gi|146316515|gb|ABQ21054.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Vibrio cholerae
           O395]
 gi|148874477|gb|EDL72612.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Vibrio cholerae
           623-39]
 gi|149739600|gb|EDM53820.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio cholerae
           MZO-2]
 gi|150423362|gb|EDN15307.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio cholerae
           AM-19226]
 gi|227009358|gb|ACP05570.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Vibrio cholerae
           M66-2]
 gi|227013216|gb|ACP09426.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Vibrio cholerae
           O395]
 gi|229333393|gb|EEN98879.1| queuosine biosynthesis QueD PTPS-I [Vibrio cholerae 12129(1)]
 gi|229345048|gb|EEO10022.1| queuosine biosynthesis QueD PTPS-I [Vibrio cholerae RC9]
 gi|229347444|gb|EEO12404.1| queuosine biosynthesis QueD PTPS-I [Vibrio cholerae TMA 21]
 gi|229351180|gb|EEO16121.1| queuosine biosynthesis QueD PTPS-I [Vibrio cholerae B33]
 gi|229357338|gb|EEO22255.1| queuosine biosynthesis QueD PTPS-I [Vibrio cholerae BX 330286]
 gi|254844126|gb|EET22540.1| 6-pyruvoyl tetrahydrobiopterin synthase [Vibrio cholerae MO10]
 gi|255736770|gb|EET92167.1| queuosine biosynthesis QueD PTPS-I [Vibrio cholera CIRS 101]
 gi|258586885|gb|EEW11600.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio mimicus
           VM573]
 gi|262022200|gb|EEY40909.1| queuosine biosynthesis QueD PTPS-I [Vibrio cholerae RC27]
 gi|262029215|gb|EEY47867.1| queuosine biosynthesis QueD PTPS-I [Vibrio cholerae INDRE 91/1]
 gi|297536476|gb|EFH75309.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297542944|gb|EFH78994.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|327483984|gb|AEA78391.1| Queuosine biosynthesis QueD, PTPS-I [Vibrio cholerae LMA3894-4]
          Length = 122

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 60/116 (51%), Positives = 82/116 (70%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ + F FEAAH LP VP  HKC R+HGHS+ V L +EG+VDP TG+V DF  I+  F P
Sbjct: 6   ELYKEFMFEAAHHLPHVPAGHKCGRLHGHSFLVRLYVEGEVDPHTGWVVDFAEIKAAFKP 65

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           + ++LDH+ LN+IE LENPT+E +A WIW++L  SL +LS V + ET  +   Y+G
Sbjct: 66  IYDRLDHYYLNDIEGLENPTSEVLAKWIWQQLKPSLPLLSKVEIKETCTAGCIYRG 121


>gi|260599123|ref|YP_003211694.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Cronobacter
           turicensis z3032]
 gi|260218300|emb|CBA33275.1| Putative 6-pyruvoyl tetrahydrobiopterin synthase [Cronobacter
           turicensis z3032]
          Length = 120

 Score =  146 bits (369), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 55/115 (47%), Positives = 79/115 (68%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAHRLP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P+
Sbjct: 5   LFKDFIFEAAHRLPHVPEGHKCGRLHGHSFMVRLEVTGEVDPHTGWIIDFAELKAAFKPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            + LDH+ LN+I  LENPT+E +A WIW ++   L +LS+V + ET  +   Y+G
Sbjct: 65  YDSLDHYYLNDIPGLENPTSEVLARWIWAQMKPRLPLLSAVMIKETCTAGCVYRG 119


>gi|311278266|ref|YP_003940497.1| 6-pyruvoyl tetrahydropterin synthase [Enterobacter cloacae SCF1]
 gi|308747461|gb|ADO47213.1| 6-pyruvoyl tetrahydropterin synthase [Enterobacter cloacae SCF1]
          Length = 121

 Score =  146 bits (369), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 55/115 (47%), Positives = 79/115 (68%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAH LP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 6   LFKDFTFEAAHHLPHVPEGHKCGRLHGHSFMVRLEITGEVDPYTGWIMDFAELKAAFKPT 65

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDH+ LN+I  LENPT+E +A WIW ++   + +LS+V V ET  +   Y+G
Sbjct: 66  YDRLDHYYLNDIPGLENPTSEVLAKWIWDQMKPQVPLLSAVMVKETCTAGCVYRG 120


>gi|332087650|gb|EGI92777.1| queuosine biosynthesis protein QueD [Shigella dysenteriae 155-74]
          Length = 120

 Score =  146 bits (369), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 57/115 (49%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP+ HKC R+HGHS+ V L + G+V+P TG++ DF  ++  F P 
Sbjct: 5   LFKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVNPHTGWIIDFAELKAAFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+I  LENPT+E +A WIW ++   + +LS+V V ET  +   Y+G
Sbjct: 65  YERLDHHYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCIYRG 119


>gi|291618621|ref|YP_003521363.1| YgcM [Pantoea ananatis LMG 20103]
 gi|291153651|gb|ADD78235.1| YgcM [Pantoea ananatis LMG 20103]
 gi|327395001|dbj|BAK12423.1| putative 6-pyruvoyl tetrahydrobiopterin synthase YgcM [Pantoea
           ananatis AJ13355]
          Length = 119

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 56/115 (48%), Positives = 76/115 (66%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAH LP VP  HKC R+HGHS+ V L + G+VD  TG+V DF  ++  F PL
Sbjct: 5   LFKEFQFEAAHYLPNVPAGHKCGRLHGHSFLVRLEITGEVDAHTGWVMDFAELKAAFKPL 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDH+ LNEI  LENPT+E +A WIW  +   L +LS+V + ET  +   Y+G
Sbjct: 65  YDRLDHYYLNEIPGLENPTSEVLAKWIWDHMKPRLPLLSAVMIKETCTAGCTYRG 119


>gi|258627613|ref|ZP_05722390.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio mimicus
           VM603]
 gi|262165553|ref|ZP_06033290.1| queuosine biosynthesis QueD PTPS-I [Vibrio mimicus VM223]
 gi|262171668|ref|ZP_06039346.1| queuosine biosynthesis QueD PTPS-I [Vibrio mimicus MB-451]
 gi|258580195|gb|EEW05167.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio mimicus
           VM603]
 gi|261892744|gb|EEY38730.1| queuosine biosynthesis QueD PTPS-I [Vibrio mimicus MB-451]
 gi|262025269|gb|EEY43937.1| queuosine biosynthesis QueD PTPS-I [Vibrio mimicus VM223]
          Length = 122

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 60/116 (51%), Positives = 82/116 (70%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ + F FEAAH LP VP  HKC R+HGHS+ V L +EG+VDP TG+V DF  I+  F P
Sbjct: 6   ELYKEFMFEAAHHLPHVPAGHKCGRLHGHSFLVRLYVEGEVDPYTGWVVDFAEIKAAFKP 65

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           + ++LDH+ LN+IE LENPT+E +A WIW++L  SL +LS V + ET  +   Y+G
Sbjct: 66  IYDRLDHYYLNDIEGLENPTSEVLAKWIWQQLKPSLPLLSKVEIKETCTAGCIYRG 121


>gi|183219599|ref|YP_001837595.1| 6-pyruvoyl tetrahydrobiopterin synthase [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
 gi|189909738|ref|YP_001961293.1| 6-pyruvoyltetrahydropterin synthase [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Ames)']
 gi|167774414|gb|ABZ92715.1| 6-pyruvoyltetrahydropterin synthase [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Ames)']
 gi|167778021|gb|ABZ96319.1| 6-pyruvoyl tetrahydrobiopterin synthase [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
          Length = 124

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 54/118 (45%), Positives = 84/118 (71%), Gaps = 1/118 (0%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           +++++ F FEAAH LP VP+ HKC RMHGHS+R  + ++G++DP TG++ DF  ++    
Sbjct: 4   IELSKTFGFEAAHFLPNVPEGHKCKRMHGHSFRFAVYLKGEIDPHTGWIMDFGELKSIVK 63

Query: 61  PLLEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+L++ LDH+ LN++  LENPT+ENIA+W+W +L   L +L  + +YET  S   Y+G
Sbjct: 64  PILDEHLDHYVLNDVPGLENPTSENIAVWLWNQLKPKLPLLDKITLYETCTSSCVYRG 121


>gi|188534832|ref|YP_001908629.1| Putative 6-pyruvoyl tetrahydrobiopterin synthase [Erwinia
           tasmaniensis Et1/99]
 gi|188029874|emb|CAO97758.1| Putative 6-pyruvoyl tetrahydrobiopterin synthase [Erwinia
           tasmaniensis Et1/99]
          Length = 119

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 56/115 (48%), Positives = 81/115 (70%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAH LP VP  HKC R+HGHS+ V L + G+VD  TG+V DF +I++ F P+
Sbjct: 5   LFKEFQFEAAHLLPHVPAGHKCGRLHGHSFMVRLEITGEVDQHTGWVMDFSDIKRAFKPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDH+ LN+I  LENPT+E +A WIW+++  +L +LS+V V ET  +   Y+G
Sbjct: 65  YDRLDHYYLNDIPGLENPTSEVLAEWIWQQMKPALPLLSAVMVKETCTAGCVYRG 119


>gi|317492845|ref|ZP_07951269.1| 6-pyruvoyl tetrahydropterin synthase [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316918967|gb|EFV40302.1| 6-pyruvoyl tetrahydropterin synthase [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 119

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 56/115 (48%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAH LP VP+ HKC R+HGHS+ V + + G+VD  TG+V DF  ++  F P+
Sbjct: 5   LFKDFQFEAAHHLPHVPEGHKCGRLHGHSFLVRIEITGEVDAYTGWVMDFAELKAAFKPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           L++LDH+ LN+I  LENPT+E +A WIW++L   L +LS+V V ET  +   Y+G
Sbjct: 65  LDRLDHYYLNDIPGLENPTSEVLAQWIWQQLKPELPLLSAVLVKETCTAGCTYRG 119


>gi|20804094|emb|CAD31297.1| PUTATIVE 6-PYRUVOYL TETRAHYDROBIOPTERIN SYNTHASE PROTEIN
           [Mesorhizobium loti R7A]
          Length = 117

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 80/117 (68%), Positives = 94/117 (80%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MKITQAFTFEAAH LPRVP+TH+CHRMHGHSYRVEL +EG VDP TGFV DFF++   F 
Sbjct: 1   MKITQAFTFEAAHCLPRVPETHRCHRMHGHSYRVELRLEGPVDPDTGFVIDFFDVGAVFG 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PLL++LDH  LNE+E L+NPTAENIA+WIW +    L  + SV VYETP+ W EY+G
Sbjct: 61  PLLQRLDHQHLNEVEGLDNPTAENIAVWIWNQTKPLLGQMCSVTVYETPLCWAEYEG 117


>gi|288933818|ref|YP_003437877.1| 6-pyruvoyl tetrahydropterin synthase [Klebsiella variicola At-22]
 gi|288888547|gb|ADC56865.1| 6-pyruvoyl tetrahydropterin synthase [Klebsiella variicola At-22]
          Length = 121

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 55/115 (47%), Positives = 78/115 (67%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAH LP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 6   LFKDFTFEAAHHLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIMDFAELKAAFKPT 65

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDH+ LN+I  LENPT+E +A WIW  +   + +LS+V V ET  +   Y+G
Sbjct: 66  YDRLDHYYLNDIPGLENPTSEVLAKWIWDEMKPRVPLLSAVMVKETCTAGCIYRG 120


>gi|229525890|ref|ZP_04415295.1| queuosine biosynthesis QueD PTPS-I [Vibrio cholerae bv. albensis
           VL426]
 gi|229339471|gb|EEO04488.1| queuosine biosynthesis QueD PTPS-I [Vibrio cholerae bv. albensis
           VL426]
          Length = 122

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 60/116 (51%), Positives = 82/116 (70%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ + F FEAAH LP VP  HKC R+HGHS+ V L +EG+VDP TG+V DF  I+  F P
Sbjct: 6   ELYKEFMFEAAHHLPHVPTGHKCGRLHGHSFLVRLYVEGEVDPHTGWVVDFAEIKAAFKP 65

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           + ++LDH+ LN+IE LENPT+E +A WIW++L  SL +LS V + ET  +   Y+G
Sbjct: 66  IYDRLDHYYLNDIEGLENPTSEVLAKWIWQQLKPSLPLLSKVEIKETCTAGCIYRG 121


>gi|260768312|ref|ZP_05877246.1| queuosine biosynthesis QueD PTPS-I [Vibrio furnissii CIP 102972]
 gi|260616342|gb|EEX41527.1| queuosine biosynthesis QueD PTPS-I [Vibrio furnissii CIP 102972]
 gi|315180020|gb|ADT86934.1| 6-pyruvoyl-tetrahydropterin synthase [Vibrio furnissii NCTC 11218]
          Length = 121

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 59/116 (50%), Positives = 81/116 (69%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I + F FEAAH LP VP+ HKC R+HGHS+ V L + GDVDP TG++ DF  I+  F P
Sbjct: 4   EIYKEFMFEAAHHLPHVPEGHKCGRLHGHSFLVRLYVAGDVDPHTGWLVDFAEIKAAFKP 63

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           + ++LDH+ LN+I+ LENPT+E +A WIW++L  SL +LS V + ET  +   Y G
Sbjct: 64  IYDRLDHYYLNDIDGLENPTSEVLAKWIWQQLKPSLPLLSKVEIKETCTAGCIYSG 119


>gi|152971642|ref|YP_001336751.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|206579592|ref|YP_002236872.1| queuosine biosynthesis protein QueD [Klebsiella pneumoniae 342]
 gi|238896238|ref|YP_002920974.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Klebsiella
           pneumoniae NTUH-K2044]
 gi|290511102|ref|ZP_06550471.1| queuosine biosynthesis QueD, PTPS-I [Klebsiella sp. 1_1_55]
 gi|330012240|ref|ZP_08307335.1| queuosine biosynthesis protein QueD [Klebsiella sp. MS 92-3]
 gi|150956491|gb|ABR78521.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|206568650|gb|ACI10426.1| queuosine biosynthesis protein QueD [Klebsiella pneumoniae 342]
 gi|238548556|dbj|BAH64907.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Klebsiella
           pneumoniae subsp. pneumoniae NTUH-K2044]
 gi|289776095|gb|EFD84094.1| queuosine biosynthesis QueD, PTPS-I [Klebsiella sp. 1_1_55]
 gi|328533880|gb|EGF60549.1| queuosine biosynthesis protein QueD [Klebsiella sp. MS 92-3]
          Length = 121

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 55/115 (47%), Positives = 78/115 (67%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAH LP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 6   LFKDFTFEAAHHLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIMDFAELKAAFKPT 65

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDH+ LN+I  LENPT+E +A WIW  +   + +LS+V V ET  +   Y+G
Sbjct: 66  YDRLDHYYLNDIPGLENPTSEVLAKWIWDEMKPRVPLLSAVMVKETCTAGCVYRG 120


>gi|212711379|ref|ZP_03319507.1| hypothetical protein PROVALCAL_02451 [Providencia alcalifaciens DSM
           30120]
 gi|212686108|gb|EEB45636.1| hypothetical protein PROVALCAL_02451 [Providencia alcalifaciens DSM
           30120]
          Length = 121

 Score =  145 bits (367), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 82/115 (71%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           I + F FEAAHRLP VP+ HKC R+HGHS+ V L + G++D  TG++ DF +++  F+P+
Sbjct: 5   IYKDFHFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEIDAHTGWIMDFADVKNAFNPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LNEIE LENPT+E +A WIW++    L +LS++ V ET  +   Y+G
Sbjct: 65  YERLDHHYLNEIEGLENPTSEVLARWIWQQTKPLLPLLSAITVKETCNAGCVYRG 119


>gi|310766635|gb|ADP11585.1| Putative 6-pyruvoyl tetrahydrobiopterin synthase [Erwinia sp.
           Ejp617]
          Length = 119

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 56/115 (48%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAH LP VP  HKC R+HGHS+ V L + G+V+P TG+V DF  I+  F P+
Sbjct: 5   LFKEFQFEAAHLLPHVPAGHKCGRLHGHSFMVRLEITGEVNPHTGWVMDFSEIKSAFKPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDH+ LN+I  LENPT+E +A WIW+++  +L +LS+V V ET  +   Y+G
Sbjct: 65  YDRLDHYYLNDIPGLENPTSEVLAEWIWQQMKPALPLLSAVMVKETCTAGCVYRG 119


>gi|329296029|ref|ZP_08253365.1| hypothetical protein Pstas_04121 [Plautia stali symbiont]
          Length = 119

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 55/115 (47%), Positives = 77/115 (66%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAHRLP VP+ HKC R+HGHS+ V L + G+VD  TG+V DF  ++  F P+
Sbjct: 5   LFKEFQFEAAHRLPHVPEGHKCGRLHGHSFLVRLEITGEVDAHTGWVMDFAELKAAFRPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDHH LN+I  LE+PT+E +A WIW  +   L  LS+V + ET  +   Y+G
Sbjct: 65  YDRLDHHYLNDIPGLESPTSEVLAKWIWDEMKPILPELSAVMIKETCTTGCVYRG 119


>gi|283786681|ref|YP_003366546.1| 6-pyruvoyl tetrahydrobiopterin synthase [Citrobacter rodentium
           ICC168]
 gi|282950135|emb|CBG89771.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Citrobacter
           rodentium ICC168]
          Length = 120

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 57/115 (49%), Positives = 79/115 (68%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 5   LFKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIIDFAELKAAFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDHH LNEI  L NPT+E +A WIW  +  ++ +LS+V V ET  +   Y+G
Sbjct: 65  YDRLDHHYLNEIPGLSNPTSEVLAKWIWDEVKPTMPLLSAVMVKETCTAGCVYRG 119


>gi|326330123|ref|ZP_08196434.1| queuosine biosynthesis protein QueD [Nocardioidaceae bacterium
           Broad-1]
 gi|325951936|gb|EGD43965.1| queuosine biosynthesis protein QueD [Nocardioidaceae bacterium
           Broad-1]
          Length = 122

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 60/116 (51%), Positives = 81/116 (69%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I + FTFEAAHRLP VP  HKC R+HGHS+RV+L + G V  +TG+V DF +++  F P
Sbjct: 6   EIFKEFTFEAAHRLPNVPDGHKCARLHGHSFRVQLHVRGSVGEETGWVQDFGDLKAAFKP 65

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           L  +LDH+ LNEIE L+NPT+E +A W+W RL  +L  L  V+V ET  +   Y+G
Sbjct: 66  LEARLDHYYLNEIEGLDNPTSEVLAKWLWDRLIDALPNLVEVQVRETCTAGCIYRG 121


>gi|237729739|ref|ZP_04560220.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226908345|gb|EEH94263.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 120

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 55/115 (47%), Positives = 79/115 (68%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAH LP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 5   LFKDFTFEAAHHLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIMDFAELKAAFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDH+ LN+I  LENPT+E +A WIW ++   + +LS+V V ET  +   Y+G
Sbjct: 65  YDRLDHYYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCVYRG 119


>gi|28898657|ref|NP_798262.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|308094778|ref|ZP_05892046.2| queuosine biosynthesis protein QueD [Vibrio parahaemolyticus
           AN-5034]
 gi|308095644|ref|ZP_05907277.2| queuosine biosynthesis protein QueD [Vibrio parahaemolyticus
           Peru-466]
 gi|308125847|ref|ZP_05777480.2| queuosine biosynthesis protein QueD [Vibrio parahaemolyticus K5030]
 gi|28806875|dbj|BAC60146.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|308086656|gb|EFO36351.1| queuosine biosynthesis protein QueD [Vibrio parahaemolyticus
           Peru-466]
 gi|308093248|gb|EFO42943.1| queuosine biosynthesis protein QueD [Vibrio parahaemolyticus
           AN-5034]
 gi|308111708|gb|EFO49248.1| queuosine biosynthesis protein QueD [Vibrio parahaemolyticus K5030]
          Length = 137

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 60/116 (51%), Positives = 82/116 (70%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I + F FEAAH LP VP+ HKC R+HGHS+ V L +EG+VDP TG+V DF  I+  F P
Sbjct: 21  EIYKEFMFEAAHHLPHVPEGHKCGRLHGHSFLVRLYVEGEVDPHTGWVVDFAEIKAAFKP 80

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           +  +LDH+ LN+IE LENPT+E +A WIW++L  +L +LS V + ET  +   Y+G
Sbjct: 81  IYNRLDHYYLNDIEGLENPTSEVLAKWIWQQLKPNLPLLSKVEIKETCTAGCIYKG 136


>gi|292487232|ref|YP_003530104.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Erwinia amylovora
           CFBP1430]
 gi|292900394|ref|YP_003539763.1| 6-pyruvoyl tetrahydrobiopterin synthase [Erwinia amylovora ATCC
           49946]
 gi|291200242|emb|CBJ47370.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Erwinia amylovora
           ATCC 49946]
 gi|291552651|emb|CBA19696.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Erwinia amylovora
           CFBP1430]
          Length = 119

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 56/115 (48%), Positives = 79/115 (68%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAH LP VP  HKC R+HGHS+ V L + G+VD  TG+V DF  I+  F P+
Sbjct: 5   LFKEFQFEAAHHLPHVPAGHKCGRLHGHSFMVRLEITGEVDAHTGWVMDFSEIKSAFKPV 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDH+ LN+I  LENPT+E +A WIW+++  +L +LS+V V ET  +   Y+G
Sbjct: 65  YDRLDHYYLNDIPGLENPTSEVLAEWIWQQMKPALPLLSAVMVKETCTAGCVYRG 119


>gi|261210974|ref|ZP_05925264.1| queuosine biosynthesis QueD PTPS-I [Vibrio sp. RC341]
 gi|262402350|ref|ZP_06078911.1| queuosine biosynthesis QueD PTPS-I [Vibrio sp. RC586]
 gi|260839949|gb|EEX66549.1| queuosine biosynthesis QueD PTPS-I [Vibrio sp. RC341]
 gi|262351132|gb|EEZ00265.1| queuosine biosynthesis QueD PTPS-I [Vibrio sp. RC586]
          Length = 122

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 59/116 (50%), Positives = 82/116 (70%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ + F FEAAH LP VP  HKC R+HGHS+ V L +EG+V+P TG+V DF  I+  F P
Sbjct: 6   ELYKEFMFEAAHHLPHVPAGHKCGRLHGHSFLVRLYVEGEVNPHTGWVVDFAEIKAAFKP 65

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           + ++LDH+ LN+IE LENPT+E +A WIW++L  SL +LS V + ET  +   Y+G
Sbjct: 66  IYDRLDHYYLNDIEGLENPTSEVLAKWIWQQLKPSLPLLSKVEIKETCTAGCIYRG 121


>gi|183983366|ref|YP_001851657.1| 6-pyruvoyl tetrahydrobiopterin synthase [Mycobacterium marinum M]
 gi|183176692|gb|ACC41802.1| 6-pyruvoyl tetrahydrobiopterin synthase [Mycobacterium marinum M]
          Length = 159

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 59/116 (50%), Positives = 83/116 (71%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I   FTFE+AHRLP VP  HKC R+HGHSYR  + +EG VDP+ G++ DF  I+    P
Sbjct: 6   EIYCEFTFESAHRLPNVPAGHKCGRLHGHSYRARIYVEGPVDPRAGWIVDFGKIKDACKP 65

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           ++ +LDH+ LNEI+ LENPT+E +++WIW+ L+T L ++S+V V ET  S   Y+G
Sbjct: 66  VIARLDHYYLNEIDGLENPTSEQLSMWIWRELATLLPMMSAVSVSETCSSGCMYRG 121


>gi|296104444|ref|YP_003614590.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
 gi|295058903|gb|ADF63641.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
          Length = 120

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 54/115 (46%), Positives = 79/115 (68%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAH LP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 5   LFKDFTFEAAHHLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIMDFAELKAAFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDH+ LN+I  LENPT+E +A WIW ++   + +LS+V + ET  +   Y+G
Sbjct: 65  YDRLDHYYLNDIPGLENPTSEVLAKWIWDQMKPLVPLLSAVMIKETCTAGCVYRG 119


>gi|86146274|ref|ZP_01064599.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio sp.
           MED222]
 gi|85835985|gb|EAQ54118.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio sp.
           MED222]
          Length = 120

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 60/116 (51%), Positives = 81/116 (69%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ + F FEAAH LP VP+ HKC R+HGHS+ V L +EG+VDP TG+V DF  I+  F P
Sbjct: 4   ELYKEFMFEAAHHLPHVPEGHKCGRLHGHSFLVRLYVEGEVDPHTGWVIDFSEIKAVFKP 63

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           + ++LDH+ LN+IE LENPT+E +A WIW  L  SL +LS V + ET  +   Y+G
Sbjct: 64  IYDRLDHYYLNDIEGLENPTSEVLAKWIWNELKPSLPLLSKVEIKETCTAGCIYRG 119


>gi|295097337|emb|CBK86427.1| preQ(0) biosynthesis protein QueD [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 121

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 54/115 (46%), Positives = 78/115 (67%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAH LP VP  HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 6   LFKDFTFEAAHHLPHVPAGHKCGRLHGHSFMVRLEITGEVDPHTGWIMDFAELKAAFKPT 65

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDH+ LN+I  LENPT+E +A WIW ++   + +LS+V + ET  +   Y+G
Sbjct: 66  YDRLDHYYLNDIPGLENPTSEVLAKWIWDQMKPLVPLLSAVMIKETCTAGCVYRG 120


>gi|218709794|ref|YP_002417415.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Vibrio splendidus
           LGP32]
 gi|218322813|emb|CAV18990.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Vibrio splendidus
           LGP32]
          Length = 136

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 59/116 (50%), Positives = 81/116 (69%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ + F FEAAH LP VP+ HKC R+HGHS+ V L +EG+VDP TG+V DF  I+  F P
Sbjct: 20  ELYKEFMFEAAHHLPHVPEGHKCGRLHGHSFLVRLYVEGEVDPHTGWVIDFSEIKAVFKP 79

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           + ++LDH+ LN+I+ LENPT+E +A WIW  L  SL +LS V + ET  +   Y+G
Sbjct: 80  IYDRLDHYYLNDIDGLENPTSEVLAKWIWNELKPSLPLLSKVEIKETCTAGCIYRG 135


>gi|262275963|ref|ZP_06053772.1| queuosine biosynthesis QueD PTPS-I [Grimontia hollisae CIP 101886]
 gi|262219771|gb|EEY71087.1| queuosine biosynthesis QueD PTPS-I [Grimontia hollisae CIP 101886]
          Length = 120

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 61/116 (52%), Positives = 80/116 (68%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ + F FEAAHRLP VP+ HKC R+HGHS+ V L + GDVDP TG+V DF  I++ F P
Sbjct: 4   ELFKEFMFEAAHRLPHVPEGHKCGRLHGHSFLVRLYVAGDVDPHTGWVIDFSEIKKVFQP 63

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           + ++LDHH LN+IE LENPT+E +A WIW +L   L  LS V + ET  +   Y G
Sbjct: 64  IYDRLDHHYLNDIEGLENPTSEVLAKWIWDKLKPELPCLSKVMIKETCTAGCIYTG 119


>gi|259909458|ref|YP_002649814.1| Putative 6-pyruvoyl tetrahydrobiopterin synthase [Erwinia
           pyrifoliae Ep1/96]
 gi|224965080|emb|CAX56612.1| Putative 6-pyruvoyl tetrahydrobiopterin synthase [Erwinia
           pyrifoliae Ep1/96]
 gi|283479531|emb|CAY75447.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Erwinia
           pyrifoliae DSM 12163]
          Length = 119

 Score =  144 bits (364), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 55/115 (47%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAH LP VP  HKC R+HGHS+ + L + G+V+P TG+V DF  I+  F P+
Sbjct: 5   LFKEFQFEAAHLLPHVPAGHKCGRLHGHSFMIRLEITGEVNPHTGWVMDFSEIKSAFKPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDH+ LN+I  LENPT+E +A WIW+++  +L +LS+V V ET  +   Y+G
Sbjct: 65  YDRLDHYYLNDIPGLENPTSEVLAEWIWQQMKPALPLLSAVMVKETCTAGCVYRG 119


>gi|91224270|ref|ZP_01259532.1| 6-pyruvoyl-tetrahydropterin synthase [Vibrio alginolyticus 12G01]
 gi|153835333|ref|ZP_01988000.1| 6-pyruvoyl tetrahydrobiopterin synthase [Vibrio harveyi HY01]
 gi|156974185|ref|YP_001445092.1| hypothetical protein VIBHAR_01900 [Vibrio harveyi ATCC BAA-1116]
 gi|262393923|ref|YP_003285777.1| queuosine biosynthesis QueD PTPS-I [Vibrio sp. Ex25]
 gi|269961687|ref|ZP_06176048.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio harveyi
           1DA3]
 gi|269968457|ref|ZP_06182471.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio
           alginolyticus 40B]
 gi|91190612|gb|EAS76879.1| 6-pyruvoyl-tetrahydropterin synthase [Vibrio alginolyticus 12G01]
 gi|148868147|gb|EDL67304.1| 6-pyruvoyl tetrahydrobiopterin synthase [Vibrio harveyi HY01]
 gi|156525779|gb|ABU70865.1| hypothetical protein VIBHAR_01900 [Vibrio harveyi ATCC BAA-1116]
 gi|262337517|gb|ACY51312.1| queuosine biosynthesis QueD PTPS-I [Vibrio sp. Ex25]
 gi|269826931|gb|EEZ81251.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio
           alginolyticus 40B]
 gi|269833552|gb|EEZ87650.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Vibrio harveyi
           1DA3]
          Length = 120

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 60/116 (51%), Positives = 82/116 (70%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ + F FEAAH LP VP+ HKC R+HGHS+ V L +EG+VDP TG+V DF  I+  F P
Sbjct: 4   ELYKEFMFEAAHHLPHVPEGHKCGRLHGHSFLVRLYVEGEVDPHTGWVVDFAEIKAAFKP 63

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           +  +LDH+ LN+IE LENPT+E +A WIW++L  SL +LS V + ET  +   Y+G
Sbjct: 64  IYNRLDHYYLNDIEGLENPTSEVLAKWIWQQLKPSLPLLSKVEIKETCTAGCIYKG 119


>gi|123441109|ref|YP_001005098.1| putative 6-pyruvoyl tetrahydrobiopterin synthase family protein
           [Yersinia enterocolitica subsp. enterocolitica 8081]
 gi|122088070|emb|CAL10858.1| putative 6-pyruvoyl tetrahydrobiopterin synthase family protein
           [Yersinia enterocolitica subsp. enterocolitica 8081]
          Length = 119

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 54/115 (46%), Positives = 78/115 (67%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAH LP VP+ HKC R+HGHS+ + + + G+VD  +G+V DF  ++  F P+
Sbjct: 5   LFKDFQFEAAHLLPHVPEGHKCGRLHGHSFMIRIEVTGEVDAHSGWVMDFAELKAAFKPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+I  LENPT+E +A WIW++L   L  LS+V V ET  +   ++G
Sbjct: 65  WERLDHHYLNDIPGLENPTSEVLASWIWQQLKPQLPELSAVMVKETCSAGCIFRG 119


>gi|37524703|ref|NP_928047.1| hypothetical protein plu0702 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36784128|emb|CAE12997.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 120

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 56/115 (48%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           I + F FEAAHRLP VP+ HKC R+HGHS+ V L + G+VDP +G++ DF +++  F P+
Sbjct: 5   IFKDFQFEAAHRLPHVPEGHKCGRLHGHSFIVRLEITGEVDPHSGWIMDFADLKALFKPV 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+I  LENPT+E +A WIW ++   +  LS+V V ET  +   ++G
Sbjct: 65  WEQLDHHYLNDIPGLENPTSEVLATWIWHKVKPIVPQLSAVMVKETCTAGCIFRG 119


>gi|300724655|ref|YP_003713980.1| putative synthase with tetrahydrobiopterin biosynthesis-like domain
           [Xenorhabdus nematophila ATCC 19061]
 gi|297631197|emb|CBJ91892.1| putative synthase with tetrahydrobiopterin biosynthesis-like domain
           [Xenorhabdus nematophila ATCC 19061]
          Length = 120

 Score =  144 bits (363), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 60/117 (51%), Positives = 83/117 (70%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           + I + F FEAAH LP VP+ HKC R+HGHS+ V L + G++DP +G++ DF +++  F 
Sbjct: 3   ITIFKDFQFEAAHHLPHVPEGHKCGRLHGHSFMVRLEITGELDPLSGWIMDFADVKAAFK 62

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ E+LDHH LNEI  LENPT+E +A WIWK+L  +LS LS+V V ET  +   Y+G
Sbjct: 63  PIWERLDHHYLNEIPGLENPTSEVLAKWIWKQLKPTLSPLSAVMVKETCSAGCIYRG 119


>gi|50122474|ref|YP_051641.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Pectobacterium
           atrosepticum SCRI1043]
 gi|49613000|emb|CAG76451.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Pectobacterium
           atrosepticum SCRI1043]
          Length = 138

 Score =  144 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 60/115 (52%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAH LP VP+ HKC R+HGHS+ V L + G+VDP TG+V DF  ++  F P 
Sbjct: 23  LFKDFQFEAAHHLPHVPEGHKCGRLHGHSFMVRLEITGEVDPYTGWVMDFSELKAAFKPT 82

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LNEI  LENPT+E +A WIW++L  +L +LS+V V ET  +   Y+G
Sbjct: 83  WERLDHHYLNEIPGLENPTSEVLAHWIWQQLKPTLPLLSAVMVKETCTAGCVYKG 137


>gi|300718115|ref|YP_003742918.1| 6-pyruvoyl tetrahydrobiopterin synthase [Erwinia billingiae Eb661]
 gi|299063951|emb|CAX61071.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Erwinia
           billingiae Eb661]
          Length = 119

 Score =  144 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 54/115 (46%), Positives = 77/115 (66%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAH LP VP  HKC R+HGHS+ V L + G+VD  TG++ DF  ++  F P+
Sbjct: 5   LFKDFMFEAAHHLPNVPAGHKCGRLHGHSFLVRLEITGEVDAHTGWIMDFAELKAAFKPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDH+ LNEI  LENPT+E +A WIW ++   L+ LS+V + ET  +   Y+G
Sbjct: 65  YDQLDHYYLNEIAGLENPTSEVLAKWIWDQMKPKLAELSAVTIKETCTAGCIYRG 119


>gi|163800698|ref|ZP_02194598.1| 6-pyruvoyl-tetrahydropterin synthase [Vibrio sp. AND4]
 gi|159175047|gb|EDP59844.1| 6-pyruvoyl-tetrahydropterin synthase [Vibrio sp. AND4]
          Length = 120

 Score =  144 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 60/116 (51%), Positives = 82/116 (70%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ + F FEAAH LP VP+ HKC R+HGHS+ V L +EG+VDP TG+V DF  I+  F P
Sbjct: 4   ELYKEFMFEAAHHLPHVPEGHKCGRLHGHSFLVRLYVEGEVDPHTGWVVDFAQIKAAFKP 63

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           +  +LDH+ LN+IE LENPT+E +A WIW++L  SL +LS V + ET  +   Y+G
Sbjct: 64  IYNRLDHYYLNDIEGLENPTSEVLAKWIWQQLKPSLPLLSKVEIKETCTAGCIYKG 119


>gi|331671185|ref|ZP_08372018.1| queuosine biosynthesis protein QueD [Escherichia coli TA271]
 gi|331061774|gb|EGI33700.1| queuosine biosynthesis protein QueD [Escherichia coli TA271]
          Length = 120

 Score =  144 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 59/115 (51%), Positives = 80/115 (69%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP  HKC R+HGHS+ V L + G+VD  TG++ DF  ++  F P 
Sbjct: 5   LYKDFTFEAAHRLPNVPNGHKCGRLHGHSFVVRLEITGEVDKHTGWIIDFAELKAIFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           L++LDH+ LN+I  LENPT+E +A WIW ++   LSILS+V V ET  +   Y+G
Sbjct: 65  LDRLDHYYLNDITGLENPTSEVLAEWIWNQIKPQLSILSAVIVKETCSAGCIYRG 119


>gi|153840262|ref|ZP_01992929.1| 6-pyruvoyl tetrahydrobiopterin synthase [Vibrio parahaemolyticus
           AQ3810]
 gi|149746073|gb|EDM57203.1| 6-pyruvoyl tetrahydrobiopterin synthase [Vibrio parahaemolyticus
           AQ3810]
          Length = 120

 Score =  143 bits (362), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 58/116 (50%), Positives = 82/116 (70%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ + F FEAAH LP VP+ HKC R+HGHS+ V L ++G+VDP TG+V DF  I+  F P
Sbjct: 4   ELYKEFMFEAAHHLPHVPEGHKCGRLHGHSFLVRLYVKGEVDPHTGWVVDFAEIKAAFKP 63

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           +  +LDH+ LN+IE LENPT+E +A WIW++L  +L +LS V + ET  +   Y+G
Sbjct: 64  IYNRLDHYYLNDIEGLENPTSEVLAKWIWQQLKPNLPLLSKVEIKETCTAGCIYKG 119


>gi|37680272|ref|NP_934881.1| 6-pyruvoyl-tetrahydropterin synthase [Vibrio vulnificus YJ016]
 gi|37199019|dbj|BAC94852.1| 6-pyruvoyl-tetrahydropterin synthase [Vibrio vulnificus YJ016]
          Length = 121

 Score =  143 bits (362), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 59/116 (50%), Positives = 82/116 (70%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ + F FEAAH LP VP+ HKC R+HGHS+ V L +EG+VDP TG+V DF  I+  F P
Sbjct: 5   ELYKEFMFEAAHHLPHVPEGHKCGRLHGHSFLVRLYVEGEVDPHTGWVVDFAEIKAAFKP 64

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           +  +LDH+ LN+IE LENPT+E +A WIW++L  +L +LS V + ET  +   Y+G
Sbjct: 65  IYNRLDHYYLNDIEGLENPTSEVLAKWIWQQLKPNLPLLSKVEIKETCTAGCIYKG 120


>gi|328474768|gb|EGF45573.1| 6-pyruvoyl-tetrahydropterin synthase [Vibrio parahaemolyticus
           10329]
          Length = 120

 Score =  143 bits (362), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 59/116 (50%), Positives = 82/116 (70%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ + F FEAAH LP VP+ HKC R+HGHS+ V L +EG+VDP TG+V DF  I+  F P
Sbjct: 4   ELYKEFMFEAAHHLPHVPEGHKCGRLHGHSFLVRLYVEGEVDPHTGWVVDFAEIKAAFKP 63

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           +  +LDH+ LN+IE LENPT+E +A WIW++L  +L +LS V + ET  +   Y+G
Sbjct: 64  IYNRLDHYYLNDIEGLENPTSEVLAKWIWQQLKPNLPLLSKVEIKETCTAGCIYKG 119


>gi|291326720|ref|ZP_06125592.2| queuosine biosynthesis protein QueD [Providencia rettgeri DSM 1131]
 gi|291313349|gb|EFE53802.1| queuosine biosynthesis protein QueD [Providencia rettgeri DSM 1131]
          Length = 135

 Score =  143 bits (362), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 82/115 (71%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           I + FTFEAAH+LP VP+ HKC R+HGHS+ V L + G+VD  +G++ DF +++  F P+
Sbjct: 19  IYKDFTFEAAHKLPHVPEGHKCGRLHGHSFMVRLEITGEVDSHSGWIIDFSDVKAAFKPI 78

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LN+IE LENPT+E +A WIW++    L +LS+V V ET  +   Y+G
Sbjct: 79  WERLDHHYLNDIEGLENPTSEVLAQWIWQQTKPLLPLLSAVTVKETCNAGCVYRG 133


>gi|262041518|ref|ZP_06014715.1| queuosine biosynthesis protein QueD [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259041079|gb|EEW42153.1| queuosine biosynthesis protein QueD [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 121

 Score =  143 bits (362), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 55/115 (47%), Positives = 78/115 (67%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAH LP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 6   LFKDFTFEAAHHLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIMDFAELKAAFKPT 65

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDH+ LN+I  LENPT+E +A WIW  +   + +LS+V V ET  +   Y+G
Sbjct: 66  YDRLDHYYLNDISGLENPTSEVLAKWIWDEMKPRVPLLSAVMVKETCTAGCVYRG 120


>gi|197286097|ref|YP_002151969.1| 6-pyruvoyl tetrahydrobiopterin synthase [Proteus mirabilis HI4320]
 gi|227356607|ref|ZP_03840994.1| 6-pyruvoyl tetrahydrobiopterin synthase [Proteus mirabilis ATCC
           29906]
 gi|194683584|emb|CAR44466.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Proteus mirabilis
           HI4320]
 gi|227163363|gb|EEI48290.1| 6-pyruvoyl tetrahydrobiopterin synthase [Proteus mirabilis ATCC
           29906]
          Length = 120

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 83/115 (72%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           I + F FEAAH LP VPK HKC R+HGHS+ V L + G+VD ++G++ DF +++  F P 
Sbjct: 5   IFKDFQFEAAHHLPHVPKGHKCGRLHGHSFLVRLEITGEVDAQSGWLIDFADVKAAFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           L++LDH+ LN+IE LENPT+E +A WIW+++  SL +LS+V V ET  +   Y+G
Sbjct: 65  LDRLDHYYLNDIEGLENPTSEVLAKWIWQQVKPSLPLLSAVMVKETCTAGCIYRG 119


>gi|288550341|ref|ZP_05970064.2| queuosine biosynthesis protein QueD [Enterobacter cancerogenus ATCC
           35316]
 gi|288315540|gb|EFC54478.1| queuosine biosynthesis protein QueD [Enterobacter cancerogenus ATCC
           35316]
          Length = 121

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 53/115 (46%), Positives = 76/115 (66%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAH LP VP  HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 6   LFKDFIFEAAHHLPHVPAGHKCGRLHGHSFMVRLEITGEVDPHTGWIMDFAELKAAFKPT 65

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDH+ LN+I  LENPT+E +A WIW ++   +  LS+V + ET  +   Y+G
Sbjct: 66  YDRLDHYYLNDIPGLENPTSEVLAKWIWDQVKPLVPQLSAVMIKETCTAGCIYRG 120


>gi|28198089|ref|NP_778403.1| 6-pyruvoyl tetrahydrobiopterin synthase [Xylella fastidiosa
           Temecula1]
 gi|182680717|ref|YP_001828877.1| queuosine biosynthesis protein QueD [Xylella fastidiosa M23]
 gi|28056149|gb|AAO28052.1| 6-pyruvoyl tetrahydrobiopterin synthase [Xylella fastidiosa
           Temecula1]
 gi|182630827|gb|ACB91603.1| queuosine biosynthesis protein QueD [Xylella fastidiosa M23]
 gi|307579181|gb|ADN63150.1| 6-pyruvoyl tetrahydrobiopterin synthase [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 118

 Score =  143 bits (361), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 58/117 (49%), Positives = 82/117 (70%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M I + F  EAAHRLP VP  HKC R+HGHS+R+E+ + G ++  TG++ DF ++++ F 
Sbjct: 1   MDIFKVFIIEAAHRLPHVPPGHKCARLHGHSFRIEVHVSGALESDTGWIMDFSDLKRAFQ 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ ++LDHH LNEIE LENPT+E +AIW+W RL   L  L+ + V+ET  S   Y+G
Sbjct: 61  PIYDQLDHHYLNEIEGLENPTSERLAIWVWDRLKPVLPALTEIVVHETCTSGCRYRG 117


>gi|71277953|ref|YP_269633.1| putative 6-pyruvoyl tetrahydropterin synthase [Colwellia
           psychrerythraea 34H]
 gi|71143693|gb|AAZ24166.1| putative 6-pyruvoyl tetrahydropterin synthase [Colwellia
           psychrerythraea 34H]
          Length = 120

 Score =  143 bits (361), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 57/115 (49%), Positives = 78/115 (67%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           I + F FEAAH+LP VP  HKC R+HGHSY+V + +EG VD  +G+  DF +++  F P+
Sbjct: 5   IYKDFMFEAAHKLPNVPAGHKCARLHGHSYKVRIHLEGTVDKDSGWFIDFSDVKTIFKPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
             +LDH+ LN+IE LENPTAE I+ WIW +L   L  LS++ + ET    V Y+G
Sbjct: 65  YNQLDHYYLNDIEGLENPTAEVISKWIWDKLKPDLPELSAIELMETCTCGVIYKG 119


>gi|146312869|ref|YP_001177943.1| putative 6-pyruvoyl tetrahydropterin synthase [Enterobacter sp.
           638]
 gi|145319745|gb|ABP61892.1| preQ(0) biosynthesis protein QueD [Enterobacter sp. 638]
          Length = 120

 Score =  143 bits (361), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 54/115 (46%), Positives = 78/115 (67%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAH LP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF  ++  F P 
Sbjct: 5   LFKDFIFEAAHHLPHVPQGHKCGRLHGHSFMVRLEITGEVDPHTGWIMDFSELKAAFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++LDH+ LN+I  LENPT+E +A WIW ++   + +LSSV + ET  +   Y+G
Sbjct: 65  YDRLDHYYLNDIPGLENPTSEVLAKWIWDQMKPLVPLLSSVMIKETCTAGCVYRG 119


>gi|290476590|ref|YP_003469495.1| putative synthase with tetrahydrobiopterin biosynthesis-like domain
           [Xenorhabdus bovienii SS-2004]
 gi|289175928|emb|CBJ82731.1| putative synthase with tetrahydrobiopterin biosynthesis-like domain
           [Xenorhabdus bovienii SS-2004]
          Length = 121

 Score =  143 bits (361), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 59/116 (50%), Positives = 81/116 (69%), Gaps = 1/116 (0%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           I + F FEAAHRLP VP+ HKC R+HGHS+ V L + G+VDP +G++ DF +++  F P+
Sbjct: 5   IFKDFQFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPLSGWIMDFADVKVAFKPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLST-SLSILSSVRVYETPMSWVEYQG 117
            E+LDH+ LNEI  LENPT+E +A WIW++L    L  LS+V V ET  +   Y+G
Sbjct: 65  WERLDHNYLNEIPGLENPTSEVLAKWIWEKLKPTLLPQLSAVMVKETCSAGCIYRG 120


>gi|326423974|ref|NP_761108.2| queuosine biosynthesis protein QueD [Vibrio vulnificus CMCP6]
 gi|319999353|gb|AAO10635.2| queuosine biosynthesis protein QueD [Vibrio vulnificus CMCP6]
          Length = 121

 Score =  143 bits (361), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 58/116 (50%), Positives = 82/116 (70%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ + F FEAAH LP VP+ HKC R+HGHS+ V L +EG+VDP TG+V DF  I+  F P
Sbjct: 5   ELYKEFMFEAAHHLPHVPEGHKCGRLHGHSFLVRLYVEGEVDPHTGWVVDFAEIKAAFKP 64

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           +  +LDH+ LN+I+ LENPT+E +A WIW++L  +L +LS V + ET  +   Y+G
Sbjct: 65  IYNRLDHYYLNDIKGLENPTSEVLAKWIWQQLKPNLPLLSKVEIKETCTAGCIYKG 120


>gi|149190806|ref|ZP_01869071.1| 6-pyruvoyl-tetrahydropterin synthase [Vibrio shilonii AK1]
 gi|148835368|gb|EDL52340.1| 6-pyruvoyl-tetrahydropterin synthase [Vibrio shilonii AK1]
          Length = 120

 Score =  143 bits (361), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 59/116 (50%), Positives = 82/116 (70%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ + F FEAAH LP VP+ HKC R+HGHS+ V L +EG+VDP TG+V DF  I+  F P
Sbjct: 4   ELYKEFMFEAAHHLPHVPEGHKCGRLHGHSFLVRLYVEGEVDPHTGWVVDFAEIKAAFKP 63

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           + ++LDH+ LN+IE LENPT+E +A WIW +L  +L +LS V + ET  +   Y+G
Sbjct: 64  IYDRLDHYYLNDIEGLENPTSEVLAKWIWGQLKPNLPLLSKVEIKETCTAGCIYKG 119


>gi|260772903|ref|ZP_05881819.1| queuosine biosynthesis QueD PTPS-I [Vibrio metschnikovii CIP 69.14]
 gi|260612042|gb|EEX37245.1| queuosine biosynthesis QueD PTPS-I [Vibrio metschnikovii CIP 69.14]
          Length = 119

 Score =  143 bits (361), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 58/116 (50%), Positives = 80/116 (68%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I + F FEAAH LP VP+ HKC R+HGHS+ V L + G+VD  TG++ DF  I+  F P
Sbjct: 4   EIYKEFMFEAAHHLPHVPEGHKCGRLHGHSFLVRLYVAGEVDAHTGWLIDFAEIKAAFQP 63

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           + ++LDH+ LN+IE LENPT+E +A WIW++L  SL +LS V + ET  +   Y G
Sbjct: 64  IYDRLDHYYLNDIEGLENPTSEVLAKWIWQQLKPSLPLLSKVEIKETCTAGCVYTG 119


>gi|227114088|ref|ZP_03827744.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 120

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 60/115 (52%), Positives = 78/115 (67%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAH LP VP  HKC R+HGHS+ V L + G+VDP TG+V DF  ++  F P 
Sbjct: 5   LFKDFQFEAAHHLPHVPDGHKCGRLHGHSFMVRLEITGEVDPYTGWVMDFSELKAAFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LNEI  LENPT+E +A WIW +L  +L +LS+V V ET  +   Y+G
Sbjct: 65  WERLDHHYLNEIPGLENPTSEVLAHWIWHQLKPTLPLLSAVMVKETCTAGCVYRG 119


>gi|71898622|ref|ZP_00680792.1| 6-pyruvoyltetrahydropterin synthase [Xylella fastidiosa Ann-1]
 gi|71731569|gb|EAO33630.1| 6-pyruvoyltetrahydropterin synthase [Xylella fastidiosa Ann-1]
          Length = 118

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 58/117 (49%), Positives = 82/117 (70%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M I + F  EAAHRLP VP  HKC R+HGHS+R+E+ + G ++  TG++ DF ++++ F 
Sbjct: 1   MDIFKVFIIEAAHRLPHVPPGHKCARLHGHSFRIEVHVSGALESDTGWIMDFSDLKRAFQ 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ ++LDHH LNEIE LENPT+E +AIW+W RL   L  L+ + V+ET  S   Y+G
Sbjct: 61  PIYDQLDHHYLNEIEGLENPTSERLAIWVWDRLKPVLPALTEIVVHETCTSGCRYRG 117


>gi|262196689|ref|YP_003267898.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Haliangium ochraceum DSM 14365]
 gi|262080036|gb|ACY16005.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Haliangium ochraceum DSM 14365]
          Length = 121

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 57/116 (49%), Positives = 85/116 (73%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++++ + FEAAH+LP+VP THKC R+HGHSY + + + GD+DP+ G++ DF +I+Q   P
Sbjct: 4   QLSRDYRFEAAHQLPKVPPTHKCSRVHGHSYHLTITLSGDIDPEMGWLIDFADIDQVVDP 63

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           ++E+LDH  LN+IE LENPT+E +A+W+W+ L+  L  L  V V ETP S   Y+G
Sbjct: 64  VIERLDHRLLNDIEGLENPTSELLAVWLWRALAPGLPTLVEVMVAETPTSRCVYRG 119


>gi|15836798|ref|NP_297486.1| 6-pyruvoyl tetrahydrobiopterin synthase [Xylella fastidiosa 9a5c]
 gi|9104995|gb|AAF83006.1|AE003873_3 6-pyruvoyl tetrahydrobiopterin synthase [Xylella fastidiosa 9a5c]
          Length = 123

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 82/117 (70%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M I + F  EAAHRLP VP  HKC R+HGHS+R+E+ + G ++  TG++ DF ++++ F 
Sbjct: 6   MDIFKVFIIEAAHRLPHVPPGHKCARLHGHSFRIEVHVSGALESDTGWIMDFSDLKRAFQ 65

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ ++LDHH LNEIE LENPT+E +A+W+W RL   L  L+ + V+ET  S   Y+G
Sbjct: 66  PIYDQLDHHYLNEIEGLENPTSERLAMWVWDRLKPVLPALTEIVVHETCTSGCRYRG 122


>gi|71275477|ref|ZP_00651763.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Xylella fastidiosa Dixon]
 gi|71900656|ref|ZP_00682781.1| 6-pyruvoyltetrahydropterin synthase [Xylella fastidiosa Ann-1]
 gi|170729398|ref|YP_001774831.1| 6-pyruvoyltetrahydropterin synthase [Xylella fastidiosa M12]
 gi|71163777|gb|EAO13493.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Xylella fastidiosa Dixon]
 gi|71729591|gb|EAO31697.1| 6-pyruvoyltetrahydropterin synthase [Xylella fastidiosa Ann-1]
 gi|167964191|gb|ACA11201.1| 6-pyruvoyltetrahydropterin synthase [Xylella fastidiosa M12]
          Length = 118

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 82/117 (70%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M I + F  EAAHRLP VP  HKC R+HGHS+R+E+ + G ++  TG++ DF ++++ F 
Sbjct: 1   MDIFKVFIIEAAHRLPHVPPGHKCTRLHGHSFRIEVHVSGALESDTGWIMDFSDLKRAFQ 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ ++LDHH LNEIE LENPT+E +A+W+W RL   L  L+ + V+ET  S   Y+G
Sbjct: 61  PIYDQLDHHYLNEIEGLENPTSERLAMWVWDRLKPVLPALTEIVVHETCTSGCRYRG 117


>gi|59711767|ref|YP_204543.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Vibrio fischeri
           ES114]
 gi|197335085|ref|YP_002155961.1| queuosine biosynthesis protein QueD [Vibrio fischeri MJ11]
 gi|59479868|gb|AAW85655.1| 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) [Vibrio fischeri
           ES114]
 gi|197316575|gb|ACH66022.1| queuosine biosynthesis protein QueD [Vibrio fischeri MJ11]
          Length = 120

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 56/116 (48%), Positives = 80/116 (68%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ + F FEAAH LP VP+ HKC R+HGHS+ V L +EG+VDP TG+V DF  I+  F P
Sbjct: 4   ELYKDFMFEAAHHLPHVPEGHKCGRLHGHSFLVRLYVEGEVDPHTGWVVDFAEIKAAFKP 63

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
             ++LDH+ LN+I+ LENPT+E +A WIW  +  +L +LS + + ET  +   Y+G
Sbjct: 64  TYDRLDHYYLNDIKGLENPTSEVLAKWIWNEVKPNLPLLSKIEIKETCTAGCTYRG 119


>gi|209694861|ref|YP_002262789.1| 6-pyruvoyl tetrahydrobiopterin synthase [Aliivibrio salmonicida
           LFI1238]
 gi|208008812|emb|CAQ79015.1| 6-pyruvoyl tetrahydrobiopterin synthase [Aliivibrio salmonicida
           LFI1238]
          Length = 120

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 56/116 (48%), Positives = 79/116 (68%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ + F FEAAH LP VP+ HKC R+HGHS+ V L +EG+VD  TG+V DF  I+  F P
Sbjct: 4   ELYKDFMFEAAHHLPHVPEGHKCGRLHGHSFLVRLYVEGEVDQHTGWVIDFSEIKAAFKP 63

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
             ++LDH+ LN+I+ LENPT+E +A WIW  +  SL +LS + + ET  +   Y+G
Sbjct: 64  TYDRLDHYYLNDIKGLENPTSEVLAKWIWNEVKPSLPLLSKIEIKETCTAGCTYRG 119


>gi|253689734|ref|YP_003018924.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251756312|gb|ACT14388.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 120

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 60/115 (52%), Positives = 79/115 (68%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAH LP VP+ HKC R+HGHS+ V L + G+VDP TG+V DF  ++  F P 
Sbjct: 5   LFKDFQFEAAHHLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWVMDFSELKAAFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LNEI  LENPT+E +A WIW +L  +L +LS+V V ET  +   Y+G
Sbjct: 65  WERLDHHYLNEIPGLENPTSEVLAHWIWHQLKPTLPLLSAVMVKETCTAGCVYKG 119


>gi|227329733|ref|ZP_03833757.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 120

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 60/115 (52%), Positives = 78/115 (67%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAH LP VP  HKC R+HGHS+ V L + G+VDP TG+V DF  ++  F P 
Sbjct: 5   LFKDFQFEAAHHLPHVPDGHKCGRLHGHSFMVRLEITGEVDPYTGWVMDFSELKAAFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LNEI  LENPT+E +A WIW +L  +L +LS+V V ET  +   Y+G
Sbjct: 65  WERLDHHYLNEIPGLENPTSEVLAHWIWHQLKPTLPLLSAVMVKETCTAGCVYKG 119


>gi|94676726|ref|YP_588674.1| 6-pyruvoyl-tetrahydropterin synthase [Baumannia cicadellinicola
           str. Hc (Homalodisca coagulata)]
 gi|94219876|gb|ABF14035.1| 6-pyruvoyl-tetrahydropterin synthase [Baumannia cicadellinicola
           str. Hc (Homalodisca coagulata)]
          Length = 129

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 54/115 (46%), Positives = 78/115 (67%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFE+AH LP VP  HKC R+HGHS+RV + +   +D  TG++ DF  ++    P+
Sbjct: 15  LFKDFTFESAHYLPYVPAGHKCGRIHGHSFRVRIELTAKIDLYTGWIMDFAELKAVCQPI 74

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           +E+LDH  LN+I  LENPT+E +A WIW+RL  +L +LS+V + ET  S   Y+G
Sbjct: 75  IEQLDHSYLNKIPGLENPTSEVLAQWIWQRLLPNLPLLSAVYIKETCNSGCVYRG 129


>gi|261822767|ref|YP_003260873.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Pectobacterium wasabiae WPP163]
 gi|261606780|gb|ACX89266.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Pectobacterium wasabiae WPP163]
          Length = 120

 Score =  141 bits (355), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 59/115 (51%), Positives = 78/115 (67%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FEAAH LP VP+ HKC R+HGHS+ V L + G+VDP TG+V DF  ++  F   
Sbjct: 5   LFKDFQFEAAHHLPHVPEGHKCGRLHGHSFMVRLEITGEVDPYTGWVMDFSELKAAFKST 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            E+LDHH LNEI  LENPT+E +A WIW +L  +L +LS+V V ET  +   Y+G
Sbjct: 65  WERLDHHYLNEIPGLENPTSEVLAHWIWHQLKPALPLLSAVMVKETCTAGCVYKG 119


>gi|226328668|ref|ZP_03804186.1| hypothetical protein PROPEN_02563 [Proteus penneri ATCC 35198]
 gi|225203401|gb|EEG85755.1| hypothetical protein PROPEN_02563 [Proteus penneri ATCC 35198]
          Length = 120

 Score =  139 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 82/115 (71%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           I + F FEAAH LP VP+ HKC R+HGHS+ V L + G+V+  +G++ DF +++  F P 
Sbjct: 5   IFKDFQFEAAHHLPHVPEGHKCGRLHGHSFLVRLELTGEVNAHSGWLIDFADVKAAFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           LE+LDH+ LNEIE LENPT+E +A WIW+++  SL +LS+V V ET  +   Y+G
Sbjct: 65  LERLDHYYLNEIEGLENPTSEVLAKWIWQQVKPSLPLLSAVMVKETCTAGCIYRG 119


>gi|183600237|ref|ZP_02961730.1| hypothetical protein PROSTU_03779 [Providencia stuartii ATCC 25827]
 gi|188022532|gb|EDU60572.1| hypothetical protein PROSTU_03779 [Providencia stuartii ATCC 25827]
          Length = 120

 Score =  139 bits (350), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 56/115 (48%), Positives = 83/115 (72%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           I + F FEAAH+LP VP+ HKC R+HGHS+ V L + G+V+ K+G++ DF ++++ F P+
Sbjct: 5   IYKDFHFEAAHKLPYVPEGHKCGRLHGHSFMVRLELTGEVEEKSGWLIDFSDVKKAFKPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           L++LDH+ LN+IE LENPT+E +A WIW +    L +LS+V V ET  +   Y+G
Sbjct: 65  LDQLDHYYLNDIEGLENPTSEVLASWIWHKTKPLLPLLSAVTVKETCNAGCIYRG 119


>gi|118616970|ref|YP_905302.1| 6-pyruvoyl tetrahydrobiopterin synthase [Mycobacterium ulcerans
           Agy99]
 gi|118569080|gb|ABL03831.1| 6-pyruvoyl tetrahydrobiopterin synthase [Mycobacterium ulcerans
           Agy99]
          Length = 160

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 59/117 (50%), Positives = 82/117 (70%), Gaps = 1/117 (0%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I   FTFE+AHRLP VP  HKC R+HGHSYR    +EG VDP+ G++ DF  I+    P
Sbjct: 6   EIYCEFTFESAHRLPNVPAGHKCGRLHGHSYRARTYVEGPVDPRAGWIVDFGKIKDACKP 65

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS-ILSSVRVYETPMSWVEYQG 117
           ++ +LDH+ LNEI+ LENPT+E +++WIW+ L+T L  ++S+V V ET  S   Y+G
Sbjct: 66  VIARLDHYYLNEIDGLENPTSEQLSMWIWRELATLLPMMMSAVSVSETCSSGCMYRG 122


>gi|320155976|ref|YP_004188355.1| queuosine biosynthesis QueD, PTPS-I [Vibrio vulnificus MO6-24/O]
 gi|319931288|gb|ADV86152.1| queuosine biosynthesis QueD, PTPS-I [Vibrio vulnificus MO6-24/O]
          Length = 111

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 58/109 (53%), Positives = 78/109 (71%)

Query: 9   FEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDH 68
           FEAAH LP VP+ HKC R+HGHS+ V L +EG+VDP TG+V DF  I+  F P+  +LDH
Sbjct: 2   FEAAHHLPHVPEGHKCGRLHGHSFLVRLYVEGEVDPHTGWVVDFAEIKAAFKPIYNRLDH 61

Query: 69  HCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           + LN+IE LENPT+E +A WIW++L  +L +LS V + ET  +   Y+G
Sbjct: 62  YYLNDIEGLENPTSEVLAKWIWQQLKPNLPLLSKVEIKETCTAGCIYKG 110


>gi|171911786|ref|ZP_02927256.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Verrucomicrobium
           spinosum DSM 4136]
          Length = 121

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 56/116 (48%), Positives = 79/116 (68%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ + + FEAA  LP +P  HKC RMHGHS+++E+ +EG+VDPK G+V D   I +  +P
Sbjct: 4   RLVKDYRFEAAQTLPSLPGDHKCKRMHGHSFKIEIAVEGEVDPKIGWVYDHAQISKAMNP 63

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           L++ LDH  LNEIE LENPT EN+A W W RLS  L  L  + ++ETP +   ++G
Sbjct: 64  LMDLLDHSYLNEIEGLENPTIENMAAWFWVRLSPQLPGLCEIVIHETPTARCVFRG 119


>gi|162456903|ref|YP_001619270.1| putative 6-pyruvoyltetrahydropterin synthase [Sorangium cellulosum
           'So ce 56']
 gi|161167485|emb|CAN98790.1| putative 6-pyruvoyltetrahydropterin synthase [Sorangium cellulosum
           'So ce 56']
          Length = 120

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 56/116 (48%), Positives = 84/116 (72%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++   F FEAAHRLP+VP+ HKC R+HGHS++VE+ + G V+ +TG+  D+ ++ + ++P
Sbjct: 4   RLVHEFRFEAAHRLPKVPQGHKCARLHGHSFKVEVAIRGPVNEETGWFIDYSHLYEAWAP 63

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           L + LDHH LNE+  LENPT+E +A WIW RL+ SL  L+ V ++ET  +  EY+G
Sbjct: 64  LHDLLDHHYLNEVPGLENPTSEVLARWIWTRLAPSLPSLNRVTIFETCDARCEYEG 119


>gi|312891087|ref|ZP_07750610.1| preQ(0) biosynthesis protein QueD [Mucilaginibacter paludis DSM
           18603]
 gi|311296395|gb|EFQ73541.1| preQ(0) biosynthesis protein QueD [Mucilaginibacter paludis DSM
           18603]
          Length = 118

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 55/117 (47%), Positives = 77/117 (65%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M + + FTF++AH L RVP  HKC  +HGH+Y + +  EGDV  + G+V DF ++     
Sbjct: 1   MILYKQFTFDSAHFLSRVPDGHKCKAIHGHTYHLTVYAEGDVKEQEGWVFDFGDMTSVVK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P++E LDH  LN IE LENPTAE +A+W+WK++   L  LS + + ETP S V Y+G
Sbjct: 61  PIIETLDHAMLNNIEGLENPTAELLAVWLWKKIKPELPALSKIELKETPTSGVIYEG 117


>gi|21672675|ref|NP_660742.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Buchnera
           aphidicola str. Sg (Schizaphis graminum)]
 gi|25091060|sp|Q8K9D8|QUED_BUCAP RecName: Full=6-carboxy-5,6,7,8-tetrahydropterin synthase;
           Short=CPH4 synthase; AltName: Full=Queuosine
           biosynthesis protein queD
 gi|21623313|gb|AAM67953.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Buchnera
           aphidicola str. Sg (Schizaphis graminum)]
          Length = 120

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 58/116 (50%), Positives = 79/116 (68%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           I + F FEAAH LP VPK HKC R+HGHS+ V L ++  ++ K G++ D+  I+  F P+
Sbjct: 5   IFKDFQFEAAHYLPYVPKMHKCRRLHGHSFFVRLELKDKINEKNGWIIDYAEIKLAFQPI 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQGF 118
            ++LDHH LN+I  LENPT+E +A WIW RL   LSIL+++ + ET  S   YQGF
Sbjct: 65  YDQLDHHFLNDIPGLENPTSEILAKWIWHRLKPKLSILNTIIIKETCTSGCIYQGF 120


>gi|74318332|ref|YP_316072.1| 6-pyruvoyl tetrahydrobiopterin synthase [Thiobacillus denitrificans
           ATCC 25259]
 gi|74057827|gb|AAZ98267.1| 6-pyruvoyl tetrahydrobiopterin synthase [Thiobacillus denitrificans
           ATCC 25259]
          Length = 122

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 55/117 (47%), Positives = 78/117 (66%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M I + F  + A RLP +P +H+C R+HGHS+ VEL + G+VD + G+V DF  IE  + 
Sbjct: 1   MDIFRIFHLQCARRLPALPASHRCSRVHGHSFEVELTVSGEVDARLGWVCDFAEIEAAWR 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ E LDH  LN+++ L+NPT+E +AIW+W +L  SL  LS +RV ET  S   Y+G
Sbjct: 61  PIHEALDHRYLNDVDRLDNPTSERLAIWLWAQLKPSLPGLSQIRVMETHDSGCIYRG 117


>gi|189219306|ref|YP_001939947.1| 6-pyruvoyl-tetrahydropterin synthase [Methylacidiphilum infernorum
           V4]
 gi|189186164|gb|ACD83349.1| 6-pyruvoyl-tetrahydropterin synthase [Methylacidiphilum infernorum
           V4]
          Length = 161

 Score =  130 bits (327), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 49/115 (42%), Positives = 72/115 (62%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ F FEAA  LP  P+ HKC R HGHS+++ + + G+VDP+ G + D   I +   PL
Sbjct: 46  LSKDFDFEAAQALPSFPEGHKCRRTHGHSFKLTVSVRGEVDPQKGVLYDHGKISEAVCPL 105

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           +E+LDH+ LN+IE L NPT EN+A W W +L   L  L  + + ET  +   Y+G
Sbjct: 106 IEQLDHYYLNDIEGLSNPTIENMAGWFWNKLKDKLPGLYEITIQETARTRCIYRG 160


>gi|289810639|ref|ZP_06541268.1| queuosine biosynthesis protein QueD [Salmonella enterica subsp.
           enterica serovar Typhi str. AG3]
          Length = 118

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 51/103 (49%), Positives = 74/103 (71%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTFEAAHRLP VP+ HKC R+HGHS+ V L + G+VDP TG++ DF +++  F P 
Sbjct: 5   LYKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIMDFADLKAAFKPT 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRV 105
            ++LDH+ LN+I  L NPT+E +A WIW ++   + +LS+V V
Sbjct: 65  YDRLDHYYLNDIPGLSNPTSEVLAKWIWDQVKPVVPLLSAVMV 107


>gi|153004749|ref|YP_001379074.1| putative 6-pyruvoyl tetrahydropterin synthase [Anaeromyxobacter sp.
           Fw109-5]
 gi|152028322|gb|ABS26090.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Anaeromyxobacter sp. Fw109-5]
          Length = 129

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 76/118 (64%), Gaps = 5/118 (4%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M++   F F AAHRLPR      C RMHGH+YR  + +EGDVDP+TG + DF  +++   
Sbjct: 12  MRLDVEFYFAAAHRLPRYE--GPCFRMHGHNYRFFVALEGDVDPRTGMIADFGEVKRIVQ 69

Query: 61  PLL-EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
             +  +LDH  LN++  LENPTAENIA WIW+ L   +  L+ VR++E P S V Y+G
Sbjct: 70  EQVLARLDHRTLNDV--LENPTAENIARWIWEVLEPHVPGLAEVRLFEIPDSCVTYRG 125


>gi|220917100|ref|YP_002492404.1| queuosine biosynthesis protein QueD [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219954954|gb|ACL65338.1| queuosine biosynthesis protein QueD [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 129

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 53/118 (44%), Positives = 75/118 (63%), Gaps = 5/118 (4%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M++   F F AAHRLPR      C RMHGH+YR  + +EG+VDP TG + DF ++++   
Sbjct: 12  MRLDVEFYFAAAHRLPRYE--GPCFRMHGHNYRFFVALEGEVDPATGMIADFGDVKRIVQ 69

Query: 61  PLL-EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
             +  ++DH  LN++  L+NPTAENIA W+W+ L   L  L  +R+YE P S V Y+G
Sbjct: 70  EHVLARVDHRTLNDV--LDNPTAENIARWVWEVLEPHLPGLCEIRLYEIPDSCVTYRG 125


>gi|197122318|ref|YP_002134269.1| queuosine biosynthesis protein QueD [Anaeromyxobacter sp. K]
 gi|196172167|gb|ACG73140.1| queuosine biosynthesis protein QueD [Anaeromyxobacter sp. K]
          Length = 129

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 52/118 (44%), Positives = 75/118 (63%), Gaps = 5/118 (4%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M++   F F AAHRLPR      C RMHGH+YR  + +EG++DP TG + DF ++++   
Sbjct: 12  MRLDVEFYFAAAHRLPRYE--GPCFRMHGHNYRFFVALEGEIDPATGMIADFGDVKRIVQ 69

Query: 61  PLL-EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
             +  ++DH  LN++  L+NPTAENIA W+W+ L   L  L  +R+YE P S V Y+G
Sbjct: 70  EHVLARVDHRTLNDV--LDNPTAENIARWVWEVLEPHLPGLCEIRLYEIPDSCVTYRG 125


>gi|306843410|ref|ZP_07476011.1| queuosine biosynthesis protein QueD [Brucella sp. BO1]
 gi|306276101|gb|EFM57801.1| queuosine biosynthesis protein QueD [Brucella sp. BO1]
          Length = 121

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 63/116 (54%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT+ F F A+H+L  +P  H+C R+HGH+Y VE+ +        GFV D+  +  +  
Sbjct: 2   FRITKEFHFSASHQLTGLPADHQCARLHGHNYIVEVELSAPDLDTHGFVRDYHELAAFKH 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            + +  DH  LN++   E  TAE +A   +         +S+VRV ETP +W EY+
Sbjct: 62  YIDDTFDHRHLNDVLGHEQTTAERLAKHFFDWCHARWPEISAVRVSETPKTWAEYR 117


>gi|23502821|ref|NP_698948.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella suis 1330]
 gi|62290821|ref|YP_222614.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella abortus bv. 1
           str. 9-941]
 gi|82700733|ref|YP_415307.1| putative 6-pyruvoyl tetrahydropterin synthase [Brucella melitensis
           biovar Abortus 2308]
 gi|148560529|ref|YP_001259790.1| queuosine biosynthesis protein QueD [Brucella ovis ATCC 25840]
 gi|161619891|ref|YP_001593778.1| hypothetical protein BCAN_A2018 [Brucella canis ATCC 23365]
 gi|163843995|ref|YP_001628399.1| hypothetical protein BSUIS_A1813 [Brucella suis ATCC 23445]
 gi|189025040|ref|YP_001935808.1| hypothetical protein BAbS19_I18520 [Brucella abortus S19]
 gi|225853409|ref|YP_002733642.1| queuosine biosynthesis protein QueD [Brucella melitensis ATCC
           23457]
 gi|237816335|ref|ZP_04595328.1| queuosine biosynthesis protein QueD [Brucella abortus str. 2308 A]
 gi|254690111|ref|ZP_05153365.1| queuosine biosynthesis protein QueD [Brucella abortus bv. 6 str.
           870]
 gi|254694601|ref|ZP_05156429.1| queuosine biosynthesis protein QueD [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696226|ref|ZP_05158054.1| queuosine biosynthesis protein QueD [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254700611|ref|ZP_05162439.1| queuosine biosynthesis protein QueD [Brucella suis bv. 5 str. 513]
 gi|254704981|ref|ZP_05166809.1| queuosine biosynthesis protein QueD [Brucella suis bv. 3 str. 686]
 gi|254707504|ref|ZP_05169332.1| queuosine biosynthesis protein QueD [Brucella pinnipedialis
           M163/99/10]
 gi|254708956|ref|ZP_05170767.1| queuosine biosynthesis protein QueD [Brucella pinnipedialis B2/94]
 gi|254713615|ref|ZP_05175426.1| queuosine biosynthesis protein QueD [Brucella ceti M644/93/1]
 gi|254716031|ref|ZP_05177842.1| queuosine biosynthesis protein QueD [Brucella ceti M13/05/1]
 gi|254731144|ref|ZP_05189722.1| queuosine biosynthesis protein QueD [Brucella abortus bv. 4 str.
           292]
 gi|256030483|ref|ZP_05444097.1| queuosine biosynthesis protein QueD [Brucella pinnipedialis
           M292/94/1]
 gi|256059944|ref|ZP_05450129.1| queuosine biosynthesis protein QueD [Brucella neotomae 5K33]
 gi|256158469|ref|ZP_05456367.1| queuosine biosynthesis protein QueD [Brucella ceti M490/95/1]
 gi|256253888|ref|ZP_05459424.1| queuosine biosynthesis protein QueD [Brucella ceti B1/94]
 gi|256258365|ref|ZP_05463901.1| queuosine biosynthesis protein QueD [Brucella abortus bv. 9 str.
           C68]
 gi|256263111|ref|ZP_05465643.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella melitensis bv. 2
           str. 63/9]
 gi|256370375|ref|YP_003107886.1| queuosine biosynthesis protein QueD [Brucella microti CCM 4915]
 gi|260546088|ref|ZP_05821828.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella abortus NCTC
           8038]
 gi|260562885|ref|ZP_05833371.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella melitensis bv. 1
           str. 16M]
 gi|260567545|ref|ZP_05838015.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella suis bv. 4 str.
           40]
 gi|260755650|ref|ZP_05867998.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella abortus bv. 6
           str. 870]
 gi|260758875|ref|ZP_05871223.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella abortus bv. 4
           str. 292]
 gi|260760599|ref|ZP_05872942.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella abortus bv. 2
           str. 86/8/59]
 gi|260884675|ref|ZP_05896289.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella abortus bv. 9
           str. C68]
 gi|261214925|ref|ZP_05929206.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella abortus bv. 3
           str. Tulya]
 gi|261217799|ref|ZP_05932080.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella ceti M13/05/1]
 gi|261221025|ref|ZP_05935306.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella ceti B1/94]
 gi|261314987|ref|ZP_05954184.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella pinnipedialis
           M163/99/10]
 gi|261316455|ref|ZP_05955652.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella pinnipedialis
           B2/94]
 gi|261321353|ref|ZP_05960550.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella ceti M644/93/1]
 gi|261323916|ref|ZP_05963113.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella neotomae 5K33]
 gi|261751120|ref|ZP_05994829.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella suis bv. 5 str.
           513]
 gi|261755682|ref|ZP_05999391.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella suis bv. 3 str.
           686]
 gi|265987525|ref|ZP_06100082.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella pinnipedialis
           M292/94/1]
 gi|265996985|ref|ZP_06109542.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella ceti M490/95/1]
 gi|294851211|ref|ZP_06791884.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella sp. NVSL 07-0026]
 gi|297247207|ref|ZP_06930925.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella abortus bv. 5
           str. B3196]
 gi|23348845|gb|AAN30863.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Brucella suis
           1330]
 gi|62196953|gb|AAX75253.1| hypothetical 6-pyruvoyl tetrahydrobiopterin synthase [Brucella
           abortus bv. 1 str. 9-941]
 gi|82616834|emb|CAJ11930.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Brucella melitensis biovar Abortus 2308]
 gi|148371786|gb|ABQ61765.1| queuosine biosynthesis protein QueD [Brucella ovis ATCC 25840]
 gi|161336702|gb|ABX63007.1| Hypothetical protein BCAN_A2018 [Brucella canis ATCC 23365]
 gi|163674718|gb|ABY38829.1| Hypothetical protein BSUIS_A1813 [Brucella suis ATCC 23445]
 gi|189020612|gb|ACD73334.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Brucella abortus S19]
 gi|225641774|gb|ACO01688.1| queuosine biosynthesis protein QueD [Brucella melitensis ATCC
           23457]
 gi|237788402|gb|EEP62617.1| queuosine biosynthesis protein QueD [Brucella abortus str. 2308 A]
 gi|256000538|gb|ACU48937.1| queuosine biosynthesis protein QueD [Brucella microti CCM 4915]
 gi|260096195|gb|EEW80071.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella abortus NCTC
           8038]
 gi|260152901|gb|EEW87993.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella melitensis bv. 1
           str. 16M]
 gi|260157063|gb|EEW92143.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella suis bv. 4 str.
           40]
 gi|260669193|gb|EEX56133.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella abortus bv. 4
           str. 292]
 gi|260671031|gb|EEX57852.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella abortus bv. 2
           str. 86/8/59]
 gi|260675758|gb|EEX62579.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella abortus bv. 6
           str. 870]
 gi|260874203|gb|EEX81272.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella abortus bv. 9
           str. C68]
 gi|260916532|gb|EEX83393.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella abortus bv. 3
           str. Tulya]
 gi|260919609|gb|EEX86262.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella ceti B1/94]
 gi|260922888|gb|EEX89456.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella ceti M13/05/1]
 gi|261294043|gb|EEX97539.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella ceti M644/93/1]
 gi|261295678|gb|EEX99174.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella pinnipedialis
           B2/94]
 gi|261299896|gb|EEY03393.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella neotomae 5K33]
 gi|261304013|gb|EEY07510.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella pinnipedialis
           M163/99/10]
 gi|261740873|gb|EEY28799.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella suis bv. 5 str.
           513]
 gi|261745435|gb|EEY33361.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella suis bv. 3 str.
           686]
 gi|262551453|gb|EEZ07443.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella ceti M490/95/1]
 gi|263093012|gb|EEZ17162.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella melitensis bv. 2
           str. 63/9]
 gi|264659722|gb|EEZ29983.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella pinnipedialis
           M292/94/1]
 gi|294819800|gb|EFG36799.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella sp. NVSL 07-0026]
 gi|297174376|gb|EFH33723.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella abortus bv. 5
           str. B3196]
 gi|326409972|gb|ADZ67037.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Brucella melitensis M28]
 gi|326539689|gb|ADZ87904.1| queuosine biosynthesis protein QueD [Brucella melitensis M5-90]
          Length = 121

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 62/116 (53%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT+ F F A+H+L  +P  H+C R+HGH+Y VE+ +        GFV D+  +     
Sbjct: 2   FRITKEFHFSASHQLTGLPADHQCARLHGHNYIVEVELSAPDLDTHGFVRDYHELAALKH 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            + +  DH  LN++   E  TAE +A   +         +S+VRV ETP +W EY+
Sbjct: 62  YIDDTFDHRHLNDVLGHEQTTAERLAKHFFDWCHARWPEISAVRVSETPKTWAEYR 117


>gi|254502383|ref|ZP_05114534.1| 6-pyruvoyl tetrahydropterin synthase superfamily [Labrenzia
           alexandrii DFL-11]
 gi|222438454|gb|EEE45133.1| 6-pyruvoyl tetrahydropterin synthase superfamily [Labrenzia
           alexandrii DFL-11]
          Length = 139

 Score =  126 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 38/115 (33%), Positives = 64/115 (55%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +IT+ F F A+H+L  +P  H C R HGH+Y VE+ +      + GFV D+  ++   + 
Sbjct: 14  RITKEFHFSASHQLIGLPDDHPCARFHGHNYVVEVELASSELNQIGFVRDYNELKSLKTY 73

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
           + + LDH  LN++   +  TAE +A  ++   +      ++VRV ETP +  EY+
Sbjct: 74  IDDTLDHRHLNDVLGDDCVTAERLAKHLFDWCAQKWPETTAVRVKETPKTCAEYR 128


>gi|254718023|ref|ZP_05179834.1| queuosine biosynthesis protein QueD [Brucella sp. 83/13]
 gi|265982971|ref|ZP_06095706.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella sp. 83/13]
 gi|306839804|ref|ZP_07472605.1| queuosine biosynthesis protein QueD [Brucella sp. NF 2653]
 gi|264661563|gb|EEZ31824.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella sp. 83/13]
 gi|306405159|gb|EFM61437.1| queuosine biosynthesis protein QueD [Brucella sp. NF 2653]
          Length = 121

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 63/116 (54%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT+ F F A+H+L  +P  H+C R+HGH+Y VE+ +        GFV D+  +  +  
Sbjct: 2   FRITKEFHFSASHQLTGLPTDHQCARLHGHNYIVEVELSAPDLDTHGFVRDYHELAAFKH 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            + +  DH  LN++   E  TAE +A   +         +S+VRV ETP +W EY+
Sbjct: 62  YIDDTFDHRHLNDVLGHEQTTAERLAKHFFDWCHARWPEISAVRVSETPKTWAEYR 117


>gi|153008344|ref|YP_001369559.1| putative 6-pyruvoyl tetrahydropterin synthase [Ochrobactrum
           anthropi ATCC 49188]
 gi|151560232|gb|ABS13730.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Ochrobactrum anthropi ATCC 49188]
          Length = 118

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 66/116 (56%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT+ F F A+H+L  +P  H+C R+HGH+Y VE+ +  D   + GFV D+  +  +  
Sbjct: 2   FRITKEFHFSASHQLTGLPDDHQCARLHGHNYIVEVELSADDLNQHGFVRDYHELAPFKR 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            + +  DH  LN++   +  TAE +A   ++        +S+VRV ETP +W EY+
Sbjct: 62  YIDDCFDHRHLNDVLGHDQSTAETLARHFFEWCYARWPEISAVRVSETPKTWAEYR 117


>gi|192896485|gb|ACF06634.1| ToyB [Streptomyces rimosus]
          Length = 131

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 49/118 (41%), Positives = 71/118 (60%), Gaps = 2/118 (1%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEG--DVDPKTGFVDDFFNIEQY 58
            +I++ F F A+HRL  + + H C RMHGH+Y VEL +    D   K GFV D+  +  +
Sbjct: 13  FRISKEFHFSASHRLDHLDEGHPCSRMHGHNYVVELELSAGDDALTKAGFVRDYGELAAF 72

Query: 59  FSPLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
              L  +LDH  LN++ +  NP+AEN+A WI +R  T    L++VRV ET  +W EY+
Sbjct: 73  KQWLDAELDHRHLNDVVDGLNPSAENLARWIHERWRTGFPELTAVRVSETDKTWAEYR 130


>gi|300022912|ref|YP_003755523.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Hyphomicrobium denitrificans ATCC 51888]
 gi|299524733|gb|ADJ23202.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Hyphomicrobium denitrificans ATCC 51888]
          Length = 181

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 50/114 (43%), Positives = 76/114 (66%), Gaps = 1/114 (0%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           ++IT  +TFEAAH LP+V   HKC R+HGH+YRV++ + G    + GFV D+  ++    
Sbjct: 67  IRITATYTFEAAHFLPKVHDGHKCRRLHGHNYRVDVSVAG-GLDERGFVLDYAELDGIVQ 125

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVE 114
           P++++LDH CLN+I  LENPT+E +A+W+  R++        +RV+ETP   VE
Sbjct: 126 PVIDELDHRCLNDIPGLENPTSEILALWLRSRIAAKAGTKPMIRVWETPRYLVE 179


>gi|239832975|ref|ZP_04681304.1| queuosine biosynthesis protein QueD [Ochrobactrum intermedium LMG
           3301]
 gi|239825242|gb|EEQ96810.1| queuosine biosynthesis protein QueD [Ochrobactrum intermedium LMG
           3301]
          Length = 118

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 66/116 (56%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT+ F F A+H+L  +P+ H+C R+HGH+Y VE+ +      + GFV D+  +  +  
Sbjct: 2   FRITKEFHFSASHQLTGLPEDHQCARLHGHNYIVEVELSASDLNEHGFVRDYHELAPFKR 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            + +  DH  LN++   +  TAE +A   ++        +S+VRV ETP +W EY+
Sbjct: 62  YIDDCFDHRHLNDVLGHDQSTAETLARHFFEWCHARWPEISAVRVSETPKTWAEYR 117


>gi|86158389|ref|YP_465174.1| 6-pyruvoyl tetrahydropterin synthase [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85774900|gb|ABC81737.1| 6-pyruvoyl tetrahydropterin synthase [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 129

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 53/118 (44%), Positives = 77/118 (65%), Gaps = 5/118 (4%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M++   F F AAHRLPR      C RMHGH+YR  + +EG+VDP TG + DF ++++  +
Sbjct: 12  MRLDVEFYFAAAHRLPRYE--GPCFRMHGHNYRFFVALEGEVDPATGMIADFGDVKRIVA 69

Query: 61  PLL-EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
             +  ++DH  LN++  L+NPTAENIA W+W+ L   L+ L  +R+YE P S V Y+G
Sbjct: 70  EHVLARVDHRTLNDV--LDNPTAENIARWMWEVLEPHLAGLCEIRLYEIPDSCVTYRG 125


>gi|256112301|ref|ZP_05453222.1| queuosine biosynthesis protein QueD [Brucella melitensis bv. 3 str.
           Ether]
 gi|265993734|ref|ZP_06106291.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella melitensis bv. 3
           str. Ether]
 gi|262764715|gb|EEZ10636.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella melitensis bv. 3
           str. Ether]
          Length = 121

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 41/116 (35%), Positives = 63/116 (54%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT+ F F A+H+L  +P  H+C R+HGH+Y VE+ +        GFV D+  +     
Sbjct: 2   FRITKEFHFSASHQLTGLPADHQCARLHGHNYIVEVELSAPDLDTHGFVRDYHELAALKH 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            + +  DH  LN++   E  TAE +A   +       S +S+VRV ETP +W EY+
Sbjct: 62  YIDDTFDHRHLNDVLGHEQTTAERLAKHFFDWCHARWSEISAVRVSETPKTWAEYR 117


>gi|225628172|ref|ZP_03786207.1| queuosine biosynthesis protein QueD [Brucella ceti str. Cudo]
 gi|260169390|ref|ZP_05756201.1| queuosine biosynthesis protein QueD [Brucella sp. F5/99]
 gi|261758912|ref|ZP_06002621.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella sp. F5/99]
 gi|225616997|gb|EEH14044.1| queuosine biosynthesis protein QueD [Brucella ceti str. Cudo]
 gi|261738896|gb|EEY26892.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella sp. F5/99]
          Length = 121

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 62/116 (53%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT+ F F A+H+L  +P  H+C R+HGH+Y VE+ +        GFV D+  +     
Sbjct: 2   FRITKEFHFSASHQLTGLPADHQCARLHGHNYIVEVELSAPNLDTHGFVRDYHELAALKH 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            + +  DH  LN++   E  TAE +A   +         +S++RV ETP +W EY+
Sbjct: 62  YIDDTFDHRHLNDVLGHEQTTAERLAKHFFDWCHARWPEISAMRVSETPKTWAEYR 117


>gi|110636376|ref|YP_676584.1| putative 6-pyruvoyl tetrahydropterin synthase [Mesorhizobium sp.
           BNC1]
 gi|110287360|gb|ABG65419.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Chelativorans sp. BNC1]
          Length = 118

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 43/116 (37%), Positives = 65/116 (56%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT+ F F A+H+L R+   H C R+HGH+Y VE+ +  D   + GFV D+ ++  +  
Sbjct: 2   FRITKQFHFSASHQLLRLADDHPCKRLHGHNYIVEIELAADALDENGFVRDYHDLAAFQR 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            + E LDH  LN++   +  TAE +A   +      L   S VRV ETP +W EY+
Sbjct: 62  YVDETLDHRHLNDVFGHDAVTAEWLAKHFFDWCRERLPETSCVRVSETPKTWAEYR 117


>gi|13474825|ref|NP_106395.1| 6-pyruvoyl tetrahydrobiopterin synthase [Mesorhizobium loti
           MAFF303099]
 gi|14025581|dbj|BAB52181.1| 6-pyruvoyl tetrahydrobiopterin synthase [Mesorhizobium loti
           MAFF303099]
          Length = 119

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 65/116 (56%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT+ F F A+H+L  +P  H+C R+HGH+Y V + + G    + GFV D+ ++  +  
Sbjct: 3   FRITKEFHFSASHQLTSLPPDHQCARLHGHNYIVVVELSGGELDEHGFVRDYQDLAAFKH 62

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            +    DH  LN++   ++ TAE +A   +      L   S+VRV ETP +W EY+
Sbjct: 63  YIDGTFDHRHLNDVLGHDHATAECLARHFYDWCKVRLPETSAVRVSETPKTWAEYR 118


>gi|42523343|ref|NP_968723.1| 6-pyruvoyltetrahydropterin synthase [Bdellovibrio bacteriovorus
           HD100]
 gi|39575550|emb|CAE79717.1| 6-pyruvoyltetrahydropterin synthase [Bdellovibrio bacteriovorus
           HD100]
          Length = 135

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 49/115 (42%), Positives = 73/115 (63%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ Q F  E+A  LP +P +H C RMHGHS+++ L + GD+DPK G+V D+ +I+    
Sbjct: 18  FELKQHFQIESARFLPHLPASHPCSRMHGHSFKLILTLVGDLDPKIGWVIDYNDIQALMK 77

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEY 115
           PLL+++DH  LNE+  LENPT+E +A W++ +    L  L  V V ETP +   Y
Sbjct: 78  PLLDQIDHRVLNEVPGLENPTSELLAKWLYDKARPFLPTLVKVTVAETPATECSY 132


>gi|307943819|ref|ZP_07659163.1| queuosine biosynthesis protein QueD [Roseibium sp. TrichSKD4]
 gi|307773449|gb|EFO32666.1| queuosine biosynthesis protein QueD [Roseibium sp. TrichSKD4]
          Length = 124

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 62/116 (53%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +I + F F A+H+L  +P+ H C R+HGH+Y VE+ +  +     GFV D+  +  + S
Sbjct: 2   FRIWKEFHFSASHQLFGLPEDHPCARLHGHNYVVEVELASEELDSVGFVRDYRELGAFKS 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            + + LDH  LN+I   +  TAE +A             + +VRV ETP +  EY+
Sbjct: 62  YIDDTLDHLHLNDILGDDGVTAERMAQHFHDWCKARWPEVVAVRVRETPKTCAEYR 117


>gi|15891588|ref|NP_357260.1| 6-pyruvoyl tetrahydropterin synthase [Agrobacterium tumefaciens
           str. C58]
 gi|15160024|gb|AAK90045.1| 6-pyruvoyl tetrahydropterin synthase [Agrobacterium tumefaciens
           str. C58]
          Length = 118

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 67/116 (57%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT+ F F A+H+L  +P  H+C+R+HGH+Y VE+ + G+   + GFV D+  +     
Sbjct: 2   FRITKEFHFSASHQLKSLPSDHQCNRLHGHNYIVEVELSGEELNEHGFVRDYHELAPLKR 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            + +  DH  LN++   +  TAE +A   +    TSL   S+VRV ET  +W EY+
Sbjct: 62  YIDDHFDHRHLNDVLGHDQVTAECLAKHFYDWCKTSLPETSAVRVSETTKTWAEYR 117


>gi|291443189|ref|ZP_06582579.1| 6-pyruvoyl tetrahydropterin synthase protein [Streptomyces
           roseosporus NRRL 15998]
 gi|291346136|gb|EFE73040.1| 6-pyruvoyl tetrahydropterin synthase protein [Streptomyces
           roseosporus NRRL 15998]
          Length = 121

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 49/116 (42%), Positives = 72/116 (62%), Gaps = 2/116 (1%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEG--DVDPKTGFVDDFFNIEQYFS 60
           IT+ F F A+HRL  +P  H+C R+HGH+Y +EL +    D   + GFV D+ ++  +  
Sbjct: 5   ITKEFHFSASHRLEHLPSDHQCARLHGHNYIIELKLSAAPDQLTEPGFVRDYGDLADFKK 64

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            L   LDH  LN+I E  NP+AEN+A+WI+ + +     LS+VRV ET  +W EY+
Sbjct: 65  WLDHTLDHRHLNDIIEDRNPSAENMAMWIYDQWTERYPELSAVRVSETDKTWAEYR 120


>gi|16264810|ref|NP_437602.1| putative 6-pyruvoyl tetrahydropterin synthase protein
           [Sinorhizobium meliloti 1021]
 gi|2808501|emb|CAA12531.1| ExsC protein [Sinorhizobium meliloti]
 gi|15140948|emb|CAC49462.1| 6-pyruvoyltetrahydropterin synthase [Sinorhizobium meliloti 1021]
          Length = 119

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 65/116 (56%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT+ F F A+H+L  +P  H+C R+HGH+Y VE+ + G+   + GFV D+  +     
Sbjct: 3   FRITKEFHFSASHQLKSLPAEHQCARLHGHNYIVEVELSGETLNEHGFVRDYHELAPLKQ 62

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            + E  DH  LN++   +  TAE +A   ++     L   ++VRV ET  +W EY+
Sbjct: 63  YIDECFDHRHLNDVLGHDRVTAECLAQHFYEWCQARLPETTAVRVSETAKTWAEYR 118


>gi|288942463|ref|YP_003444703.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Allochromatium vinosum DSM 180]
 gi|288897835|gb|ADC63671.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Allochromatium vinosum DSM 180]
          Length = 364

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 49/115 (42%), Positives = 66/115 (57%), Gaps = 1/115 (0%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F FE+AHRLP VP+ H C RMHGH + V L  + D         DF  +   ++PL
Sbjct: 123 LWRRFRFESAHRLPNVPEGHPCGRMHGHGFEVILHADQD-LGGQDMGIDFDRLAALWTPL 181

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            ++L   CLN+I  LENPT+E ++ WIW RL   L  LS V VYET  +   + G
Sbjct: 182 HDELHQVCLNDIPGLENPTSERLSSWIWSRLKPELPALSWVTVYETATAGCHFDG 236



 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 36/113 (31%), Positives = 60/113 (53%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I +   FEAA RL R P+     R+HGHSY + L +   +D   G+  D+ ++++ F P
Sbjct: 240 RIWKEQRFEAALRLERSPEGDARRRLHGHSYLLRLHLTAPLDQVLGWTVDYGDVKRLFKP 299

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVE 114
           L ++LDHH L+ ++ LE     ++  WI +R+   L  L  + +  TP     
Sbjct: 300 LYDRLDHHRLDALDGLEAADPGSLIRWIRERIQDDLPELDRIDLQPTPGCGAS 352



 Score = 67.1 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 56/109 (51%), Gaps = 4/109 (3%)

Query: 9   FEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDH 68
           FEAA R+  +P+ H+C R+HGHS+  ++  E  +        +  +++   +  +E LD+
Sbjct: 13  FEAACRVDILPEGHRCRRLHGHSFLAQVRAELPLGWAGFPGAESDDLQAALACCVEPLDY 72

Query: 69  HCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
             LN I  +  PT EN+A W+  RL   +  ++SV +  T     +  G
Sbjct: 73  RDLNAILPI--PTDENLARWVRDRLD--VPGIASVGIQSTRDQGADLDG 117


>gi|307308044|ref|ZP_07587762.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Sinorhizobium meliloti BL225C]
 gi|307319887|ref|ZP_07599310.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Sinorhizobium meliloti AK83]
 gi|306894427|gb|EFN25190.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Sinorhizobium meliloti AK83]
 gi|306901448|gb|EFN32052.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Sinorhizobium meliloti BL225C]
          Length = 118

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 65/116 (56%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT+ F F A+H+L  +P  H+C R+HGH+Y VE+ + G+   + GFV D+  +     
Sbjct: 2   FRITKEFHFSASHQLKSLPAEHQCARLHGHNYIVEVELSGETLNEHGFVRDYHELAPLKQ 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            + E  DH  LN++   +  TAE +A   ++     L   ++VRV ET  +W EY+
Sbjct: 62  YIDECFDHRHLNDVLGHDRVTAECLAQHFYEWCQARLPETTAVRVSETAKTWAEYR 117


>gi|239939760|ref|ZP_04691697.1| putative 6-pyruvoyl tetrahydropterin synthase [Streptomyces
           roseosporus NRRL 15998]
 gi|239986243|ref|ZP_04706907.1| putative 6-pyruvoyl tetrahydropterin synthase [Streptomyces
           roseosporus NRRL 11379]
          Length = 120

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 49/116 (42%), Positives = 72/116 (62%), Gaps = 2/116 (1%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEG--DVDPKTGFVDDFFNIEQYFS 60
           IT+ F F A+HRL  +P  H+C R+HGH+Y +EL +    D   + GFV D+ ++  +  
Sbjct: 4   ITKEFHFSASHRLEHLPSDHQCARLHGHNYIIELKLSAAPDQLTEPGFVRDYGDLADFKK 63

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            L   LDH  LN+I E  NP+AEN+A+WI+ + +     LS+VRV ET  +W EY+
Sbjct: 64  WLDHTLDHRHLNDIIEDRNPSAENMAMWIYDQWTERYPELSAVRVSETDKTWAEYR 119


>gi|300088542|ref|YP_003759064.1| fused 6-pyruvoyl tetrahydropterin synthase/hypothetical protein
           [Dehalogenimonas lykanthroporepellens BL-DC-9]
 gi|299528275|gb|ADJ26743.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Dehalogenimonas lykanthroporepellens BL-DC-9]
          Length = 121

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 41/119 (34%), Positives = 65/119 (54%), Gaps = 6/119 (5%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I+    F++AH L       KC ++HGH YRV + +       TG   DF  ++    P
Sbjct: 3   RISVESHFDSAHFLRGY--GGKCEQLHGHRYRVMVKVAAAELDDTGLACDFTELKALLKP 60

Query: 62  LLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLS--ILSSVRVYETPMSWVEYQ 116
           +L + DH  LN++   +  NP+AENIA  I++ L+  ++   L SV V+E+P S  EY+
Sbjct: 61  VLARYDHTLLNDVPPFDTINPSAENIARVIFEALAPEITGVQLESVTVWESPESSAEYR 119


>gi|114640356|ref|XP_001147929.1| PREDICTED: 6-pyruvoyl tetrahydrobiopterin synthase [Pan
           troglodytes]
          Length = 145

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 41/132 (31%), Positives = 73/132 (55%), Gaps = 16/132 (12%)

Query: 2   KITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDD 51
           K+++  +F A+HRL          +    KC+    HGH+Y+V + + G++DP TG V +
Sbjct: 13  KVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMN 72

Query: 52  FFNIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVRV 105
             ++++Y    +++ LDH  L+ ++    +   T EN+A++IW  L   L   +L  V+V
Sbjct: 73  LADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKV 132

Query: 106 YETPMSWVEYQG 117
           YET  + V Y+G
Sbjct: 133 YETDNNIVVYKG 144


>gi|332716135|ref|YP_004443601.1| 6-pyruvoyl tetrahydropterin synthase [Agrobacterium sp. H13-3]
 gi|325062820|gb|ADY66510.1| 6-pyruvoyl tetrahydropterin synthase [Agrobacterium sp. H13-3]
          Length = 118

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 66/116 (56%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT+ F F A+H+L  +P  H+C R+HGH+Y VE+ + G+   + GFV D+  +     
Sbjct: 2   FRITKEFHFSASHQLKSLPADHQCARLHGHNYIVEVELSGEELNEHGFVRDYHELAPLKR 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            + +  DH  LN++   +  TAE +A   +    TSL   S+VRV ET  +W EY+
Sbjct: 62  YIDDHFDHRHLNDVLGHDRVTAECLAKHFYDWCKTSLPETSAVRVSETAKTWAEYR 117


>gi|109108666|ref|XP_001108264.1| PREDICTED: 6-pyruvoyl tetrahydrobiopterin synthase [Macaca mulatta]
          Length = 145

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 40/132 (30%), Positives = 72/132 (54%), Gaps = 16/132 (12%)

Query: 2   KITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDD 51
           ++++  +F A+HRL          +    KC     HGH+Y+V + + G++DP TG V +
Sbjct: 13  QVSRRISFSASHRLYSKFLSDEENLKLFGKCSNPNGHGHNYKVVVTVHGEIDPATGMVMN 72

Query: 52  FFNIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVRV 105
             ++++Y    +++ LDH  L+ ++    +   T EN+A++IW  L   L   +L  V+V
Sbjct: 73  LADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKV 132

Query: 106 YETPMSWVEYQG 117
           YET  + V Y+G
Sbjct: 133 YETDNNIVVYKG 144


>gi|260063543|ref|YP_003196623.1| putative 6-pyruvoyl tetrahydropterin synthase [Robiginitalea
           biformata HTCC2501]
 gi|88782987|gb|EAR14161.1| putative 6-pyruvoyl tetrahydropterin synthase [Robiginitalea
           biformata HTCC2501]
          Length = 137

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 48/135 (35%), Positives = 70/135 (51%), Gaps = 18/135 (13%)

Query: 1   MKIT--QAFTFEAAHRLPRVPKT--------HKCHR--MHGHSYRVELVMEGDVDPKTGF 48
           M++T  +   F AAHRL R             KC     HGH+Y + + + G +DP+TGF
Sbjct: 1   MRVTVSRKAHFNAAHRLYRPDWDDARNREVFGKCSNPLYHGHNYELIVSVTGPIDPETGF 60

Query: 49  VDDFFNIEQYFS-PLLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSI--LSS 102
           V D   ++      + + LDH  LN E+ E    NPTAENIA+ IW +L   +       
Sbjct: 61  VVDMAELKVLIRDKVEDALDHKNLNEEVPEFRELNPTAENIAVVIWDKLRPHIPASCDLE 120

Query: 103 VRVYETPMSWVEYQG 117
           + +YETP ++V Y+G
Sbjct: 121 ITLYETPRNFVSYRG 135


>gi|197101844|ref|NP_001124750.1| 6-pyruvoyl tetrahydrobiopterin synthase [Pongo abelii]
 gi|75042575|sp|Q5REZ5|PTPS_PONAB RecName: Full=6-pyruvoyl tetrahydrobiopterin synthase; Short=PTP
           synthase; Short=PTPS
 gi|55725762|emb|CAH89662.1| hypothetical protein [Pongo abelii]
          Length = 145

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 72/132 (54%), Gaps = 16/132 (12%)

Query: 2   KITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDD 51
           ++++  +F A+HRL          +    KC     HGH+Y+V + + G++DP TG V +
Sbjct: 13  QVSRRISFSASHRLYSKFLSDEENLKLFGKCSNPNGHGHNYKVVVTVHGEIDPATGMVMN 72

Query: 52  FFNIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVRV 105
             ++++Y    +++ LDH  L+ ++    +   T EN+A++IW  L   L   +L  V++
Sbjct: 73  LADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKL 132

Query: 106 YETPMSWVEYQG 117
           YET  + V Y+G
Sbjct: 133 YETDNNIVVYKG 144


>gi|56698724|ref|YP_168946.1| 6-pyruvoyl tetrahydropterin synthase, putative [Ruegeria pomeroyi
           DSS-3]
 gi|56680461|gb|AAV97127.1| 6-pyruvoyl tetrahydropterin synthase, putative [Ruegeria pomeroyi
           DSS-3]
          Length = 118

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 40/115 (34%), Positives = 66/115 (57%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +IT+ F F A+H+L  +P  H C R+HGH+Y VE+ +        GFV D+  ++   + 
Sbjct: 3   RITKEFHFSASHQLCHLPDDHPCARLHGHNYIVEVELAAAELDANGFVRDYRELKPLKTW 62

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
           + + LDH  LNE+   +  T+E +A  +++      +  S+VRV ETP +W EY+
Sbjct: 63  IDDALDHRHLNEVFGHDMVTSERLAKEVYEFCKARWAETSAVRVSETPKTWAEYR 117


>gi|227820049|ref|YP_002824020.1| 6-pyruvoyl tetrahydrobiopterin synthase [Sinorhizobium fredii
           NGR234]
 gi|36958585|gb|AAQ87053.1| ExsC protein [Sinorhizobium fredii NGR234]
 gi|227339048|gb|ACP23267.1| 6-pyruvoyl tetrahydrobiopterin synthase [Sinorhizobium fredii
           NGR234]
          Length = 118

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 63/116 (54%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT+ F F A+H+L  +P  H+C R+HGH+Y VE+ +  +   + GFV D+  +     
Sbjct: 2   FRITKEFHFSASHQLTSLPPEHQCARLHGHNYVVEVELSAETLNEHGFVRDYHELAPLKQ 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            + E  DH  LN++   +  TAE +A   +      L   S+VRV ET  +W EY+
Sbjct: 62  YIDESFDHRHLNDVLGHDRVTAECLAQHFYVWCQARLPETSAVRVSETAKTWAEYR 117


>gi|182413384|ref|YP_001818450.1| putative 6-pyruvoyl tetrahydropterin synthase [Opitutus terrae
           PB90-1]
 gi|177840598|gb|ACB74850.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Opitutus terrae PB90-1]
          Length = 161

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 44/131 (33%), Positives = 70/131 (53%), Gaps = 16/131 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F AAHRL    K+          C     HGH+Y +E+ + G+ DP+TG++ D 
Sbjct: 24  ITRQVHFNAAHRLYNPTKSQAWNTNQYGLCTSPNWHGHNYVLEVTVRGEPDPETGYIVDL 83

Query: 53  FNIEQYFSPL-LEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVRVY 106
             +++      +++ DH  LN +++ L N  PT EN+ I  W ++  +L    L  VR+Y
Sbjct: 84  SELKRVLHETVVDRCDHRNLNDDVDFLRNVIPTTENLVIAFWDQIEPALPAGKLHCVRLY 143

Query: 107 ETPMSWVEYQG 117
           ETP ++ EY G
Sbjct: 144 ETPRNFAEYFG 154


>gi|4506331|ref|NP_000308.1| 6-pyruvoyl tetrahydrobiopterin synthase [Homo sapiens]
 gi|417553|sp|Q03393|PTPS_HUMAN RecName: Full=6-pyruvoyl tetrahydrobiopterin synthase; Short=PTP
           synthase; Short=PTPS
 gi|177789|gb|AAA51541.1| 6-pyruvoyltetrahydropterin synthase [Homo sapiens]
 gi|451208|dbj|BAA04224.1| 6-pyruvoyl-tetrahydropterin synthase [Homo sapiens]
 gi|624869|dbj|BAA04959.1| 6-pyruvoyl-tetrahydropterin synthase [Homo sapiens]
 gi|2276404|gb|AAB64229.1| PTS [Homo sapiens]
 gi|3142325|gb|AAC16970.1| 6-pyruvoyl-tetrahydropterin synthase [Homo sapiens]
 gi|7768658|dbj|BAA95486.1| 6-pyruvoyltetrahydropterin synthase [Homo sapiens]
 gi|16307196|gb|AAH09686.1| 6-pyruvoyltetrahydropterin synthase [Homo sapiens]
 gi|117645424|emb|CAL38178.1| hypothetical protein [synthetic construct]
 gi|117646154|emb|CAL38544.1| hypothetical protein [synthetic construct]
 gi|119587599|gb|EAW67195.1| 6-pyruvoyltetrahydropterin synthase [Homo sapiens]
 gi|123980116|gb|ABM81887.1| 6-pyruvoyltetrahydropterin synthase [synthetic construct]
 gi|123994915|gb|ABM85059.1| 6-pyruvoyltetrahydropterin synthase [synthetic construct]
 gi|167887685|gb|ACA06065.1| 6-pyruvoyl tetrahydrobiopterin synthase [Homo sapiens]
          Length = 145

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 40/132 (30%), Positives = 73/132 (55%), Gaps = 16/132 (12%)

Query: 2   KITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDD 51
           ++++  +F A+HRL          +    KC+    HGH+Y+V + + G++DP TG V +
Sbjct: 13  QVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMN 72

Query: 52  FFNIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVRV 105
             ++++Y    +++ LDH  L+ ++    +   T EN+A++IW  L   L   +L  V+V
Sbjct: 73  LADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKV 132

Query: 106 YETPMSWVEYQG 117
           YET  + V Y+G
Sbjct: 133 YETDNNIVVYKG 144


>gi|260463746|ref|ZP_05811944.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Mesorhizobium opportunistum WSM2075]
 gi|319785230|ref|YP_004144706.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|259030600|gb|EEW31878.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Mesorhizobium opportunistum WSM2075]
 gi|317171118|gb|ADV14656.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 118

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 41/116 (35%), Positives = 63/116 (54%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT+ F F A+H+L  +P  H+C R+HGH+Y V + +        GFV D+ ++     
Sbjct: 2   FRITKEFHFSASHQLTSLPPEHQCARLHGHNYIVVVELSAKELNSHGFVRDYHDLAPLKH 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            + E LDH  LN+    E  TAE +A   ++     L   ++VRV ETP +W EY+
Sbjct: 62  YIDESLDHRHLNDALAHEQVTAEYLARHFYEWCKARLPETAAVRVSETPKTWAEYR 117


>gi|150377057|ref|YP_001313653.1| putative 6-pyruvoyl tetrahydropterin synthase [Sinorhizobium
           medicae WSM419]
 gi|150031604|gb|ABR63720.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Sinorhizobium medicae WSM419]
          Length = 118

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 66/116 (56%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT+ F F A+H+L  +P  H+C R+HGH+Y VE+ + G+   + GFV D+  +    +
Sbjct: 2   FRITKEFHFSASHQLKNLPPEHQCARLHGHNYIVEVELSGETLNEHGFVRDYHELAPLKT 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            + E  DH  LN++   +  TAE +A   ++     L   ++VRV ET  +W EY+
Sbjct: 62  YIDEAFDHRHLNDVLGHDRVTAECLARHFYEWCKARLFETTAVRVSETAKTWAEYR 117


>gi|20804217|emb|CAD31243.1| PUTATIVE 6-PYRUVOYL TETRAHYDROPTERIN SYNTHASE PROTEIN
           [Mesorhizobium loti R7A]
          Length = 118

 Score =  120 bits (302), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 64/116 (55%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             IT+ F F A+H+L  +P  H+C R+HGH+Y V + + G    + GFV D+ ++  +  
Sbjct: 2   FHITKEFHFSASHQLTSLPPGHQCARLHGHNYIVVVELSGGELDEHGFVRDYQDLAAFKH 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            +    DH  LN++   ++ TAE +A   +      L   S+VRV ETP +W EY+
Sbjct: 62  YIDGTFDHRHLNDVLGHDHATAEYLARHFYDWCKVRLPETSAVRVSETPKTWAEYR 117


>gi|254839597|pdb|3I2B|A Chain A, The Crystal Structure Of Human 6 Pyruvoyl
           Tetrahydrobiopterin Synthase
 gi|254839598|pdb|3I2B|D Chain D, The Crystal Structure Of Human 6 Pyruvoyl
           Tetrahydrobiopterin Synthase
 gi|254839599|pdb|3I2B|E Chain E, The Crystal Structure Of Human 6 Pyruvoyl
           Tetrahydrobiopterin Synthase
 gi|254839600|pdb|3I2B|B Chain B, The Crystal Structure Of Human 6 Pyruvoyl
           Tetrahydrobiopterin Synthase
 gi|254839601|pdb|3I2B|C Chain C, The Crystal Structure Of Human 6 Pyruvoyl
           Tetrahydrobiopterin Synthase
 gi|254839602|pdb|3I2B|F Chain F, The Crystal Structure Of Human 6 Pyruvoyl
           Tetrahydrobiopterin Synthase
 gi|254839603|pdb|3I2B|G Chain G, The Crystal Structure Of Human 6 Pyruvoyl
           Tetrahydrobiopterin Synthase
 gi|254839604|pdb|3I2B|H Chain H, The Crystal Structure Of Human 6 Pyruvoyl
           Tetrahydrobiopterin Synthase
 gi|254839605|pdb|3I2B|I Chain I, The Crystal Structure Of Human 6 Pyruvoyl
           Tetrahydrobiopterin Synthase
 gi|254839606|pdb|3I2B|J Chain J, The Crystal Structure Of Human 6 Pyruvoyl
           Tetrahydrobiopterin Synthase
 gi|254839607|pdb|3I2B|K Chain K, The Crystal Structure Of Human 6 Pyruvoyl
           Tetrahydrobiopterin Synthase
 gi|254839608|pdb|3I2B|L Chain L, The Crystal Structure Of Human 6 Pyruvoyl
           Tetrahydrobiopterin Synthase
          Length = 141

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 40/132 (30%), Positives = 73/132 (55%), Gaps = 16/132 (12%)

Query: 2   KITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDD 51
           ++++  +F A+HRL          +    KC+    HGH+Y+V + + G++DP TG V +
Sbjct: 9   QVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMN 68

Query: 52  FFNIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVRV 105
             ++++Y    +++ LDH  L+ ++    +   T EN+A++IW  L   L   +L  V+V
Sbjct: 69  LADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKV 128

Query: 106 YETPMSWVEYQG 117
           YET  + V Y+G
Sbjct: 129 YETDNNIVVYKG 140


>gi|254476894|ref|ZP_05090280.1| queuosine biosynthesis protein QueD [Ruegeria sp. R11]
 gi|214031137|gb|EEB71972.1| queuosine biosynthesis protein QueD [Ruegeria sp. R11]
          Length = 117

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 64/116 (55%), Gaps = 1/116 (0%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT+ F F A+H+L  +P  H+C R+HGH+Y V + + G      GFV D+  +    +
Sbjct: 2   FRITKEFHFSASHQLTHLPADHQCARLHGHNYIVVVELAGAELNSDGFVRDYHELAPLKN 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            +    DH  LN++ E    TAEN+A + +    +     ++VRV ETP +W EY+
Sbjct: 62  YIDGSFDHRHLNDVMEGP-STAENMARYFYDWCVSRWPETAAVRVSETPKTWAEYR 116


>gi|254469920|ref|ZP_05083325.1| queuosine biosynthesis protein QueD [Pseudovibrio sp. JE062]
 gi|211961755|gb|EEA96950.1| queuosine biosynthesis protein QueD [Pseudovibrio sp. JE062]
          Length = 118

 Score =  119 bits (300), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 41/115 (35%), Positives = 67/115 (58%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           KIT+ F F A+H+L  +P+ H C R+HGH+Y V + +  +   + GFV DF  ++     
Sbjct: 3   KITKEFHFSASHQLCEMPEGHPCARLHGHNYIVVVELASEFLNEYGFVVDFTELKPLKRF 62

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
           + ++LDH  LNE+   +  T+E +A  I++      +   +VRV ETP +W EY+
Sbjct: 63  IDDELDHRHLNEVFGHDQVTSEFLAKTIYEFCKGHWTETCAVRVSETPKTWAEYR 117


>gi|302871077|ref|YP_003839713.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Caldicellulosiruptor obsidiansis OB47]
 gi|302573936|gb|ADL41727.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Caldicellulosiruptor obsidiansis OB47]
          Length = 142

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 46/122 (37%), Positives = 71/122 (58%), Gaps = 10/122 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M + + F F+AAH L +     KC  +HGH+Y++ + +EG  D +   V DF  +++   
Sbjct: 23  MLLKKIFKFDAAHNLTKY--NGKCENLHGHTYKLVVTVEGKPDNQD-MVIDFVLLKKIVQ 79

Query: 61  -PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
             +++ LDH  +N+I  +ENPTAENIA WIW +LS  +      L  + V+ET  S V Y
Sbjct: 80  NEVIDILDHAYINDI--IENPTAENIAKWIWGKLSKKIEEQGVKLYEIEVWETEDSSVIY 137

Query: 116 QG 117
           +G
Sbjct: 138 RG 139


>gi|300023288|ref|YP_003755899.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525109|gb|ADJ23578.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Hyphomicrobium denitrificans ATCC 51888]
          Length = 140

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 47/118 (39%), Positives = 63/118 (53%), Gaps = 1/118 (0%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I + F FEAAH LP         R+HGHS+R  +V+EG+    TG++  F  +     
Sbjct: 13  MQIYKDFRFEAAHFLPSAAPGTPNARVHGHSFRARVVVEGEPGRDTGYIFHFDELSSALR 72

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYE-TPMSWVEYQG 117
              E LDH  LN+IE L  PT E IA+WIW RLS  +  L  V V+  +      Y+G
Sbjct: 73  ETEEDLDHRMLNDIEGLSAPTLERIAMWIWNRLSNRVPGLVQVEVHRDSCNEGCVYRG 130


>gi|24213032|ref|NP_710513.1| 6-pyruvoyltetrahydropterin synthase [Leptospira interrogans serovar
           Lai str. 56601]
 gi|45656191|ref|YP_000277.1| 6-pyruvoyl tetrahydrobiopterin synthase [Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130]
 gi|24193721|gb|AAN47531.1| 6-pyruvoyltetrahydropterin synthase [Leptospira interrogans serovar
           Lai str. 56601]
 gi|45599425|gb|AAS68914.1| 6-pyruvoyl tetrahydrobiopterin synthase [Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130]
          Length = 128

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 53/118 (44%), Positives = 81/118 (68%), Gaps = 1/118 (0%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           +++T+ F F+AAH LP VP  HKC R+HGHS+R +L ++G +DPKTG++ D+  + +   
Sbjct: 4   IELTKEFRFDAAHLLPNVPDGHKCKRLHGHSFRFKLHLKGTIDPKTGWLIDYAAVSKIVK 63

Query: 61  PLLE-KLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           PL+E  LDH+ LN++  LENPT+EN++IW+W  L   L +L  + + ET  S   Y+G
Sbjct: 64  PLIENHLDHYYLNDVPGLENPTSENLSIWLWNHLKPLLPLLYKITLNETCTSACIYEG 121


>gi|332828304|gb|EGK01016.1| hypothetical protein HMPREF9455_02805 [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 120

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 37/115 (32%), Positives = 63/115 (54%), Gaps = 1/115 (0%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           KI++ F+F A+H L  +P  H C R+HGH+Y + + ++       GF+ D+  ++     
Sbjct: 3   KISKQFSFSASHILEGLPLEHPCSRLHGHNYVITVHLQAKQLNTVGFIKDYRELDSVKQY 62

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
           +   LDH  LN+I    NPTAEN+A +++      +  L ++ V ETP +   Y+
Sbjct: 63  IDNTLDHRHLNDILPF-NPTAENMAKYLYDIFKKDIPELYAIEVSETPKTTAIYE 116


>gi|254467147|ref|ZP_05080558.1| queuosine biosynthesis protein QueD [Rhodobacterales bacterium Y4I]
 gi|206688055|gb|EDZ48537.1| queuosine biosynthesis protein QueD [Rhodobacterales bacterium Y4I]
          Length = 117

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 62/116 (53%), Gaps = 1/116 (0%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT+ F F A+H+L  +P  H+C R+HGH+Y V + +        GFV D+  ++    
Sbjct: 2   FRITKEFHFSASHQLTHLPPDHQCARLHGHNYVVVVELAAKELNSDGFVRDYHELKPLKD 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            +    DH  LN++ +    TAEN+A   +         +++V+V ETP +W EY+
Sbjct: 62  YIDGTFDHRHLNDVLD-GYSTAENMAKHFYDWCHARWPEVAAVKVSETPKTWAEYR 116


>gi|312623240|ref|YP_004024853.1| hypothetical protein Calkro_2196 [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312203707|gb|ADQ47034.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Caldicellulosiruptor kronotskyensis 2002]
          Length = 120

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 46/122 (37%), Positives = 72/122 (59%), Gaps = 10/122 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M + + F F+AAH L +     KC  +HGH+Y++ + +EG  D +   V DF  +++   
Sbjct: 1   MLLKKIFKFDAAHNLTKY--NGKCENLHGHTYKLAVTVEGKPDNQD-MVIDFMLLKKIVQ 57

Query: 61  -PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
             +++ LDH  +N+I  +ENPTAENIA WIW++LS  +      L  + V+ET  S V Y
Sbjct: 58  DEVIDILDHAYINDI--IENPTAENIAKWIWEKLSKKIEEQGVKLYEIEVWETEDSSVIY 115

Query: 116 QG 117
           +G
Sbjct: 116 RG 117


>gi|260892491|ref|YP_003238588.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Ammonifex degensii KC4]
 gi|260864632|gb|ACX51738.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Ammonifex degensii KC4]
          Length = 124

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 46/122 (37%), Positives = 68/122 (55%), Gaps = 10/122 (8%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++T   +F AAHRLP  P    C R+HGH++ V + + G+     G + DF  ++Q    
Sbjct: 3   RLTVKGSFSAAHRLPNHP--SPCSRLHGHNWEVTVTVIGEELGPDGMLLDFTVLKQILQE 60

Query: 62  LLEKLDHHCLNEIEELE---NPTAENIAIWIWKRLSTSLS-----ILSSVRVYETPMSWV 113
           +L KLDH  LNEI        PTAEN+A +I+  ++T L+      L  V+V E+P +WV
Sbjct: 61  VLAKLDHQYLNEIPPFGKELPPTAENLARYIYHEVATRLAPYPAVTLQEVKVGESPSAWV 120

Query: 114 EY 115
            Y
Sbjct: 121 VY 122


>gi|149916376|ref|ZP_01904896.1| hypothetical protein RAZWK3B_12317 [Roseobacter sp. AzwK-3b]
 gi|149809830|gb|EDM69682.1| hypothetical protein RAZWK3B_12317 [Roseobacter sp. AzwK-3b]
          Length = 118

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 39/114 (34%), Positives = 67/114 (58%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           IT+ F F A+H+L  +P+ H+C R+HGH+Y V + +  +     GFV D+ ++ +    +
Sbjct: 4   ITKEFHFSASHQLFGLPEDHQCARLHGHNYIVVVELRAEDLNAHGFVRDYLDLAELKRYI 63

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            +KLDH  LN++   +  TAE +A  ++         +S+V+V ETP +W EY+
Sbjct: 64  DDKLDHRHLNDVLGDDCVTAERMARHLYDWCVGRWPEVSAVKVSETPKTWAEYR 117


>gi|332208228|ref|XP_003253203.1| PREDICTED: 6-pyruvoyl tetrahydrobiopterin synthase-like [Nomascus
           leucogenys]
          Length = 145

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 41/132 (31%), Positives = 72/132 (54%), Gaps = 16/132 (12%)

Query: 2   KITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDD 51
           ++++  +F A+HRL          +    KC     HGH+Y+V + + G++DP TG V +
Sbjct: 13  QVSRCISFSASHRLYSKFLSDEENLKLFGKCSNPNGHGHNYKVVVTVHGEIDPATGMVMN 72

Query: 52  FFNIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVRV 105
             ++++Y    ++E LDH  L+ ++    +   T EN+A++IW  L   L   +L  V+V
Sbjct: 73  LADLKKYMEEAIMEPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKV 132

Query: 106 YETPMSWVEYQG 117
           YET  + V Y+G
Sbjct: 133 YETDNNIVVYKG 144


>gi|17390048|gb|AAH18029.1| 6-pyruvoyltetrahydropterin synthase [Homo sapiens]
 gi|117646878|emb|CAL37554.1| hypothetical protein [synthetic construct]
          Length = 145

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 73/132 (55%), Gaps = 16/132 (12%)

Query: 2   KITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDD 51
           ++++  +F A+HRL          +    KC+    HGH+Y+V + + G++DP TG V +
Sbjct: 13  QVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMN 72

Query: 52  FFNIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVRV 105
             ++++Y    +++ LDH  L+ ++    +   T EN+A+++W  L   L   +L  V+V
Sbjct: 73  LADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYMWDNLQKVLPVGVLYKVKV 132

Query: 106 YETPMSWVEYQG 117
           YET  + V Y+G
Sbjct: 133 YETDNNIVVYKG 144


>gi|83942509|ref|ZP_00954970.1| 6-pyruvoyl tetrahydropterin synthase, putative [Sulfitobacter sp.
           EE-36]
 gi|83846602|gb|EAP84478.1| 6-pyruvoyl tetrahydropterin synthase, putative [Sulfitobacter sp.
           EE-36]
          Length = 117

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 37/114 (32%), Positives = 64/114 (56%), Gaps = 1/114 (0%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           IT+ F F A+H+L  +P  H+C R+HGH+Y V + +        GFV D+  ++   + +
Sbjct: 4   ITKEFHFSASHQLSHLPDGHQCARLHGHNYVVVVELRAKELNADGFVRDYGELKPLKTYI 63

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            E  DH  LN++ +    T EN+A  +++  +      ++V+V ETP +W EY+
Sbjct: 64  DETFDHRHLNDVLDF-VSTGENMARHLYEWCANRWPETTAVKVSETPKTWAEYR 116


>gi|118592128|ref|ZP_01549522.1| hypothetical protein SIAM614_25667 [Stappia aggregata IAM 12614]
 gi|118435424|gb|EAV42071.1| hypothetical protein SIAM614_25667 [Stappia aggregata IAM 12614]
          Length = 127

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 38/116 (32%), Positives = 66/116 (56%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT+ F F A+H++  + + H C R+HGH+Y VE+ +  +    TGFV D+  + ++  
Sbjct: 2   FRITKEFHFSASHQILGLGEDHPCARLHGHNYVVEVELMSEELNGTGFVRDYHELSEFKR 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            + + LDH  LN++   +  TAE +A + +       S  S+VRV ETP +  E++
Sbjct: 62  FIDDTLDHRHLNDVLGDDCVTAETMARFFYNWCRQRWSETSAVRVKETPKTCAEFR 117


>gi|116327180|ref|YP_796900.1| 6-pyruvoyltetrahydropterin synthase [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116332168|ref|YP_801886.1| 6-pyruvoyltetrahydropterin synthase [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
 gi|116119924|gb|ABJ77967.1| 6-pyruvoyltetrahydropterin synthase [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116125857|gb|ABJ77128.1| 6-pyruvoyltetrahydropterin synthase [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
          Length = 128

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 52/118 (44%), Positives = 78/118 (66%), Gaps = 1/118 (0%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           +++T+ F F+AAH LP V   HKC R+HGHS+R +L ++G +D  TG++ D+  + +   
Sbjct: 4   IELTKEFRFDAAHLLPNVSDGHKCKRLHGHSFRFKLHLKGKIDSNTGWLIDYAEVSRIVK 63

Query: 61  P-LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P + + LDH+ LNE+  LENPT+ENIAIW+WK L   L +L  + + ET  S   Y+G
Sbjct: 64  PLIEDHLDHYYLNEVPGLENPTSENIAIWLWKHLKPLLPLLYKITLNETCTSACIYEG 121


>gi|163738316|ref|ZP_02145731.1| hypothetical protein RGBS107_09846 [Phaeobacter gallaeciensis
           BS107]
 gi|161388237|gb|EDQ12591.1| hypothetical protein RGBS107_09846 [Phaeobacter gallaeciensis
           BS107]
          Length = 117

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 63/116 (54%), Gaps = 1/116 (0%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT+ F F A+H+L  +P  H+C R+HGH+Y V + + G      GFV D+  +    +
Sbjct: 2   FRITKEFHFSASHQLSHLPADHQCARLHGHNYIVVVELAGAELNSDGFVRDYHELAPLKN 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            +    DH  LN++ +    TAEN+A   ++         S+VRV ETP +W EY+
Sbjct: 62  YIDGSFDHRHLNDVMDGP-STAENMARHFYEWCVARWPETSAVRVSETPKTWAEYR 116


>gi|296216197|ref|XP_002754462.1| PREDICTED: 6-pyruvoyl tetrahydrobiopterin synthase-like [Callithrix
           jacchus]
          Length = 145

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 71/132 (53%), Gaps = 16/132 (12%)

Query: 2   KITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDD 51
           ++++  +F A+HRL          +    KC     HGH+Y+V + + G +DP TG V +
Sbjct: 13  QVSRGISFSASHRLHSKFLSEEENLKLFGKCSNPNGHGHNYKVVVTVHGQIDPATGMVMN 72

Query: 52  FFNIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVRV 105
             +++++    +++ LDH  L+ ++    +   T EN+A++IW  L   L   +L  V+V
Sbjct: 73  LTDLKKHMEEAIMQPLDHKNLDLDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKV 132

Query: 106 YETPMSWVEYQG 117
           YET  + V Y+G
Sbjct: 133 YETDNNIVVYKG 144


>gi|299132130|ref|ZP_07025325.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Afipia sp. 1NLS2]
 gi|298592267|gb|EFI52467.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Afipia sp. 1NLS2]
          Length = 96

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 58/91 (63%), Positives = 71/91 (78%)

Query: 27  MHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEELENPTAENIA 86
           MHGHSYR+E+V+ G  DP TGFV DFF++E+ F PLL++LDH+CLN++  LENPTAENIA
Sbjct: 1   MHGHSYRIEVVLNGSTDPHTGFVVDFFDVEEAFEPLLKRLDHNCLNDVPGLENPTAENIA 60

Query: 87  IWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           IWIW++    L  L SVRVYETP  W EY G
Sbjct: 61  IWIWEKAKQRLPQLFSVRVYETPDCWAEYDG 91


>gi|78044205|ref|YP_359798.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77996320|gb|ABB15219.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 120

 Score =  117 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 47/120 (39%), Positives = 68/120 (56%), Gaps = 8/120 (6%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            KI+ + TF+AAH L       KC  +HGH++RVE  +EG      G + DF  I+ Y  
Sbjct: 2   FKISVSTTFDAAHFLKDYD--GKCANLHGHTWRVEAEVEGQTTNDLGLLIDFGMIKDYLK 59

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSL-----SILSSVRVYETPMSWVEY 115
            +  +LDH  LN++ ++ NPTAENIA +I+K L   L       L SV+V+E+P +   Y
Sbjct: 60  DITSRLDHKLLNDVLQV-NPTAENIARYIFKELKAKLIVYPEIKLCSVKVWESPNNAATY 118


>gi|116253992|ref|YP_769830.1| 6-pyruvoyl tetrahydropterin synthase protein [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115258640|emb|CAK09744.1| putative 6-pyruvoyl tetrahydropterin synthase protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 119

 Score =  117 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 38/115 (33%), Positives = 60/115 (52%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +IT+ F   A+H+L  +P  H+C R+HGH+Y V + +  +     GFV D+ ++      
Sbjct: 4   RITKEFHLSASHQLDHLPADHQCARLHGHNYVVIVELAAENLNDDGFVRDYHDLSPLKRY 63

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
           + E  DH  LN++      T+E +A   +          SSVRV ETP +W EY+
Sbjct: 64  IDETFDHRHLNDVFGHSKVTSEFLARHFYDWCKQRFPETSSVRVSETPKTWAEYR 118


>gi|323705610|ref|ZP_08117184.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323535087|gb|EGB24864.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 123

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 50/119 (42%), Positives = 76/119 (63%), Gaps = 9/119 (7%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MK+T+ FTF++AH L R     KC  +HGH+Y++E+ +EG +D + G V DF +++    
Sbjct: 1   MKVTKVFTFDSAHNLTRY--NGKCENLHGHTYKLEVTVEGSIDDE-GMVIDFAHLKAIVD 57

Query: 61  -PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVE 114
             +++KLDH  LNE+    N T ENIAIW+W++L   L      L S+R++ETP S+ E
Sbjct: 58  SEVVKKLDHAYLNEVLGF-NTTCENIAIWMWRKLDPLLKDDRFHLFSIRLWETPTSFAE 115


>gi|163742267|ref|ZP_02149655.1| hypothetical protein RG210_03613 [Phaeobacter gallaeciensis 2.10]
 gi|161384597|gb|EDQ08978.1| hypothetical protein RG210_03613 [Phaeobacter gallaeciensis 2.10]
          Length = 117

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 63/116 (54%), Gaps = 1/116 (0%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT+ F F A+H+L  +P  H+C R+HGH+Y V + + G      GFV D+  +    +
Sbjct: 2   FRITKEFHFSASHQLSHLPADHQCARLHGHNYIVVVELAGAELNSDGFVRDYHELAPLKN 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            +    DH  LN++ +    TAEN+A   ++         ++VRV ETP +W EY+
Sbjct: 62  YIDGSFDHRHLNDVMDGP-STAENMARHFYEWCVARWPETAAVRVSETPKTWAEYR 116


>gi|119488919|ref|ZP_01621881.1| hypothetical protein L8106_20218 [Lyngbya sp. PCC 8106]
 gi|119455080|gb|EAW36222.1| hypothetical protein L8106_20218 [Lyngbya sp. PCC 8106]
          Length = 150

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 46/118 (38%), Positives = 70/118 (59%), Gaps = 7/118 (5%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVD----PKTGFVDDFFNIEQY 58
           I + F FEA+H+LP      KC R+HGHS+R  + + G+       K G + D+ +I++Y
Sbjct: 25  IGKEFRFEASHQLPN--HDGKCARLHGHSWRCTIYVSGNRLIYSGAKQGMIMDYDDIKKY 82

Query: 59  FSPLLEKL-DHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEY 115
             P+++   DH+ LN+   L NPT+E IA WI+++L T +  L +VRV ET  S   Y
Sbjct: 83  VKPIMDNYLDHYHLNDTTGLANPTSEAIAQWIYEKLETEIPGLIAVRVDETCTSQCVY 140


>gi|83953729|ref|ZP_00962450.1| 6-pyruvoyl tetrahydropterin synthase, putative [Sulfitobacter sp.
           NAS-14.1]
 gi|83841674|gb|EAP80843.1| 6-pyruvoyl tetrahydropterin synthase, putative [Sulfitobacter sp.
           NAS-14.1]
          Length = 117

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 37/114 (32%), Positives = 64/114 (56%), Gaps = 1/114 (0%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           IT+ F F A+H+L  +P  H+C R+HGH+Y V + +        GFV D+  ++   + +
Sbjct: 4   ITKEFHFSASHQLSHLPDGHQCARLHGHNYVVVVELRAKELNADGFVRDYGELKPLKTYI 63

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            E  DH  LN++ +    T EN+A  +++  +      ++V+V ETP +W EY+
Sbjct: 64  DETFDHRHLNDVLDF-VSTGENMARHLYEWCAQHWPETTAVKVSETPKTWAEYR 116


>gi|146295278|ref|YP_001179049.1| putative 6-pyruvoyl tetrahydropterin synthase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145408854|gb|ABP65858.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 121

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 46/122 (37%), Positives = 69/122 (56%), Gaps = 10/122 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M + + F F+AAH L +     KC R+HGH+Y++ + ++G    +   V DF  ++    
Sbjct: 1   MLLKKIFKFDAAHNLTKY--HGKCERLHGHTYKLVVTVKGK-LDEQDMVIDFALLKDIVQ 57

Query: 61  -PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
             +++ LDH  LN+I  +ENPTAENIA WIW+RL   +      L  V V+ET  S   Y
Sbjct: 58  KEVIDILDHAYLNDI--IENPTAENIAKWIWQRLYDKIKAQNSTLYEVEVWETEDSGAVY 115

Query: 116 QG 117
           +G
Sbjct: 116 RG 117


>gi|126737388|ref|ZP_01753123.1| hypothetical protein RSK20926_13174 [Roseobacter sp. SK209-2-6]
 gi|126721973|gb|EBA18676.1| hypothetical protein RSK20926_13174 [Roseobacter sp. SK209-2-6]
          Length = 121

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 62/116 (53%), Gaps = 1/116 (0%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT+ F F A+H+L  +P  H+C RMHGH+Y V + +        GFV D+  ++    
Sbjct: 2   FRITKEFHFSASHQLTHLPADHQCARMHGHNYIVMIELAARELNTDGFVRDYHELKPLKD 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            +    DH  LN++ E    TAEN+A   +         +++V+V ETP +W EY+
Sbjct: 62  YIDGTFDHRHLNDVLEGP-STAENMAKHFYDWSHARWPEVTAVKVSETPKTWAEYR 116


>gi|85860084|ref|YP_462286.1| queuosine biosynthesis protein [Syntrophus aciditrophicus SB]
 gi|85723175|gb|ABC78118.1| queuosine biosynthesis protein [Syntrophus aciditrophicus SB]
          Length = 159

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 43/122 (35%), Positives = 64/122 (52%), Gaps = 8/122 (6%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +I+    F AAH L   P    C  +HGH++ VE+ +E +   + G   DF  ++Q   
Sbjct: 38  FEISIEEQFSAAHALRNYP--GNCEHLHGHNWAVEVTVECEELNEIGIGIDFREVKQSVR 95

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
             L +LDH  LNE+ +    NP++ENIA  ++  LS  L+     +S VRV ETP S   
Sbjct: 96  EALHRLDHVNLNELPQFCDINPSSENIARHLYNELSRKLNTEKIRVSRVRVSETPTSKAS 155

Query: 115 YQ 116
           Y+
Sbjct: 156 YR 157


>gi|332886258|gb|EGK06502.1| hypothetical protein HMPREF9456_00376 [Dysgonomonas mossii DSM
           22836]
          Length = 120

 Score =  117 bits (294), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 40/115 (34%), Positives = 67/115 (58%), Gaps = 1/115 (0%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           KI++ F+F A+H L  +P+ H C R+HGH+Y + + ++     + GF+ D+  ++     
Sbjct: 3   KISKQFSFSASHILEGLPQEHPCSRLHGHNYVITVHLKSKELNEVGFIKDYRELDSVKKY 62

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
           + EKLDH  LN++    NPTAENIA +++      +  L +V V ETP +   Y+
Sbjct: 63  IDEKLDHRHLNDVMSF-NPTAENIARYLYDTFVADIPELYAVEVSETPKTTAIYE 116


>gi|312134336|ref|YP_004001674.1| hypothetical protein Calow_0273 [Caldicellulosiruptor owensensis
           OL]
 gi|311774387|gb|ADQ03874.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Caldicellulosiruptor owensensis OL]
          Length = 120

 Score =  117 bits (294), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 46/122 (37%), Positives = 71/122 (58%), Gaps = 10/122 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M + + F F+AAH L +     KC  +HGH+Y++ + +EG  D +   V DF  +++   
Sbjct: 1   MLLKKTFKFDAAHNLTKY--NGKCENLHGHTYKLVVTVEGKPDNQD-MVIDFVLLKKIVQ 57

Query: 61  -PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
             +++ LDH  +N+I  +ENPTAENIA WIW +LS  +      L  + V+ET  S V Y
Sbjct: 58  NEVIDILDHAYINDI--IENPTAENIAKWIWGKLSKKIEEQGCRLYEIEVWETEDSSVIY 115

Query: 116 QG 117
           +G
Sbjct: 116 RG 117


>gi|311263914|ref|XP_003129904.1| PREDICTED: 6-pyruvoyl tetrahydrobiopterin synthase-like [Sus
           scrofa]
 gi|311263916|ref|XP_003129905.1| PREDICTED: 6-pyruvoyl tetrahydrobiopterin synthase-like [Sus
           scrofa]
          Length = 146

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 40/132 (30%), Positives = 73/132 (55%), Gaps = 16/132 (12%)

Query: 2   KITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDD 51
           ++++  +F A+HRL          +    KC+    HGH+Y+V + + G++DP TG V +
Sbjct: 14  RVSRLASFSASHRLHSKSLSNEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPVTGMVMN 73

Query: 52  FFNIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI--LSSVRV 105
             ++++Y    +++ LDH  L+ ++    +   T EN+A++IW+ L   L    L  V+V
Sbjct: 74  LTDLKKYMEEAIMKPLDHKNLDLDVPYFADVVSTTENVAVYIWENLQKYLPAGVLYKVKV 133

Query: 106 YETPMSWVEYQG 117
           YET  + V Y+G
Sbjct: 134 YETDNNIVVYKG 145


>gi|222528463|ref|YP_002572345.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Caldicellulosiruptor bescii DSM 6725]
 gi|222455310|gb|ACM59572.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Caldicellulosiruptor bescii DSM 6725]
          Length = 120

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 47/122 (38%), Positives = 73/122 (59%), Gaps = 10/122 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M + + F F+AAH L +     KC  +HGH+Y++ + +EG +D +   V DF  +++   
Sbjct: 1   MLLKKIFKFDAAHNLTKY--NGKCENLHGHTYKLAVTVEGKLDNQD-MVIDFVLLKKIVQ 57

Query: 61  -PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
             +++ LDH  +N+I  +ENPTAENIA WIWK+LS  +      L  + V+ET  S V Y
Sbjct: 58  DEVIDILDHAYINDI--IENPTAENIAKWIWKKLSKKIEEQGVKLYEIEVWETEDSSVIY 115

Query: 116 QG 117
           +G
Sbjct: 116 RG 117


>gi|254489311|ref|ZP_05102515.1| queuosine biosynthesis protein QueD [Roseobacter sp. GAI101]
 gi|214042319|gb|EEB82958.1| queuosine biosynthesis protein QueD [Roseobacter sp. GAI101]
          Length = 117

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 36/115 (31%), Positives = 63/115 (54%), Gaps = 1/115 (0%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +IT+ F F A+H+L  +P  H+C R+HGH+Y V + +        GFV D+  ++   + 
Sbjct: 3   RITKEFHFSASHQLSHLPDGHQCARLHGHNYIVVVELAAADLNADGFVRDYGELKPLKTY 62

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
           + +  DH  LN++ ++   T EN+A   +          ++V+V ETP +W EY+
Sbjct: 63  IDDTFDHRHLNDVMDVA-STGENMARHFYDWCVALWPETTAVKVSETPKTWAEYR 116


>gi|312128425|ref|YP_003993299.1| hypothetical protein Calhy_2225 [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311778444|gb|ADQ07930.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Caldicellulosiruptor hydrothermalis 108]
          Length = 120

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 47/122 (38%), Positives = 72/122 (59%), Gaps = 10/122 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M + + F F+AAH L +     KC  +HGH+Y++ + +EG  D +   V DF  +++   
Sbjct: 1   MLLKKIFKFDAAHNLTKY--NGKCENLHGHTYKLVVTVEGKPDNQD-MVIDFVLLKKIVQ 57

Query: 61  -PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
             +++ LDH  +N+I  +ENPTAENIA WIWK+LS  +      L  + V+ET  S V Y
Sbjct: 58  DEVIDVLDHAYINDI--IENPTAENIAKWIWKKLSRKIEEQGCRLYEIEVWETEDSSVIY 115

Query: 116 QG 117
           +G
Sbjct: 116 RG 117


>gi|126327022|ref|XP_001381302.1| PREDICTED: similar to 6-pyruvoyl tetrahydrobiopterin synthase
           precursor (PTPS) (PTP synthase) [Monodelphis domestica]
          Length = 218

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 37/132 (28%), Positives = 70/132 (53%), Gaps = 16/132 (12%)

Query: 2   KITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDD 51
           ++++  +F A+HRL          +    KC+    HGH+Y+V + + G++ P TG V +
Sbjct: 80  RVSRCVSFSASHRLHSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIHPVTGMVVN 139

Query: 52  FFNIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVRV 105
              ++      +++ LDH  L+ ++    +   T EN+A++IW+ L   L   +L  V+V
Sbjct: 140 LTELKDIMEEAIMKPLDHKNLDQDVPYFADVVSTTENVAVYIWENLQKILPVGVLYKVKV 199

Query: 106 YETPMSWVEYQG 117
           +ET  + V Y+G
Sbjct: 200 HETDKNIVVYKG 211


>gi|195051665|ref|XP_001993145.1| GH13241 [Drosophila grimshawi]
 gi|193900204|gb|EDV99070.1| GH13241 [Drosophila grimshawi]
          Length = 168

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 43/132 (32%), Positives = 70/132 (53%), Gaps = 17/132 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T+  TF A HRL          +    KC+ +HGH  +Y VEL + G +D +TG V + 
Sbjct: 9   LTRRETFSACHRLHSPQLSDAENLEVFGKCNNLHGHGHNYTVELTVRGPIDQRTGMVLNI 68

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSI---LSSVRV 105
             ++      ++++LDH  L+ ++E       T EN+A++IW  + T L     L  VR+
Sbjct: 69  TELKDAIETVIMKRLDHKNLDKDVEYFAKIPSTTENLAVYIWDNIRTHLKKPELLYEVRI 128

Query: 106 YETPMSWVEYQG 117
           +ETP + V Y+G
Sbjct: 129 FETPKNIVTYRG 140


>gi|222149728|ref|YP_002550685.1| 6-pyruvoyl tetrahydropterin synthase [Agrobacterium vitis S4]
 gi|221736710|gb|ACM37673.1| 6-pyruvoyl tetrahydropterin synthase [Agrobacterium vitis S4]
          Length = 118

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 38/115 (33%), Positives = 65/115 (56%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +IT+ F F A+H+L  +P  H+C R+HGH+Y V + + G+   + GF+ D+  ++   + 
Sbjct: 3   RITKEFHFSASHQLKGLPDDHQCARLHGHNYIVLVELSGEELNEYGFLRDYHELKVLKAY 62

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
           + E  DH  LN++   +  TAE +A   +       +  S+VRV ET  +W EY+
Sbjct: 63  IDEAFDHRHLNDVLGHDKTTAECLAKHFYDWCKQHFAETSAVRVSETQKTWAEYR 117


>gi|222099627|ref|YP_002534195.1| Queuosine biosynthesis protein QueD [Thermotoga neapolitana DSM
           4359]
 gi|221572017|gb|ACM22829.1| Queuosine biosynthesis protein QueD [Thermotoga neapolitana DSM
           4359]
          Length = 131

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 48/122 (39%), Positives = 70/122 (57%), Gaps = 10/122 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M + + F+FEAAH L  V    KC R+HGH+YR+ + +EG    +   V DF  +++   
Sbjct: 12  MVLVKKFSFEAAHNL--VKYHGKCERLHGHTYRLTVKVEGP-LNEEDMVMDFAELKKMVE 68

Query: 61  PL-LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
              ++KLDH  LNE+   E PT E +AIWIW++LS  L      L  + ++ET  S V Y
Sbjct: 69  DRVIKKLDHSYLNEL--FEQPTTERVAIWIWEQLSGPLRECGVRLVEIELWETETSGVVY 126

Query: 116 QG 117
           +G
Sbjct: 127 RG 128


>gi|209551070|ref|YP_002282987.1| queuosine biosynthesis protein QueD [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536826|gb|ACI56761.1| queuosine biosynthesis protein QueD [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 118

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 38/115 (33%), Positives = 61/115 (53%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +IT+ F   A+H+L  +P  H+C R+HGH+Y V + +  +     GFV D+ ++      
Sbjct: 3   RITKEFHLSASHQLDHLPADHQCARLHGHNYIVVVELSAESLNDDGFVRDYHDLSPLKRY 62

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
           + E LDH  LN++      T+E +A   +          SSVR+ ETP +W EY+
Sbjct: 63  IDEALDHRHLNDVFGHSKVTSEFLAKHFYDWCKERFPETSSVRISETPKTWAEYR 117


>gi|254512574|ref|ZP_05124640.1| queuosine biosynthesis protein QueD [Rhodobacteraceae bacterium
           KLH11]
 gi|221532573|gb|EEE35568.1| queuosine biosynthesis protein QueD [Rhodobacteraceae bacterium
           KLH11]
          Length = 117

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 38/115 (33%), Positives = 63/115 (54%), Gaps = 1/115 (0%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +IT+ F F A+H+L  +P  H+C R+HGH+Y V + +        GFV D+  ++   S 
Sbjct: 3   RITKEFHFSASHQLSHLPDDHQCARLHGHNYIVVVELAAADLNSDGFVRDYHELKPLKSY 62

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
           + +  DH  LN++      TAEN+A   +   +      ++V+V ETP +W EY+
Sbjct: 63  IDDTFDHRHLNDVL-NCVSTAENMARHFYDWCAARWPETAAVKVSETPKTWAEYR 116


>gi|190893558|ref|YP_001980100.1| 6-pyruvoyl tetrahydropterin synthase [Rhizobium etli CIAT 652]
 gi|190698837|gb|ACE92922.1| 6-pyruvoyl tetrahydropterin synthase protein [Rhizobium etli CIAT
           652]
          Length = 118

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 40/115 (34%), Positives = 61/115 (53%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +IT+ F   A+H+L  +P  H+C R+HGH+Y V + +  +     GFV D+ ++      
Sbjct: 3   RITKEFHLSASHQLHHLPADHQCARLHGHNYIVVVELSAESLNDDGFVRDYHDLSPLKRY 62

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
           + E LDH  LNE+      T+E +A   +          SSVRV ETP +W EY+
Sbjct: 63  IDEALDHRHLNEVFGHSKVTSEFLAKHFYDWCRERFPETSSVRVSETPKTWAEYR 117


>gi|241206475|ref|YP_002977571.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240860365|gb|ACS58032.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 118

 Score =  116 bits (292), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 38/115 (33%), Positives = 60/115 (52%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +IT+ F   A+H+L  +P  H+C R+HGH+Y V + +  +     GFV D+ ++      
Sbjct: 3   RITKEFHLSASHQLDHLPADHQCARLHGHNYVVVVELAAESLNDDGFVRDYHDLSPLKRY 62

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
           + E  DH  LN++      T+E +A   +          SSVRV ETP +W EY+
Sbjct: 63  IDETFDHRHLNDVFGHSKVTSEFLARHFYDWCKQHFPETSSVRVSETPKTWAEYR 117


>gi|327189840|gb|EGE56978.1| queuosine biosynthesis protein QueD [Rhizobium etli CNPAF512]
          Length = 118

 Score =  116 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 40/115 (34%), Positives = 61/115 (53%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +IT+ F   A+H+L  +P  H+C R+HGH+Y V + +  +     GFV D+ ++      
Sbjct: 3   RITKEFHLSASHQLDHLPADHQCARLHGHNYIVVVELSAETLNDDGFVRDYHDLSPLKRY 62

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
           + E LDH  LNE+      T+E +A   +          SSVRV ETP +W EY+
Sbjct: 63  IDEALDHRHLNEVFGHSKVTSEFLAKHFYDWCRERFPETSSVRVSETPKTWAEYR 117


>gi|301771424|ref|XP_002921142.1| PREDICTED: 6-pyruvoyl tetrahydrobiopterin synthase-like [Ailuropoda
           melanoleuca]
          Length = 147

 Score =  116 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 40/132 (30%), Positives = 73/132 (55%), Gaps = 16/132 (12%)

Query: 2   KITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDD 51
           ++++  +F A HRL          +    KC+    HGH+Y+V + + G++DP TG V +
Sbjct: 15  RVSRLVSFSATHRLHSKSLSNEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPVTGMVMN 74

Query: 52  FFNIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI--LSSVRV 105
             ++++Y    +++ LDH  L+ ++    +   T EN+A++IW+ L   L +  L  V+V
Sbjct: 75  LTDLKEYMEEAIMKPLDHKNLDLDVPYFADVVSTTENVAVYIWENLQKFLPLGVLYKVKV 134

Query: 106 YETPMSWVEYQG 117
           YET  + V Y+G
Sbjct: 135 YETDNNIVVYKG 146


>gi|165377310|ref|NP_001107009.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bos taurus]
 gi|296480253|gb|DAA22368.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bos taurus]
          Length = 145

 Score =  116 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 41/132 (31%), Positives = 73/132 (55%), Gaps = 16/132 (12%)

Query: 2   KITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDD 51
           ++++  +F A HRL          +    KC+    HGH+Y+V + + G+VDP TG V +
Sbjct: 13  RVSRLVSFSATHRLHSKSLSNEENLKLFGKCNNPNGHGHNYKVVVTVHGEVDPVTGMVMN 72

Query: 52  FFNIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVRV 105
             ++++Y    +++ LDH  L+ ++    +   T EN+A++IW+ L   L   +L  V+V
Sbjct: 73  LTDLKKYMEEAIMKPLDHKNLDLDVPYFADIVSTTENVAVYIWENLQKFLPVGVLYKVKV 132

Query: 106 YETPMSWVEYQG 117
           YET  + V Y+G
Sbjct: 133 YETDNNIVVYKG 144


>gi|86136124|ref|ZP_01054703.1| hypothetical 6-pyruvoyl tetrahydrobiopterin synthase [Roseobacter
           sp. MED193]
 gi|85826998|gb|EAQ47194.1| hypothetical 6-pyruvoyl tetrahydrobiopterin synthase [Roseobacter
           sp. MED193]
          Length = 117

 Score =  116 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 65/116 (56%), Gaps = 1/116 (0%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +I + F F A+H+L  +PK H+C R+HGH+Y V + +        GFV D+ +++   S
Sbjct: 2   FRIRKEFHFSASHQLSHLPKDHQCARLHGHNYIVVVELAAKQLNADGFVRDYHDLKSLKS 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            + + LDH  LN++ +    TAEN+A   +   +      ++V V ETP +W EY+
Sbjct: 62  YIDDHLDHRHLNDVMDGP-STAENMARHFYDWCAARWPETTAVLVSETPKTWAEYR 116


>gi|86359302|ref|YP_471194.1| 6-pyruvoyl tetrahydropterin synthase protein [Rhizobium etli CFN
           42]
 gi|86283404|gb|ABC92467.1| 6-pyruvoyl tetrahydropterin synthase protein [Rhizobium etli CFN
           42]
          Length = 119

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 40/115 (34%), Positives = 61/115 (53%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +IT+ F   A+H+L  +P  H+C R+HGH+Y V + +  +     GFV D+ ++      
Sbjct: 4   RITKEFHLSASHQLDHLPADHQCARLHGHNYVVVVELSAENLNDDGFVRDYHDLAPLKRY 63

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
           + E LDH  LNE+      T+E +A   +          SSVRV ETP +W EY+
Sbjct: 64  IDESLDHRHLNEVFGHSKVTSEFLAKHFYDWCRERFPETSSVRVSETPKTWAEYR 118


>gi|99081886|ref|YP_614040.1| putative 6-pyruvoyl tetrahydropterin synthase [Ruegeria sp. TM1040]
 gi|99038166|gb|ABF64778.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Ruegeria sp. TM1040]
          Length = 117

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 65/116 (56%), Gaps = 1/116 (0%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +I + F F A+H+L  +P  H+C R+HGH+Y V + +  +     GFV D+ +++   +
Sbjct: 2   FRIRKEFHFSASHQLSHLPLDHQCARLHGHNYIVVVELAAESLNADGFVRDYHDLKPLKT 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            + +  DH  LN++ +    TAEN+A   ++  +      S+V V ETP +W EY+
Sbjct: 62  YIDDHFDHRHLNDVMD-SPSTAENMARHFYEWCAARWPETSAVLVSETPKTWAEYR 116


>gi|163746923|ref|ZP_02154280.1| hypothetical protein OIHEL45_16009 [Oceanibulbus indolifex HEL-45]
 gi|161380037|gb|EDQ04449.1| hypothetical protein OIHEL45_16009 [Oceanibulbus indolifex HEL-45]
          Length = 117

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 38/116 (32%), Positives = 65/116 (56%), Gaps = 1/116 (0%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +I + F F A+H+L  +P  H+C R+HGH+Y V + +  +     GFV D+ +++   +
Sbjct: 2   FRIRKEFHFSASHQLTHLPDDHQCARLHGHNYIVVVELAAEALNADGFVRDYHDLKALKT 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            + +  DH  LN++ +    TAEN+A   +   +   S  S+V V ETP +W EY+
Sbjct: 62  YIDDHFDHRHLNDVMDGP-STAENMAKHFYDWCAARWSETSAVLVSETPKTWAEYR 116


>gi|282896040|ref|ZP_06304069.1| Dihydropteroate synthase [Raphidiopsis brookii D9]
 gi|281199067|gb|EFA73939.1| Dihydropteroate synthase [Raphidiopsis brookii D9]
          Length = 450

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 49/118 (41%), Positives = 67/118 (56%), Gaps = 7/118 (5%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDP----KTGFVDDFFNIEQY 58
           I + F FEAAH+LP      KC R+H HS+R  + + GD       K G + D+ +I +Y
Sbjct: 323 IGKEFRFEAAHQLPN--HDGKCARLHDHSWRGVVYVAGDKLINSGVKQGMIMDYGDISKY 380

Query: 59  FSPLLEKL-DHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEY 115
             PLLE   DH+ LNE   L NPT+E IA WI+++L   +  L +VR+ ET  S   Y
Sbjct: 381 IKPLLENYLDHYHLNESTGLANPTSEAIAKWIYEQLEPQIPGLVAVRIDETCTSQCIY 438


>gi|118102045|ref|XP_417928.2| PREDICTED: similar to 6-pyruvoyl tetrahydrobiopterin synthase
           precursor (PTPS) (PTP synthase) [Gallus gallus]
          Length = 148

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 40/132 (30%), Positives = 71/132 (53%), Gaps = 16/132 (12%)

Query: 2   KITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDD 51
           ++++  +F A HRL          +    KC+    HGH+Y+V + + G++DP +G V +
Sbjct: 10  RLSRTASFSACHRLHSKSLSDEENLKLFGKCNNPNGHGHNYKVIVTVRGEIDPVSGMVIN 69

Query: 52  FFNIEQYFSP-LLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSI--LSSVRV 105
             ++++Y    ++E LDH  L+ ++        T EN+A++IW+ L   L    L  V+V
Sbjct: 70  LTDLKEYMQQAIMEPLDHKNLDKDVPYFAEVVSTTENVAVFIWENLKRLLPAGMLYKVKV 129

Query: 106 YETPMSWVEYQG 117
           YET  + V Y+G
Sbjct: 130 YETDQNIVVYKG 141


>gi|260430478|ref|ZP_05784451.1| queuosine biosynthesis protein QueD [Citreicella sp. SE45]
 gi|260418507|gb|EEX11764.1| queuosine biosynthesis protein QueD [Citreicella sp. SE45]
          Length = 117

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 38/116 (32%), Positives = 63/116 (54%), Gaps = 1/116 (0%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +I + F F A+HRL  +P  H+C R+HGH+Y V + +  +     GFV D+ ++    +
Sbjct: 2   FRIRKEFHFSASHRLEHLPPDHQCARLHGHNYVVVVELAAETLNADGFVRDYHDLADLKT 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            +  + DH  LN++ E+   TAE++A   +          S+V V ETP +W EY+
Sbjct: 62  YIDGQFDHRHLNDVLEVP-STAEHMARHFFDWCRARWPETSAVLVSETPKTWAEYR 116


>gi|301616494|ref|XP_002937697.1| PREDICTED: 6-pyruvoyl tetrahydrobiopterin synthase-like [Xenopus
           (Silurana) tropicalis]
          Length = 170

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 39/133 (29%), Positives = 68/133 (51%), Gaps = 16/133 (12%)

Query: 1   MKITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVD 50
           ++I++  +F A+HRL               KC+    HGH+Y+V + + G +DP TG V 
Sbjct: 37  IQISRGLSFSASHRLHSNSLSEEENKRIFGKCNNPNGHGHNYKVIITVRGKIDPTTGMVI 96

Query: 51  DFFNIEQYFSPLLE-KLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVR 104
           +  ++++Y    +   LDH  ++ ++    N   T ENI ++IW+ L   L   +L  V 
Sbjct: 97  NLTDLKKYMEECITVPLDHKNVDKDVPYFRNVVSTVENITVFIWEELQKRLPAGLLYEVC 156

Query: 105 VYETPMSWVEYQG 117
           V+ET  +   Y+G
Sbjct: 157 VHETDSNSAVYRG 169


>gi|319953914|ref|YP_004165181.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Cellulophaga algicola DSM 14237]
 gi|319422574|gb|ADV49683.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Cellulophaga algicola DSM 14237]
          Length = 138

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 44/132 (33%), Positives = 68/132 (51%), Gaps = 16/132 (12%)

Query: 2   KITQAFTFEAAHRLPRVPK--------THKCHRM--HGHSYRVELVMEGDVDPKTGFVDD 51
           K+++   F AAHRL                C+    HGH+Y + + + G +DP+TGFV D
Sbjct: 4   KVSRKAHFNAAHRLYNPDWSFEKNDTIFGLCNNPNFHGHNYELIVSVTGKIDPETGFVID 63

Query: 52  FFNIEQYFS-PLLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSL--SILSSVRV 105
              ++      + +  DH  LN E+ E +  NPTAENIA+ I+ +L   +       V +
Sbjct: 64  VKILKDLIKSEIEDAFDHKNLNVEVPEFKNLNPTAENIAVVIYDKLRPHITSDKDLEVVL 123

Query: 106 YETPMSWVEYQG 117
           YETP ++V Y+G
Sbjct: 124 YETPRNFVTYRG 135


>gi|24638149|sp|Q90W95|PTPS_POERE RecName: Full=6-pyruvoyl tetrahydrobiopterin synthase; Short=PTP
           synthase; Short=PTPS
 gi|14905690|gb|AAK59697.1| 6-pyruvoyl tetrahydropterin synthase [Poecilia reticulata]
          Length = 147

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 38/131 (29%), Positives = 69/131 (52%), Gaps = 16/131 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+  +F A HRL               KC+    HGH+Y+VE+ + G +DP TG V + 
Sbjct: 16  ITRVQSFSACHRLHSLRLSDEENKEVYGKCNNPYGHGHNYKVEVTVRGKIDPVTGMVMNL 75

Query: 53  FNIEQYFSPLLE-KLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVRVY 106
            ++++    ++   LDH  L+ ++    +   T EN+A++IW  ++ +L   +   +R++
Sbjct: 76  TDLKKCIEEVIMIPLDHKNLDKDVPYFADVVSTTENLAVYIWDNMAKALPASLPYEIRIH 135

Query: 107 ETPMSWVEYQG 117
           ET  + V Y+G
Sbjct: 136 ETDKNIVVYRG 146


>gi|260881139|ref|ZP_05403716.2| queuosine biosynthesis protein QueD [Mitsuokella multacida DSM
           20544]
 gi|260849625|gb|EEX69632.1| queuosine biosynthesis protein QueD [Mitsuokella multacida DSM
           20544]
          Length = 136

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 47/115 (40%), Positives = 66/115 (57%), Gaps = 10/115 (8%)

Query: 9   FEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDH 68
           FEAAHR+   P   KC R+HGH+++VE V+ G    + G + DF  I+     +L++ DH
Sbjct: 21  FEAAHRVVNYP--GKCDRLHGHNWKVEAVVRGTELDELGMLVDFKAIKNALKGVLDRFDH 78

Query: 69  HCLNEIEELE---NPTAENIAIWIWKRLST-----SLSILSSVRVYETPMSWVEY 115
             LNE+E      NPTAEN+A  I++ L+        S L ++ VYETP S V Y
Sbjct: 79  RFLNELEPFAAGINPTAENLARIIFEELAGNDAFVRDSELFAITVYETPTSSVTY 133


>gi|149203607|ref|ZP_01880576.1| hypothetical protein RTM1035_06063 [Roseovarius sp. TM1035]
 gi|149142724|gb|EDM30766.1| hypothetical protein RTM1035_06063 [Roseovarius sp. TM1035]
          Length = 118

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 38/115 (33%), Positives = 66/115 (57%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +IT+ F F A+H+L  +P+TH+C R+HGH+Y V + +        GFV D+ ++      
Sbjct: 3   RITKEFHFSASHQLFGLPETHQCARLHGHNYIVVVELTAAELNAHGFVRDYLDLGDLKRY 62

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
           + + LDH  LN++   +  TAE +A  ++         +++V+V ETP +W EY+
Sbjct: 63  IDDTLDHRHLNDVLGDDCVTAERMAKHLFDWCRARWHEVTAVKVSETPKTWAEYR 117


>gi|119492167|ref|ZP_01623577.1| hypothetical protein L8106_20268 [Lyngbya sp. PCC 8106]
 gi|119453224|gb|EAW34390.1| hypothetical protein L8106_20268 [Lyngbya sp. PCC 8106]
          Length = 148

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 47/118 (39%), Positives = 69/118 (58%), Gaps = 7/118 (5%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVD----PKTGFVDDFFNIEQY 58
           I + F FEA+H+LP      KC R+HGHS+R  + + G+       K G + D+ +I++Y
Sbjct: 23  IGKEFRFEASHQLPN--HDGKCARLHGHSWRGVIYVSGNKLIDAGAKQGMIMDYEDIKKY 80

Query: 59  FSPL-LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEY 115
             PL  + LDH+ LNE   L NPT+E IA WI+++L   +  L +VR+ ET  S   Y
Sbjct: 81  LKPLLDDYLDHYHLNETTGLNNPTSEAIAKWIYEQLEDKIPGLVAVRIDETCTSQCVY 138


>gi|259418859|ref|ZP_05742776.1| queuosine biosynthesis protein QueD [Silicibacter sp. TrichCH4B]
 gi|259345081|gb|EEW56935.1| queuosine biosynthesis protein QueD [Silicibacter sp. TrichCH4B]
          Length = 117

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 62/116 (53%), Gaps = 1/116 (0%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +I + F F A+H+L  +P  H+C R+HGH+Y V + +  +     GFV D+ +++   +
Sbjct: 2   FRIRKEFHFSASHQLSHLPDDHQCARLHGHNYIVVVELAAETLNPEGFVRDYHDLKPLKT 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            + +  DH  LN++ E    TAEN+A       +       +V V ETP +W EY+
Sbjct: 62  YIDDTFDHRHLNDVLEGP-STAENMAKHFHDWCAARWPETRAVLVSETPKTWAEYR 116


>gi|85707173|ref|ZP_01038260.1| hypothetical 6-pyruvoyl tetrahydrobiopterin synthase [Roseovarius
           sp. 217]
 gi|85668332|gb|EAQ23206.1| hypothetical 6-pyruvoyl tetrahydrobiopterin synthase [Roseovarius
           sp. 217]
          Length = 118

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 37/115 (32%), Positives = 64/115 (55%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +IT+ F F A+H+L  +P+TH+C R+HGH+Y V + +        GFV D+ ++      
Sbjct: 3   RITKEFHFSASHQLFGLPETHQCARLHGHNYIVVVELTAAELNAHGFVRDYLDLGDLKRY 62

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
           + + LDH  LN++      TAE +A   +         +++V+V ETP +W E++
Sbjct: 63  IDDALDHRHLNDVLGDGCVTAERMAKHFYDWCHARWPEVTAVKVSETPKTWAEFR 117


>gi|126658985|ref|ZP_01730127.1| hypothetical protein CY0110_26822 [Cyanothece sp. CCY0110]
 gi|126619783|gb|EAZ90510.1| hypothetical protein CY0110_26822 [Cyanothece sp. CCY0110]
          Length = 130

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 52/120 (43%), Positives = 68/120 (56%), Gaps = 8/120 (6%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKT----GFVDDFFNIEQY 58
           I + F FEAAHRLP      KC R+HGHS+   + +  D   +T    G V DF  I  Y
Sbjct: 10  IYKEFRFEAAHRLPY--HQGKCSRLHGHSWVGRVYVSCDRLQETGSQQGMVMDFGEISDY 67

Query: 59  FSPLLEK-LDHHCLNEIEELENPTAENIAIWIWKRL-STSLSILSSVRVYETPMSWVEYQ 116
             PL+E  LDH+ LNE   LE+PT+E IA WI+++L S  L  L  V + ET  S  +Y+
Sbjct: 68  VDPLVENFLDHYYLNETTGLESPTSEAIAQWIFEKLESAQLPGLCMVEIRETCTSGAQYR 127


>gi|157364490|ref|YP_001471257.1| putative 6-pyruvoyl tetrahydropterin synthase [Thermotoga lettingae
           TMO]
 gi|157315094|gb|ABV34193.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermotoga lettingae TMO]
          Length = 118

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 50/122 (40%), Positives = 75/122 (61%), Gaps = 10/122 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M +++ FTF+AAHRL +     KC  +HGH+Y++ + +EGD D + G V DF  +++  +
Sbjct: 1   MYLSRDFTFDAAHRLEKY--HGKCEELHGHTYKLRVTVEGDPDEE-GMVVDFLYLKKTVN 57

Query: 61  P-LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEY 115
             ++  LDH  LNEI  +  PTAENIA W+W +L   LS     L  V V+E+  S+V Y
Sbjct: 58  ELVISVLDHRYLNEI--ISQPTAENIAKWVWDKLKNPLSTQRYRLYEVSVWESENSFVSY 115

Query: 116 QG 117
           +G
Sbjct: 116 RG 117


>gi|197129760|gb|ACH46258.1| putative 6-pyruvoyltetrahydropterin synthase [Taeniopygia guttata]
          Length = 147

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 40/132 (30%), Positives = 67/132 (50%), Gaps = 16/132 (12%)

Query: 2   KITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDD 51
           +++++ TF A HRL          +    KC+    HGH+Y+V + + G++DP +G V +
Sbjct: 10  RLSRSVTFSACHRLHSKSLSDEENLKLFGKCNNPNGHGHNYKVVVTVRGEIDPVSGMVMN 69

Query: 52  FFNIEQYFSP-LLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSI--LSSVRV 105
              +++     ++E LDH  L+ ++        T ENIA++IW  L   L    L  V V
Sbjct: 70  LTELKELMQEAIMEPLDHKNLDKDVPYFSEVVSTTENIAVFIWDSLQKLLPQGILYKVEV 129

Query: 106 YETPMSWVEYQG 117
            ET  + V Y+G
Sbjct: 130 QETEQNVVVYKG 141


>gi|86740460|ref|YP_480860.1| putative 6-pyruvoyl tetrahydropterin synthase [Frankia sp. CcI3]
 gi|86567322|gb|ABD11131.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Frankia sp. CcI3]
          Length = 144

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 42/118 (35%), Positives = 65/118 (55%), Gaps = 2/118 (1%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDV--DPKTGFVDDFFNIEQY 58
             I + F F A+H L  +P  H C RMHGH+Y V L ++       + GFV D+ ++ ++
Sbjct: 23  FAIRKEFGFSASHVLDHLPADHPCSRMHGHNYTVVLELKAQESGLNEAGFVRDYRDLGEF 82

Query: 59  FSPLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            +   + LDH  LN++    NP+AE +A WI+      L  L +V V ETP +W E++
Sbjct: 83  KAWTDDTLDHRHLNDVIIDLNPSAEQLARWIFTTWREKLPELVAVSVSETPKTWAEFR 140


>gi|323701740|ref|ZP_08113411.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfotomaculum nigrificans DSM 574]
 gi|323533276|gb|EGB23144.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfotomaculum nigrificans DSM 574]
          Length = 127

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 70/125 (56%), Gaps = 12/125 (9%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++T    F AAH L   P    C R+HGH++ V++ ++G+     G + DF  I++  + 
Sbjct: 3   QLTVNSKFSAAHSLCGYPGD--CARLHGHTWNVQVKVKGNNLDHLGMLVDFKAIKKLLAE 60

Query: 62  LLEKLDHHCLNEIEEL----ENPTAENIAIWIWKRLSTSLS------ILSSVRVYETPMS 111
           ++++LDH  LNEI        NPTAEN+A +I+K+L   ++       L  + V+E+P +
Sbjct: 61  VVDQLDHSFLNEIPGFGQDGMNPTAENLAYYIYKKLKNPIAGIREGVTLQEISVWESPDA 120

Query: 112 WVEYQ 116
           +  Y+
Sbjct: 121 YATYR 125


>gi|327402938|ref|YP_004343776.1| hypothetical protein Fluta_0937 [Fluviicola taffensis DSM 16823]
 gi|327318446|gb|AEA42938.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Fluviicola taffensis DSM 16823]
          Length = 134

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 48/133 (36%), Positives = 71/133 (53%), Gaps = 16/133 (12%)

Query: 1   MKITQAFTFEAAHRLPRVPKT--------HKCHRM--HGHSYRVELVMEGDVDPKTGFVD 50
           MKI +   F AAHRL               KC+    HGH+Y++E+ ++G ++P+TG+V 
Sbjct: 1   MKIFRVEQFNAAHRLFNPNWDDETNNRIFGKCNNPNFHGHNYKLEVELDGPINPETGYVM 60

Query: 51  DFFNIEQYFS-PLLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSIL--SSVR 104
           D   + +     +LE+ DH  LN +  E +N  P+AENIA+  W  L   L       VR
Sbjct: 61  DMKKLSEIIKLEILERFDHRNLNLDCPEFKNLIPSAENIALVCWNILRQHLPSELKLKVR 120

Query: 105 VYETPMSWVEYQG 117
           ++ETP + VEY G
Sbjct: 121 LWETPKNGVEYDG 133


>gi|312794373|ref|YP_004027296.1| hypothetical protein Calkr_2221 [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312181513|gb|ADQ41683.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 120

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 46/122 (37%), Positives = 70/122 (57%), Gaps = 10/122 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M + + F F+AAH L +     KC  +HGH+Y++ + +EG  D +   V DF  +++   
Sbjct: 1   MLLKKIFKFDAAHNLTKY--NGKCENLHGHTYKLVVTVEGKPDDQD-MVIDFVLLKKIVH 57

Query: 61  -PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
             ++  LDH  +N+I  +ENPTAENIA WIW +LS  +      L  + V+ET  S V Y
Sbjct: 58  DEVINILDHAYINDI--IENPTAENIAKWIWGKLSKKIEEQGCRLYEIEVWETEDSSVIY 115

Query: 116 QG 117
           +G
Sbjct: 116 RG 117


>gi|54038110|gb|AAH84396.1| LOC495178 protein [Xenopus laevis]
          Length = 170

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 38/133 (28%), Positives = 68/133 (51%), Gaps = 16/133 (12%)

Query: 1   MKITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVD 50
           ++I+++ +F A+HRL               KC+    HGH+Y+  + + G +DP TG V 
Sbjct: 37  IQISRSLSFSASHRLHSNSLSEEENKRIFGKCNNPNGHGHNYKAIVTVRGKIDPITGMVM 96

Query: 51  DFFNIEQYFSPLLE-KLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVR 104
           +  ++++Y    +   LDH  ++ ++    N   T ENI ++IW+ L   L   +L  V 
Sbjct: 97  NLTDLKRYMEECITVPLDHKNVDKDVPYFRNVVSTVENITVFIWEELQKRLPAGLLYEVC 156

Query: 105 VYETPMSWVEYQG 117
           V+ET  +   Y+G
Sbjct: 157 VHETDSNSAVYRG 169


>gi|213513360|ref|NP_001134835.1| 6-pyruvoyl tetrahydropterin synthase [Salmo salar]
 gi|209736438|gb|ACI69088.1| 6-pyruvoyl tetrahydrobiopterin synthase [Salmo salar]
 gi|209737562|gb|ACI69650.1| 6-pyruvoyl tetrahydrobiopterin synthase [Salmo salar]
          Length = 148

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 40/131 (30%), Positives = 68/131 (51%), Gaps = 16/131 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+  +F A HRL               KC+    HGH+Y+VE+ + G +D  TG V + 
Sbjct: 17  ITRVQSFSACHRLHSPTLSDEVNKRIFGKCNNPNGHGHNYKVEVTVRGKIDRHTGMVMNI 76

Query: 53  FNIEQYFSPLLE-KLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVRVY 106
            +++Q+   ++   LDH  L+ ++    N   T EN+A++IW  +   L   +L  V+++
Sbjct: 77  TDLKQHIEEVIMIPLDHKNLDKDVPYFANVVSTTENVAVYIWDNMVKQLPANLLYEVKIH 136

Query: 107 ETPMSWVEYQG 117
           ET  + V Y+G
Sbjct: 137 ETDKNIVVYRG 147


>gi|256045574|ref|ZP_05448454.1| queuosine biosynthesis protein QueD [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 113

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 37/109 (33%), Positives = 57/109 (52%)

Query: 8   TFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLD 67
            F A+H+L  +P  H+C R+HGH+Y VE+ +        GFV D+  +      + +  D
Sbjct: 1   HFSASHQLTGLPADHQCARLHGHNYIVEVELSAPDLDTHGFVRDYHELAALKHYIDDTFD 60

Query: 68  HHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
           H  LN++   E  TAE +A   +         +S+VRV ETP +W EY+
Sbjct: 61  HRHLNDVLGHEQTTAERLAKHFFDWCHARWPEISAVRVSETPKTWAEYR 109


>gi|326391799|ref|ZP_08213317.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermoanaerobacter ethanolicus JW 200]
 gi|325992157|gb|EGD50631.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermoanaerobacter ethanolicus JW 200]
          Length = 122

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 48/119 (40%), Positives = 71/119 (59%), Gaps = 9/119 (7%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MK+T+ FTF++AH L       KC  +HGH+Y++E+ +EG  D + G V DF  +++  +
Sbjct: 1   MKVTKIFTFDSAHNLINY--NGKCEELHGHTYKLEVTVEGKPDGE-GMVIDFVKLKEIVN 57

Query: 61  PL-LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
              ++KLDH  LNE+    N T ENI +WIWK L   L      L  +R++ETP S+ E
Sbjct: 58  EKVVKKLDHKYLNEVLGF-NTTCENILLWIWKELEPVLKGDNYHLYKLRLWETPTSFAE 115


>gi|73955142|ref|XP_854076.1| PREDICTED: similar to 6-pyruvoyl tetrahydrobiopterin synthase
           precursor (PTPS) (PTP synthase) [Canis familiaris]
          Length = 150

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 40/132 (30%), Positives = 73/132 (55%), Gaps = 16/132 (12%)

Query: 2   KITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDD 51
           ++++  +F A HRL          +    KC+    HGH+Y+V + + G++DP TG V +
Sbjct: 18  RVSRLVSFSATHRLHSKSLSNEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPVTGMVMN 77

Query: 52  FFNIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI--LSSVRV 105
             ++++Y    +++ LDH  L+ ++    +   T EN+A++IW+ L   L +  L  V+V
Sbjct: 78  LTDLKEYMEEAIMKPLDHKNLDLDVPYFADVVSTTENVAVYIWENLQKFLPLGVLYKVKV 137

Query: 106 YETPMSWVEYQG 117
           YET  + V Y+G
Sbjct: 138 YETDNNIVVYKG 149


>gi|297464880|ref|XP_002703545.1| PREDICTED: 6-pyruvoyltetrahydropterin synthase-like [Bos taurus]
 gi|297491983|ref|XP_002699300.1| PREDICTED: 6-pyruvoyltetrahydropterin synthase-like [Bos taurus]
 gi|296471751|gb|DAA13866.1| 6-pyruvoyltetrahydropterin synthase-like [Bos taurus]
          Length = 165

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 41/132 (31%), Positives = 73/132 (55%), Gaps = 16/132 (12%)

Query: 2   KITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDD 51
           ++++  +F A+HRL          +    KC+    HGH+Y+V + + G+VDP TG V +
Sbjct: 13  RVSRLVSFSASHRLHSKSLSNEENLKLFGKCNNPNGHGHNYKVVVTVHGEVDPVTGMVMN 72

Query: 52  FFNIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVRV 105
             ++++Y    +++ LDH  L+  +    +   T EN+A++IW+ L   L   +L  V+V
Sbjct: 73  LTDLKEYIEEAIMKPLDHKNLDLGVPYFADIVSTTENVAVYIWENLQKFLPVGVLYKVKV 132

Query: 106 YETPMSWVEYQG 117
           YET  + V Y+G
Sbjct: 133 YETDNNIVVYKG 144


>gi|83951568|ref|ZP_00960300.1| hypothetical 6-pyruvoyl tetrahydrobiopterin synthase [Roseovarius
           nubinhibens ISM]
 gi|83836574|gb|EAP75871.1| hypothetical 6-pyruvoyl tetrahydrobiopterin synthase [Roseovarius
           nubinhibens ISM]
          Length = 117

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 38/115 (33%), Positives = 62/115 (53%), Gaps = 1/115 (0%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I + F F A+H+L  +P+ H+C R+HGH+Y V + +        GFV D+ ++    S 
Sbjct: 3   RICKEFHFSASHQLAHLPEHHQCARLHGHNYVVAVELAAPELDANGFVRDYHDLAALKSY 62

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
           +  + DH  LN++ +    TAE +A   +   +       +VRV ETP SW EY+
Sbjct: 63  IDTRFDHRHLNDVLDGP-STAEALARHFFDYCAGQWPETVAVRVSETPRSWAEYR 116


>gi|307266253|ref|ZP_07547794.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306918703|gb|EFN48936.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 122

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 49/119 (41%), Positives = 72/119 (60%), Gaps = 9/119 (7%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MK+T+ FTF++AH L       KC  +HGH+Y++E+ +EG  D + G V DF  +++  +
Sbjct: 1   MKVTKIFTFDSAHNLINY--NGKCEELHGHTYKLEVTVEGKPDGE-GMVIDFVKLKEIVN 57

Query: 61  PL-LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
              ++KLDH  LNE+ E  N T ENI +WIWK L   L      L  +R++ETP S+ E
Sbjct: 58  EKVVKKLDHKYLNEVLEF-NTTCENILLWIWKELEPVLKGDNYHLYKLRLWETPTSFAE 115


>gi|134299608|ref|YP_001113104.1| putative 6-pyruvoyl tetrahydropterin synthase [Desulfotomaculum
           reducens MI-1]
 gi|134052308|gb|ABO50279.1| preQ(0) biosynthesis protein QueD [Desulfotomaculum reducens MI-1]
          Length = 128

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 37/126 (29%), Positives = 68/126 (53%), Gaps = 12/126 (9%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++T    F AAH L   P    C R+HGH++ VE+ + G    + G + DF +I++  +
Sbjct: 2   FELTVKNKFSAAHVLCGYPGD--CARLHGHTWTVEVKVFGKELNELGMLIDFKDIKKQLA 59

Query: 61  PLLEKLDHHCLNEIEELE----NPTAENIAIWIWKRLSTSLS------ILSSVRVYETPM 110
            ++ + DH  +N++        NPTAEN++ +I++ L+  +S       L  V V+E+P 
Sbjct: 60  TIINEFDHSYINDLPGFGEDGVNPTAENLSYYIFQTLAQRISSIQMGVKLKEVSVWESPD 119

Query: 111 SWVEYQ 116
           ++  Y+
Sbjct: 120 AYATYR 125


>gi|169831398|ref|YP_001717380.1| putative 6-pyruvoyl tetrahydropterin synthase [Candidatus
           Desulforudis audaxviator MP104C]
 gi|169638242|gb|ACA59748.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Candidatus Desulforudis audaxviator MP104C]
          Length = 126

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 42/125 (33%), Positives = 65/125 (52%), Gaps = 11/125 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++    +F AAHRL   P   +C R+HGH++ VE V+ G      G + DF  ++    
Sbjct: 2   FELRVRSSFAAAHRLHEYPD--QCRRLHGHNWEVEAVVVGPELNAAGMLVDFALLKNELR 59

Query: 61  PLLEKLDHHCLNEIEEL---ENPTAENIAIWIWKRLSTSLSI------LSSVRVYETPMS 111
            ++  LDH  LNE+      +NPTAENIA  I+  L   L+       L++V V+E+P +
Sbjct: 60  QVVGALDHCYLNELAAFGPEKNPTAENIARHIFTELKARLAGIGPAGVLTAVTVWESPAA 119

Query: 112 WVEYQ 116
              Y+
Sbjct: 120 AATYR 124


>gi|332708282|ref|ZP_08428263.1| queuosine biosynthesis protein QueD [Lyngbya majuscula 3L]
 gi|332352947|gb|EGJ32506.1| queuosine biosynthesis protein QueD [Lyngbya majuscula 3L]
          Length = 141

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 50/119 (42%), Positives = 70/119 (58%), Gaps = 8/119 (6%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVD----PKTGFVDDFFNIEQY 58
           I + F FEAAHRLP      KC R+HGHS+   + ++G+       K G + D+ +I+ Y
Sbjct: 7   IYKEFRFEAAHRLPH--HDGKCSRLHGHSWVGRVYVKGNQLIEEGSKQGMIMDYGDIKTY 64

Query: 59  FSPLLEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTS-LSILSSVRVYETPMSWVEY 115
             PLL+  LDH+ LNE   LENPT+E IA W+++RL  + L  L +V + ET  S   Y
Sbjct: 65  LKPLLDNFLDHYYLNETTGLENPTSEAIAKWVFERLEEAGLPGLYAVEIQETCTSGTRY 123


>gi|119386889|ref|YP_917944.1| putative 6-pyruvoyl tetrahydropterin synthase [Paracoccus
           denitrificans PD1222]
 gi|119377484|gb|ABL72248.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Paracoccus denitrificans PD1222]
          Length = 117

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 59/116 (50%), Gaps = 1/116 (0%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +I++ F F A+H+L  +P  H+C R+HGH+Y V + +  +     GFV D+  +     
Sbjct: 2   FRISKEFHFSASHQLAHLPPDHQCARLHGHNYIVVVELAAEELNADGFVRDYHELAPLKH 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            +    DH  LN++ +    TAEN+A               +VRV ETP +W EY+
Sbjct: 62  YIDTHFDHRHLNDVLDGP-STAENMARHFHDWCKARWPETVAVRVSETPKTWAEYR 116


>gi|15642813|ref|NP_227854.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Thermotoga
           maritima MSB8]
 gi|170288703|ref|YP_001738941.1| queuosine biosynthesis protein QueD [Thermotoga sp. RQ2]
 gi|281412100|ref|YP_003346179.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermotoga naphthophila RKU-10]
 gi|4980523|gb|AAD35132.1|AE001691_6 6-pyruvoyl tetrahydrobiopterin synthase, putative [Thermotoga
           maritima MSB8]
 gi|170176206|gb|ACB09258.1| queuosine biosynthesis protein QueD [Thermotoga sp. RQ2]
 gi|281373203|gb|ADA66765.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermotoga naphthophila RKU-10]
          Length = 120

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 45/122 (36%), Positives = 69/122 (56%), Gaps = 10/122 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M + + F+FEAAH L R     KC R+HGH+YR+ + +EG    +   V DF  +++   
Sbjct: 1   MILVKKFSFEAAHNLTRY--LGKCERLHGHTYRLVVKIEGP-LNEEEMVMDFAELKKIVE 57

Query: 61  P-LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
             ++ KLDH  LN++   + PT E +AIWIW +LS  +      L  + ++ET  S V Y
Sbjct: 58  ELVISKLDHSYLNDM--FDQPTTERVAIWIWDQLSKEMEKRGVRLHEIELWETETSGVVY 115

Query: 116 QG 117
           +G
Sbjct: 116 RG 117


>gi|154253589|ref|YP_001414413.1| 6-pyruvoyl tetrahydropterin synthase [Parvibaculum lavamentivorans
           DS-1]
 gi|154157539|gb|ABS64756.1| 6-pyruvoyl tetrahydropterin synthase [Parvibaculum lavamentivorans
           DS-1]
          Length = 122

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 53/118 (44%), Positives = 70/118 (59%), Gaps = 1/118 (0%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MKI + F F+AAH LP   + H   RMHGHS+RV + ++G    +TG V  F ++E+   
Sbjct: 1   MKIYKEFLFDAAHFLPYAEEGHPNRRMHGHSFRVVVWLKGKPAAETGIVRHFEDVEREIM 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYE-TPMSWVEYQG 117
            + EKLDHH LNEIE LE PT E IA WIW  L+T L  ++ V V+  +      Y G
Sbjct: 61  AVREKLDHHLLNEIEGLEFPTLERIAAWIWDALATPLPEIARVEVHRASCREGCIYDG 118


>gi|158521504|ref|YP_001529374.1| putative 6-pyruvoyl tetrahydropterin synthase [Desulfococcus
           oleovorans Hxd3]
 gi|158510330|gb|ABW67297.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfococcus oleovorans Hxd3]
          Length = 129

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 71/121 (58%), Gaps = 8/121 (6%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++T    F AAH+L  V   HKC  +HGH+++VE+ + G      G + DF  ++++ +
Sbjct: 2   FELTVTTHFAAAHQLKMV--AHKCENLHGHNWKVEVCVAGSELDHAGLLIDFGELKRHVA 59

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVE 114
            +++ LDH  LNE+E  +  NP++E+IA++I  +L+  L      +S V+V+E+  S   
Sbjct: 60  TVIDGLDHRFLNELEYFKNGNPSSEHIAVYIADQLTGMLKETRAKISRVKVWESENSCAT 119

Query: 115 Y 115
           Y
Sbjct: 120 Y 120


>gi|325285428|ref|YP_004261218.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Cellulophaga lytica DSM 7489]
 gi|324320882|gb|ADY28347.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Cellulophaga lytica DSM 7489]
          Length = 135

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 47/132 (35%), Positives = 68/132 (51%), Gaps = 16/132 (12%)

Query: 2   KITQAFTFEAAHRLPRVPKT--------HKCHR--MHGHSYRVELVMEGDVDPKTGFVDD 51
           K+++   F +AHRL                C     HGH+Y + + + G++DP TGFV D
Sbjct: 4   KVSRKAHFNSAHRLHNKDWDAEKNKAVFGLCSNPNYHGHNYELIVSVAGEIDPTTGFVMD 63

Query: 52  FFNIEQYFSPLLEK-LDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLS--ILSSVRV 105
              ++      +EK LDH  LN E+ E +  NPTAENIA+ IW +L   +       V +
Sbjct: 64  MKVLKDLIKEKIEKALDHKNLNIEVPEFKELNPTAENIAVVIWNKLRPEIDATKDLEVVL 123

Query: 106 YETPMSWVEYQG 117
           YETP ++V Y G
Sbjct: 124 YETPRNYVTYSG 135


>gi|157121013|ref|XP_001653731.1| 6-pyruvoyltetrahydropterin synthase, putative [Aedes aegypti]
 gi|157121015|ref|XP_001653732.1| 6-pyruvoyltetrahydropterin synthase, putative [Aedes aegypti]
 gi|108882977|gb|EAT47202.1| 6-pyruvoyltetrahydropterin synthase, putative [Aedes aegypti]
 gi|108882978|gb|EAT47203.1| 6-pyruvoyltetrahydropterin synthase, putative [Aedes aegypti]
          Length = 170

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 45/132 (34%), Positives = 71/132 (53%), Gaps = 17/132 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+   F A HRL     +         KC+    HGH+Y VE+ + G VDPKTG V + 
Sbjct: 8   LTRKECFSACHRLHSPFLSEEANRQVYGKCNNPNGHGHNYTVEVTVRGPVDPKTGMVMNI 67

Query: 53  FNIEQYF-SPLLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI---LSSVRV 105
            ++++Y    +++KLDH  L+ ++   +N   T EN+AI+IW  L   +     L  V++
Sbjct: 68  TDLKKYMDQTIMKKLDHLNLDKDVPYFKNLASTTENVAIFIWDSLKLVMPKPDLLYEVKI 127

Query: 106 YETPMSWVEYQG 117
           YET  + V Y+G
Sbjct: 128 YETDKNSVIYRG 139


>gi|229608119|ref|YP_002878767.1| queuosine biosynthesis QueD PTPS-I [Vibrio cholerae MJ-1236]
 gi|229370774|gb|ACQ61197.1| queuosine biosynthesis QueD PTPS-I [Vibrio cholerae MJ-1236]
          Length = 92

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 47/91 (51%), Positives = 65/91 (71%)

Query: 27  MHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEELENPTAENIA 86
           MHGHS+ V L +EG+VDP TG+V DF  I+  F P+ ++LDH+ LN+IE LENPT+E +A
Sbjct: 1   MHGHSFLVRLYVEGEVDPHTGWVVDFAEIKAAFKPIYDRLDHYYLNDIEGLENPTSEVLA 60

Query: 87  IWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
            WIW++L  SL +LS V + ET  +   Y+G
Sbjct: 61  KWIWQQLKPSLPLLSKVEIKETCTAGCIYRG 91


>gi|195398421|ref|XP_002057820.1| GJ17891 [Drosophila virilis]
 gi|194141474|gb|EDW57893.1| GJ17891 [Drosophila virilis]
          Length = 168

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 42/132 (31%), Positives = 69/132 (52%), Gaps = 17/132 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+  TF A HRL          +    KC+    HGH+Y VEL + G +D +TG V + 
Sbjct: 9   LTRRETFSACHRLHSPQLSDAENLEVFGKCNNFNGHGHNYTVELTVRGPIDQRTGMVLNI 68

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSI---LSSVRV 105
             ++      ++++LDH  L+ ++E       T EN+A++IW  + T L     L  V++
Sbjct: 69  TELKYAIEAVIMKRLDHKNLDKDVEYFAKIPSTTENLAVYIWDNIRTHLKKPELLYEVKI 128

Query: 106 YETPMSWVEYQG 117
           +ETP + V Y+G
Sbjct: 129 FETPKNIVTYRG 140


>gi|83816687|ref|YP_446885.1| putative 6-pyruvoyl tetrahydropterin synthase [Salinibacter ruber
           DSM 13855]
 gi|294508824|ref|YP_003572883.1| 6-pyruvoyl-tetrahydropterin synthase homolog [Salinibacter ruber
           M8]
 gi|83758081|gb|ABC46194.1| putative 6-pyruvoyl tetrahydropterin synthase [Salinibacter ruber
           DSM 13855]
 gi|294345153|emb|CBH25931.1| 6-pyruvoyl-tetrahydropterin synthase homolog [Salinibacter ruber
           M8]
          Length = 137

 Score =  113 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 45/131 (34%), Positives = 70/131 (53%), Gaps = 16/131 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCH----------RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F AAHRL    K+   +            HGH+Y +E+ + G+ DP+TG+V D 
Sbjct: 6   ITRKVHFNAAHRLHNPNKSDAWNEDTYGKDNNPNWHGHNYELEVTVAGEPDPETGYVVDL 65

Query: 53  FNIEQYFSPLL-EKLDHHCLNEIEELEN---PTAENIAIWIWKRLSTSLS--ILSSVRVY 106
             ++      + +K+DH  LN   +  +   P++EN AI IW  +  +L    L  VR+Y
Sbjct: 66  GVLKDILHDRVLDKVDHKNLNLEVDFMDGVIPSSENFAIAIWNEIEDALPNGELHCVRLY 125

Query: 107 ETPMSWVEYQG 117
           ETP ++VEY+G
Sbjct: 126 ETPRNFVEYRG 136


>gi|307151865|ref|YP_003887249.1| 6-pyruvoyl tetrahydropterin synthase/hypothetical protein
           [Cyanothece sp. PCC 7822]
 gi|306982093|gb|ADN13974.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Cyanothece sp. PCC 7822]
          Length = 129

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 47/120 (39%), Positives = 70/120 (58%), Gaps = 8/120 (6%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVD----PKTGFVDDFFNIEQY 58
           I + F FEAAH LP      KC R+HGHS+   + ++G       PK G + D+ +++QY
Sbjct: 6   IYKEFRFEAAHTLPH--HDGKCRRLHGHSWVGRVYVKGYELMAEGPKQGMIIDYADVKQY 63

Query: 59  FSPLLEKL-DHHCLNEIEELENPTAENIAIWIWKRLSTS-LSILSSVRVYETPMSWVEYQ 116
             P+L+   DH+ LNE   LENPT+E IA W++++L  + L  L +V + ET  S   Y+
Sbjct: 64  MKPILDNYLDHYYLNETTGLENPTSEAIAKWVYEKLEAAGLPGLYAVEIRETCTSGCTYK 123


>gi|295133035|ref|YP_003583711.1| tetrahydrobiopterin biosynthesis-like protein [Zunongwangia
           profunda SM-A87]
 gi|294981050|gb|ADF51515.1| tetrahydrobiopterin biosynthesis-like protein [Zunongwangia
           profunda SM-A87]
          Length = 136

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 51/135 (37%), Positives = 72/135 (53%), Gaps = 18/135 (13%)

Query: 1   MKIT--QAFTFEAAHRLPRVPK--------THKCHR--MHGHSYRVELVMEGDVDPKTGF 48
           M++T  +   F AAHRL +             KC     HGH+Y + + + G+VDP+TGF
Sbjct: 1   MRLTVHRKAHFNAAHRLFKKEWTDEKNFEVFGKCSNPNYHGHNYELTVSVTGEVDPETGF 60

Query: 49  VDDFFNIEQYFSPLLE-KLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSI--LSS 102
           V D   ++      +E   DH  LN E+EE +  NPTAENIA+ IW +L   L       
Sbjct: 61  VMDLKRLKDLIYTEVETPFDHKNLNVEVEEFKTLNPTAENIAVVIWNKLREKLRENLDLQ 120

Query: 103 VRVYETPMSWVEYQG 117
           V +YETP ++V Y+G
Sbjct: 121 VTLYETPRNFVSYKG 135


>gi|312876654|ref|ZP_07736635.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Caldicellulosiruptor lactoaceticus 6A]
 gi|311796607|gb|EFR12955.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Caldicellulosiruptor lactoaceticus 6A]
          Length = 120

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 45/122 (36%), Positives = 70/122 (57%), Gaps = 10/122 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M + + F F+AAH L +     KC  +HGH+Y++ + +EG  + +   V DF  +++   
Sbjct: 1   MLLKKIFKFDAAHNLTKY--NGKCENLHGHTYKLVVTVEGKPNDQD-MVIDFVLLKKIVH 57

Query: 61  -PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
             ++  LDH  +N+I  +ENPTAENIA WIW +LS  +      L  + V+ET  S V Y
Sbjct: 58  DEVINILDHAYINDI--IENPTAENIAKWIWGKLSKKIEEQGCRLYEIEVWETEDSSVIY 115

Query: 116 QG 117
           +G
Sbjct: 116 RG 117


>gi|170077083|ref|YP_001733721.1| 6-pyruvoyl tetrahydropterin synthase [Synechococcus sp. PCC 7002]
 gi|169884752|gb|ACA98465.1| 6-pyruvoyl tetrahydropterin synthase [Synechococcus sp. PCC 7002]
          Length = 125

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 45/120 (37%), Positives = 71/120 (59%), Gaps = 8/120 (6%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKT----GFVDDFFNIEQ 57
           ++ + F FEAAH+LP      KC R+HGHS+ + + + GD   +T    G + DF  I++
Sbjct: 5   ELYKEFRFEAAHQLPH--HDGKCARLHGHSWVMRVYLRGDRLQETGPKQGMLFDFGEIKK 62

Query: 58  YFSPLLEKL-DHHCLNEIEELENPTAENIAIWIWKRLST-SLSILSSVRVYETPMSWVEY 115
           Y  PLL++  DH+ LN+   +E+PT+E IA WI++ L    L  L++V + ET  +   Y
Sbjct: 63  YVQPLLDQYLDHYHLNDSLGMESPTSEAIAQWIYQELKKVDLPGLAAVEIKETCTAGCIY 122


>gi|167036749|ref|YP_001664327.1| putative 6-pyruvoyl tetrahydropterin synthase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|167039468|ref|YP_001662453.1| putative 6-pyruvoyl tetrahydropterin synthase [Thermoanaerobacter
           sp. X514]
 gi|300915427|ref|ZP_07132740.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermoanaerobacter sp. X561]
 gi|307725206|ref|YP_003904957.1| hypothetical protein Thet_2102 [Thermoanaerobacter sp. X513]
 gi|320115172|ref|YP_004185331.1| hypothetical protein Thebr_0332 [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|166853708|gb|ABY92117.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermoanaerobacter sp. X514]
 gi|166855583|gb|ABY93991.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|300888487|gb|EFK83636.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermoanaerobacter sp. X561]
 gi|307582267|gb|ADN55666.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermoanaerobacter sp. X513]
 gi|319928263|gb|ADV78948.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 122

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 47/119 (39%), Positives = 70/119 (58%), Gaps = 9/119 (7%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MK+T+ FTF++AH L       KC  +HGH+Y++E+ +EG  D + G V DF  +++  +
Sbjct: 1   MKVTKIFTFDSAHNLINY--NGKCEELHGHTYKLEVTVEGKPDGE-GMVIDFVKLKEIVN 57

Query: 61  PL-LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
              ++KLDH  LNE+    N T ENI +WIWK L          L  +R++ETP S+ E
Sbjct: 58  EKVVKKLDHKYLNEVLGF-NTTCENILLWIWKELEPVFKGDNYHLYKLRLWETPTSFAE 115


>gi|260887261|ref|ZP_05898524.1| queuosine biosynthesis protein QueD [Selenomonas sputigena ATCC
           35185]
 gi|330838982|ref|YP_004413562.1| queuosine biosynthesis protein QueD [Selenomonas sputigena ATCC
           35185]
 gi|260863323|gb|EEX77823.1| queuosine biosynthesis protein QueD [Selenomonas sputigena ATCC
           35185]
 gi|329746746|gb|AEC00103.1| queuosine biosynthesis protein QueD [Selenomonas sputigena ATCC
           35185]
          Length = 125

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 44/123 (35%), Positives = 65/123 (52%), Gaps = 10/123 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +I     FEAAHR+   P   KC R+HGH+++VEL + G    + G + DF   +    
Sbjct: 2   FEIKVEEEFEAAHRIVNYP--GKCDRLHGHNWKVELKISGSRLDELGMLIDFKAAKAMLQ 59

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSL------SILSSVRVYETPMSW 112
            ++  LDH  LNE+E     NPTAENIA +I++ L            L++V V+E+P + 
Sbjct: 60  EVVNSLDHRFLNELEPFSEINPTAENIARYIYQELKQREIFCNDSVHLAAVCVWESPRAC 119

Query: 113 VEY 115
             Y
Sbjct: 120 ATY 122


>gi|158314659|ref|YP_001507167.1| putative 6-pyruvoyl tetrahydropterin synthase [Frankia sp. EAN1pec]
 gi|158110064|gb|ABW12261.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Frankia sp. EAN1pec]
          Length = 140

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 48/119 (40%), Positives = 67/119 (56%), Gaps = 4/119 (3%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +I + FTF+AAH LP +P  HKC R+HGH+Y VE V+        GFV DF ++     
Sbjct: 16  FRIGKRFTFDAAHHLPSLPAGHKCSRVHGHTYTVEFVLAASELAGPGFVTDFGDLAVAGR 75

Query: 61  PLLEKLDHHCLNEIEELENPT---AENIAIWIWKRLSTSLS-ILSSVRVYETPMSWVEY 115
            L E  DH  LNE+ ++E  +   A+++A W    +   +   L +VRV ETP SW EY
Sbjct: 76  YLAESFDHRDLNEVLDVEPTSEALAQHLARWFLAEVEPGVHGRLVAVRVSETPSSWAEY 134


>gi|156389084|ref|XP_001634822.1| predicted protein [Nematostella vectensis]
 gi|156221909|gb|EDO42759.1| predicted protein [Nematostella vectensis]
          Length = 147

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 44/130 (33%), Positives = 69/130 (53%), Gaps = 15/130 (11%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHR--MHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT++ TF A HRL          +    KC+    HGH+Y+VE+ +   VD  TG V + 
Sbjct: 11  ITRSETFSACHRLHSTKLTDQQNIELFGKCNNKNGHGHNYKVEVTVASTVDEDTGMVMNL 70

Query: 53  FNIEQYFSPLLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI--LSSVRVYE 107
             ++     +L +LDH  L+ ++E  +    TAENIA++I+ +L+  L    L  VRV+E
Sbjct: 71  VALKGKIEEVLSELDHKNLDLDVEYFQTVVSTAENIAVYIYNQLNRGLPDGILYEVRVHE 130

Query: 108 TPMSWVEYQG 117
           T  +   Y+G
Sbjct: 131 TDKNVAFYRG 140


>gi|297545384|ref|YP_003677686.1| hypothetical protein Tmath_1993 [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|296843159|gb|ADH61675.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
          Length = 122

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 47/119 (39%), Positives = 70/119 (58%), Gaps = 9/119 (7%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MK+T+ FTF++AH L       KC  +HGH+Y++E+ +EG  D + G V DF  +++  +
Sbjct: 1   MKVTKIFTFDSAHNLLNY--NGKCEELHGHTYKLEVTVEGKPDGE-GMVIDFVKLKEIVN 57

Query: 61  PL-LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
              ++KLDH  LNE+    N T ENI +WIWK L          L  +R++ETP S+ E
Sbjct: 58  EKVVKKLDHKYLNEVLGF-NTTCENILLWIWKELEPVFKGDNYHLYKLRLWETPTSFAE 115


>gi|257058039|ref|YP_003135927.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Cyanothece sp. PCC 8802]
 gi|256588205|gb|ACU99091.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Cyanothece sp. PCC 8802]
          Length = 136

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 54/119 (45%), Positives = 72/119 (60%), Gaps = 8/119 (6%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVD----PKTGFVDDFFNIEQY 58
           I + F FEAAHRLP      KCHR+HGHS+   + ++GD      PK G + DF +I++Y
Sbjct: 11  IFKEFRFEAAHRLPHYD--GKCHRLHGHSWVGRIYVQGDRLVKDGPKQGMIMDFSDIQRY 68

Query: 59  FSPLLEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTS-LSILSSVRVYETPMSWVEY 115
             PLLE  LDH+ LNE   LENPT E +A WI+++L  + L  L +V + ET  S   Y
Sbjct: 69  LEPLLENFLDHYYLNETMGLENPTCEAVAQWIFEKLEKAGLQGLQAVEIQETCTSGARY 127


>gi|103488121|ref|YP_617682.1| putative 6-pyruvoyl tetrahydropterin synthase [Sphingopyxis
           alaskensis RB2256]
 gi|98978198|gb|ABF54349.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Sphingopyxis alaskensis RB2256]
          Length = 124

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 46/118 (38%), Positives = 63/118 (53%), Gaps = 1/118 (0%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++++ F F+AAH L R   T    R+HGHSYR E+ + G  DP TG + D   +E+   
Sbjct: 2   FELSKQFRFDAAHTLERSIDTESSRRIHGHSYRAEVTVRGRPDPATGMIVDLGLLERSME 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYE-TPMSWVEYQG 117
              + LDH  L+EI +L   T EN++ WIW RLS  L  L  V VY  +      Y G
Sbjct: 62  DARDALDHRFLDEINDLGPATMENLSRWIWNRLSPELDNLFKVSVYRDSSGDACTYWG 119


>gi|256751872|ref|ZP_05492744.1| 6-pyruvoyl tetrahydropterin synthase [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|256749279|gb|EEU62311.1| 6-pyruvoyl tetrahydropterin synthase [Thermoanaerobacter
           ethanolicus CCSD1]
          Length = 122

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 47/119 (39%), Positives = 70/119 (58%), Gaps = 9/119 (7%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MK+T+ FTF++AH L       KC  +HGH+Y++E+ +EG  D + G V DF  +++  +
Sbjct: 1   MKVTKIFTFDSAHNLINY--NGKCEELHGHTYKLEVTVEGKPDGE-GMVIDFVKLKEIVN 57

Query: 61  PL-LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
              ++KLDH  LNE+    N T ENI +WIWK L          L  +R++ETP S+ E
Sbjct: 58  EKVVKKLDHKYLNEVLGF-NTTCENILLWIWKELEPVFKGDNYHLYKLRLWETPTSFAE 115


>gi|300113746|ref|YP_003760321.1| fused 6-pyruvoyl tetrahydropterin synthase/hypothetical protein
           [Nitrosococcus watsonii C-113]
 gi|299539683|gb|ADJ28000.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Nitrosococcus watsonii C-113]
          Length = 129

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 39/113 (34%), Positives = 65/113 (57%), Gaps = 8/113 (7%)

Query: 9   FEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDH 68
           F +AH L   P   +C RMHGH++++E+ +      + G V DF +I++    L  +LDH
Sbjct: 13  FSSAHTLRDYP--GECRRMHGHNWKLEVEVTAQALDQQGMVMDFKDIKKSARQLCAQLDH 70

Query: 69  HCLNEIEELE--NPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
             LN+I   +  NPTAEN+A + ++ LS  L+     +S++ ++ET  + V Y
Sbjct: 71  RYLNDISPFDRINPTAENLAAFFYRGLSQQLNNERAWVSAITLWETERACVRY 123


>gi|225711632|gb|ACO11662.1| 6-pyruvoyl tetrahydrobiopterin synthase [Caligus rogercresseyi]
          Length = 140

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 43/134 (32%), Positives = 68/134 (50%), Gaps = 19/134 (14%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+   F AAHRL               KC+    HGH+Y VE+ + G+  PKTGFV + 
Sbjct: 5   LTRREHFCAAHRLHSDSLTSEENQELFGKCNNPNGHGHNYNVEITVSGEPCPKTGFVMNL 64

Query: 53  FNIEQYFSPLLEK-LDHHCLN-EIEELEN----PTAENIAIWIWKRLSTSLSI---LSSV 103
            ++++  +  + + LDH  ++ ++          TAENIAI+IW  L+        L  V
Sbjct: 65  VDLKELIATHVLRTLDHRNIDLDVPYFAQGKKTSTAENIAIYIWDCLTPHFGDGVSLYEV 124

Query: 104 RVYETPMSWVEYQG 117
           R++ET  + V Y+G
Sbjct: 125 RLWETEKNSVAYRG 138


>gi|295837454|ref|ZP_06824387.1| queuosine biosynthesis protein QueD [Streptomyces sp. SPB74]
 gi|295826529|gb|EDY46627.2| queuosine biosynthesis protein QueD [Streptomyces sp. SPB74]
          Length = 132

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 45/118 (38%), Positives = 72/118 (61%), Gaps = 3/118 (2%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDP--KTGFVDDFFNIEQY 58
           M IT+ F F A H L ++P  HKC R HGH+Y V + +    D   + GFV D+ +++ +
Sbjct: 1   MTITKEFHFSAGHVLDKLPSWHKCARPHGHNYVVVMELSAHPDELTEAGFVRDYADLDAF 60

Query: 59  FSPLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            + L E LDH  LN++ ++ +P+AEN+A+W++ R +     L +V V ETP +W  Y+
Sbjct: 61  KTWLDETLDHRHLNDVMDV-SPSAENLALWVFSRWAERYPELVAVWVSETPRTWAIYR 117


>gi|295105990|emb|CBL03533.1| queuosine biosynthesis protein QueD [Gordonibacter pamelaeae
           7-10-1-b]
          Length = 168

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 38/120 (31%), Positives = 63/120 (52%), Gaps = 7/120 (5%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++T    F+AAH LP       C  +HGH++ VE+ + G      G + DF + ++    
Sbjct: 50  ELTVRDCFDAAHALPGYD--GPCQYLHGHTWEVEVTIAGQHLDDVGMLYDFKDAKRDLHG 107

Query: 62  LLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLSI---LSSVRVYETPMSWVEYQ 116
           +LE  DH CLN++   +  NPTAE++A  ++  L  +      L  V V+E+P + V Y+
Sbjct: 108 VLENFDHRCLNDVPPFDEINPTAEHLARVVFYELEKTFPAHISLMEVAVWESPAAKVVYR 167


>gi|167522216|ref|XP_001745446.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163776404|gb|EDQ90024.1| predicted protein [Monosiga brevicollis MX1]
          Length = 135

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 44/130 (33%), Positives = 72/130 (55%), Gaps = 15/130 (11%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFN 54
           IT+   F +AHRL               KC   HGH+Y+VE+ + G VDP TG V +  +
Sbjct: 5   ITRVEAFSSAHRLWSSELSAEENANVFGKCTNKHGHNYKVEVTIRGPVDPITGMVMNLVD 64

Query: 55  IEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI---LSSVRVYE 107
           +++Y    +++ +DH  L+ ++E  +    TAEN+A++IW+++   L     L  V++YE
Sbjct: 65  LKKYMHRAVMDTMDHKDLDEDVEYFKTRPSTAENVAVFIWEQMVAQLPDSSLLHEVKLYE 124

Query: 108 TPMSWVEYQG 117
           TP + V Y G
Sbjct: 125 TPKNIVLYHG 134


>gi|218438279|ref|YP_002376608.1| queuosine biosynthesis protein QueD [Cyanothece sp. PCC 7424]
 gi|218171007|gb|ACK69740.1| queuosine biosynthesis protein QueD [Cyanothece sp. PCC 7424]
          Length = 129

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 47/120 (39%), Positives = 68/120 (56%), Gaps = 8/120 (6%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVD----PKTGFVDDFFNIEQY 58
           I + F FEAAH LP      KC R+HGHS+   + ++G+       + G + D+  I+ Y
Sbjct: 6   IYKEFRFEAAHILPH--HGGKCRRLHGHSWVGRVYVKGNELIAEGSQQGMIIDYGEIKHY 63

Query: 59  FSPLLEKL-DHHCLNEIEELENPTAENIAIWIWKRLSTS-LSILSSVRVYETPMSWVEYQ 116
             PLL+   DH+ LNE   LENPT+E IA WI+++L  + L  L +V + ET  S   Y+
Sbjct: 64  IQPLLDHYLDHYFLNETTGLENPTSEAIAKWIFEKLEAAGLPGLYAVEIRETCTSGCTYK 123


>gi|86144086|ref|ZP_01062424.1| 6-pyruvoyltetrahydropterin synthase [Leeuwenhoekiella blandensis
           MED217]
 gi|85829546|gb|EAQ48010.1| 6-pyruvoyltetrahydropterin synthase [Leeuwenhoekiella blandensis
           MED217]
          Length = 137

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 47/131 (35%), Positives = 64/131 (48%), Gaps = 16/131 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           + +   F AAHRL R             KC     HGH+Y + + + G++DPKTGFV D 
Sbjct: 6   VKRKAHFNAAHRLYRADWDDAKNLEVFGKCSYPNYHGHNYELIVAVTGEIDPKTGFVIDL 65

Query: 53  FNIEQYFS-PLLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSILS--SVRVY 106
             ++      + E  DH  LN ++ E    NPTAENI + I+ RL   L       V +Y
Sbjct: 66  KVLKDLIKSEVEEPFDHKNLNLDVAEFSQLNPTAENICVVIYDRLKAKLDAKFAIEVTLY 125

Query: 107 ETPMSWVEYQG 117
           ETP + V Y G
Sbjct: 126 ETPRNSVTYSG 136


>gi|218245015|ref|YP_002370386.1| queuosine biosynthesis protein QueD [Cyanothece sp. PCC 8801]
 gi|218165493|gb|ACK64230.1| queuosine biosynthesis protein QueD [Cyanothece sp. PCC 8801]
          Length = 136

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 55/119 (46%), Positives = 73/119 (61%), Gaps = 8/119 (6%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVD----PKTGFVDDFFNIEQY 58
           I + F FEAAHRLP      KCHR+HGHS+   + ++GD      PK G + DF +I++Y
Sbjct: 11  IFKEFRFEAAHRLPHYD--GKCHRLHGHSWVGRIYVQGDRLVKDGPKQGMIMDFSDIQRY 68

Query: 59  FSPLLEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTS-LSILSSVRVYETPMSWVEY 115
             PLLE  LDH+ LNE   LENPT E +A WI+++L  + L  L +V + ET  S V Y
Sbjct: 69  LEPLLENFLDHYYLNETMGLENPTCEAVAQWIFEKLEKAGLQGLQAVEIQETCTSGVRY 127


>gi|254434348|ref|ZP_05047856.1| 6-pyruvoyl tetrahydropterin synthase superfamily [Nitrosococcus
           oceani AFC27]
 gi|207090681|gb|EDZ67952.1| 6-pyruvoyl tetrahydropterin synthase superfamily [Nitrosococcus
           oceani AFC27]
          Length = 127

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 39/113 (34%), Positives = 65/113 (57%), Gaps = 8/113 (7%)

Query: 9   FEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDH 68
           F +AH L   P   +C RMHGH++++E+ +      + G V DF +I++    L  +LDH
Sbjct: 13  FSSAHTLRDYP--GECRRMHGHNWKLEVEVTAQALDQQGMVMDFKDIKESARELCAQLDH 70

Query: 69  HCLNEIEELE--NPTAENIAIWIWKRLSTSL----SILSSVRVYETPMSWVEY 115
             LN+I   +  NPTAEN+A + ++ LS  L    + +S++ ++ET  + V Y
Sbjct: 71  RYLNDISPFDLINPTAENLAAFFYRGLSKQLNNERARVSAITLWETERACVRY 123


>gi|156545440|ref|XP_001606725.1| PREDICTED: similar to 6-pyruvoyltetrahydropterin synthase, putative
           [Nasonia vitripennis]
          Length = 142

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 70/132 (53%), Gaps = 17/132 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+  +  + HRL     +         KC+    HGH+Y VE+ + G VDP TG V + 
Sbjct: 8   LTRKESISSCHRLHSPHLSDEENAKIYGKCNNYWGHGHNYTVEVTVRGPVDPTTGMVMNI 67

Query: 53  FNIEQYFSPL-LEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI---LSSVRV 105
            +++ Y   + +++LDH  L+ +++  +N   T EN+AI+++  +   L     L  V++
Sbjct: 68  SDLKVYMKKILMDQLDHKNLDKDVDYFKNVVSTTENVAIYVFDEIKKLLPQPELLYEVKI 127

Query: 106 YETPMSWVEYQG 117
           YET  + V Y+G
Sbjct: 128 YETDNNIVIYRG 139


>gi|159026461|emb|CAO88973.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 124

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 49/120 (40%), Positives = 69/120 (57%), Gaps = 8/120 (6%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVD----PKTGFVDDFFNIEQY 58
           I + F FEAAH LP      KC R+HGHS+   + ++ +       + G V DF  I+QY
Sbjct: 6   IYKEFRFEAAHHLPHYE--GKCRRLHGHSWLGRIYVKSNHLQCQGSQQGMVMDFGEIKQY 63

Query: 59  FSPLLEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTS-LSILSSVRVYETPMSWVEYQ 116
             PLL+  LDHH LNE   LENPT+E ++ WI+++L+ + L  L +V + ET  S   Y 
Sbjct: 64  LQPLLDNFLDHHYLNETTGLENPTSEELSRWIYEKLAKAGLPNLHAVEICETCTSGCTYY 123


>gi|194879147|ref|XP_001974184.1| GG21591 [Drosophila erecta]
 gi|190657371|gb|EDV54584.1| GG21591 [Drosophila erecta]
          Length = 168

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 40/132 (30%), Positives = 70/132 (53%), Gaps = 17/132 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T+  TF A HRL          +    KC+  HGH  +Y VE+ + G +D +TG V + 
Sbjct: 9   LTRRETFSACHRLHSPQLSDAENLEVFGKCNNFHGHGHNYTVEITVRGPIDRRTGMVVNI 68

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSLSI---LSSVRV 105
             +++     ++++LDH  L+ ++E   N   T EN+A++IW  +   L     L  V++
Sbjct: 69  SELKEAIETVIMKRLDHKNLDKDVEYFANTPSTTENLAVYIWDNIRLQLKKPELLYEVKI 128

Query: 106 YETPMSWVEYQG 117
           +ETP + + Y+G
Sbjct: 129 HETPKNIISYRG 140


>gi|195484647|ref|XP_002090777.1| GE12609 [Drosophila yakuba]
 gi|194176878|gb|EDW90489.1| GE12609 [Drosophila yakuba]
          Length = 168

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 40/132 (30%), Positives = 70/132 (53%), Gaps = 17/132 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T+  TF A HRL          +    KC+  HGH  +Y VE+ + G +D +TG V + 
Sbjct: 9   LTRRETFSACHRLHSPQLSDAENLEVFGKCNNFHGHGHNYTVEITVRGPIDRRTGMVLNI 68

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSLSI---LSSVRV 105
             +++     ++++LDH  L+ ++E   N   T EN+A++IW  +   L     L  V++
Sbjct: 69  SELKEAIETVIMKRLDHKNLDKDVEYFANTPSTTENLAVYIWDNIRLQLKKPELLYEVKI 128

Query: 106 YETPMSWVEYQG 117
           +ETP + + Y+G
Sbjct: 129 HETPKNIISYRG 140


>gi|291279398|ref|YP_003496233.1| 6-pyruvoyl-tetrahydropterin synthase [Deferribacter desulfuricans
           SSM1]
 gi|290754100|dbj|BAI80477.1| 6-pyruvoyl-tetrahydropterin synthase [Deferribacter desulfuricans
           SSM1]
          Length = 119

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 44/118 (37%), Positives = 67/118 (56%), Gaps = 5/118 (4%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++     F +AH L       KC  +HGH+++VE+ ++G+   KTG + DF NI++    
Sbjct: 3   RLRVIDHFASAHFLRDYE--GKCENLHGHNWKVEVYLKGEKLDKTGMLVDFKNIKKELRK 60

Query: 62  LLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLSIL-SSVRVYETPMSWVEYQ 116
           + ++LDH  LNE    E  NPT+ENIA +I+ RL      L SSV V+E+  +  EY 
Sbjct: 61  ITDELDHIFLNEHPYFEKINPTSENIAKYIYDRLKEKFCDLMSSVVVWESETAAAEYY 118


>gi|24585378|ref|NP_724244.1| purple [Drosophila melanogaster]
 gi|195345266|ref|XP_002039191.1| GM16965 [Drosophila sechellia]
 gi|1346905|sp|P48611|PTPS_DROME RecName: Full=6-pyruvoyl tetrahydrobiopterin synthase; Short=PTP
           synthase; Short=PTPS; AltName: Full=Protein purple;
           AltName: Full=Sepiapterin synthase A
 gi|1020309|gb|AAC47269.1| 6-pyruvoyltetrahydropterin synthase [Drosophila melanogaster]
 gi|16768814|gb|AAL28626.1| LD05512p [Drosophila melanogaster]
 gi|22946891|gb|AAN11065.1| purple [Drosophila melanogaster]
 gi|194134321|gb|EDW55837.1| GM16965 [Drosophila sechellia]
 gi|220942732|gb|ACL83909.1| pr-PB [synthetic construct]
          Length = 168

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 40/132 (30%), Positives = 70/132 (53%), Gaps = 17/132 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T+  TF A HRL          +    KC+  HGH  +Y VE+ + G +D +TG V + 
Sbjct: 9   LTRRETFSACHRLHSPQLSDAENLEVFGKCNNFHGHGHNYTVEITVRGPIDRRTGMVLNI 68

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSLSI---LSSVRV 105
             +++     ++++LDH  L+ ++E   N   T EN+A++IW  +   L     L  V++
Sbjct: 69  TELKEAIETVIMKRLDHKNLDKDVEYFANTPSTTENLAVYIWDNIRLQLKKPELLYEVKI 128

Query: 106 YETPMSWVEYQG 117
           +ETP + + Y+G
Sbjct: 129 HETPKNIISYRG 140


>gi|172037030|ref|YP_001803531.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Cyanothece sp.
           ATCC 51142]
 gi|171698484|gb|ACB51465.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Cyanothece sp.
           ATCC 51142]
          Length = 130

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 51/120 (42%), Positives = 67/120 (55%), Gaps = 8/120 (6%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKT----GFVDDFFNIEQY 58
           I + F FEAAHRLP      KC R+HGHS+   + +  D   +T    G V DF  I  Y
Sbjct: 9   IYKEFRFEAAHRLPH--HQGKCSRLHGHSWVGRVYVSRDRLHETGPQQGMVMDFGEISAY 66

Query: 59  FSPLLEK-LDHHCLNEIEELENPTAENIAIWIWKRLS-TSLSILSSVRVYETPMSWVEYQ 116
             PL+E  LDH+ LNE   LE+PT+E IA WI+++L    L  L  V + ET  S  +Y+
Sbjct: 67  LDPLVENFLDHYYLNETTGLESPTSEAIAQWIFEKLEAAKLPGLCMVEIRETCTSGAQYR 126


>gi|326434273|gb|EGD79843.1| 6-pyruvoyl tetrahydrobiopterin synthase [Salpingoeca sp. ATCC
           50818]
          Length = 153

 Score =  111 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 43/132 (32%), Positives = 71/132 (53%), Gaps = 17/132 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           I++  +F A HRL               KC+    HGH+Y+VE+ + G VDPKTG V + 
Sbjct: 21  ISRVESFSACHRLHSIHLSDEENKRIFGKCNNPNGHGHNYKVEVTLRGSVDPKTGMVINL 80

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLS---ILSSVRV 105
            +++QY    +++ +DH  L+ ++   +    T EN+A++IW +L   L     L  V+V
Sbjct: 81  VDLKQYMKKAIMDTMDHKHLDLDVPYFKHVVSTTENVAVFIWDQLQEMLPDNAQLHEVKV 140

Query: 106 YETPMSWVEYQG 117
           +ET  + V Y+G
Sbjct: 141 HETDKNVVVYRG 152


>gi|148270019|ref|YP_001244479.1| putative 6-pyruvoyl tetrahydropterin synthase [Thermotoga
           petrophila RKU-1]
 gi|147735563|gb|ABQ46903.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermotoga petrophila RKU-1]
          Length = 120

 Score =  111 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 43/122 (35%), Positives = 69/122 (56%), Gaps = 10/122 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M + + F+FEAAH L +     KC ++HGH+YR+ + +EG    +   V DF  +++   
Sbjct: 1   MILVKKFSFEAAHNLTKY--HGKCEKLHGHTYRLVVKIEGP-LNEEEMVMDFAELKKIVE 57

Query: 61  P-LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
             ++ KLDH  LN++   + PT E +AIWIW +LS  +      L  + ++ET  S V Y
Sbjct: 58  ELVISKLDHSYLNDM--FDQPTTERVAIWIWDQLSKEMEKRGVRLHEIELWETETSGVVY 115

Query: 116 QG 117
           +G
Sbjct: 116 RG 117


>gi|8394115|ref|NP_058916.1| 6-pyruvoyl tetrahydrobiopterin synthase precursor [Rattus
           norvegicus]
 gi|131559|sp|P27213|PTPS_RAT RecName: Full=6-pyruvoyl tetrahydrobiopterin synthase; Short=PTP
           synthase; Short=PTPS; Flags: Precursor
 gi|202561|gb|AAA40625.1| 6-pyruvoyl-tetrahydropterin synthase [Rattus norvegicus]
 gi|37748176|gb|AAH59140.1| 6-pyruvoyl-tetrahydropterin synthase [Rattus norvegicus]
 gi|149041615|gb|EDL95456.1| 6-pyruvoyl-tetrahydropterin synthase, isoform CRA_a [Rattus
           norvegicus]
          Length = 144

 Score =  111 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 69/127 (54%), Gaps = 16/127 (12%)

Query: 7   FTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDFFNIE 56
            +F A+HRL          +    KC+    HGH+Y+V + + G++DP TG V +  +++
Sbjct: 17  VSFSASHRLHSPSLSAEENLKVFGKCNNPNGHGHNYKVVVTIHGEIDPVTGMVMNLTDLK 76

Query: 57  QYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVRVYETPM 110
           +Y    +++ LDH  L+ ++    +   T EN+A++IW+ L   L    L  V+VYET  
Sbjct: 77  EYMEEAIMKPLDHKNLDLDVPYFADVVSTTENVAVYIWENLQRLLPVGALYKVKVYETDN 136

Query: 111 SWVEYQG 117
           + V Y+G
Sbjct: 137 NIVVYKG 143


>gi|195115874|ref|XP_002002481.1| GI12528 [Drosophila mojavensis]
 gi|193913056|gb|EDW11923.1| GI12528 [Drosophila mojavensis]
          Length = 168

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 41/132 (31%), Positives = 69/132 (52%), Gaps = 17/132 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T+  TF A HRL          +    KC+  HGH  +Y VEL + G +D +TG V + 
Sbjct: 9   LTRRETFSACHRLHSPQLSDAENLEIFGKCNNFHGHGHNYTVELTVRGPIDQRTGMVLNI 68

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSI---LSSVRV 105
             ++      ++++LDH  L+ ++E       T EN+A++IW  + T L     L  V++
Sbjct: 69  TELKDAIETVIMKRLDHKNLDKDVEYFAKIPSTTENLAVYIWDNIRTHLKKPELLYEVKI 128

Query: 106 YETPMSWVEYQG 117
           +ETP + + Y+G
Sbjct: 129 FETPKNIITYRG 140


>gi|4321787|gb|AAD15827.1| 6-pyruvoyl-tetrahydropterin synthase [Mus musculus]
          Length = 144

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 39/127 (30%), Positives = 69/127 (54%), Gaps = 16/127 (12%)

Query: 7   FTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDFFNIE 56
            +F A+HRL          +    KC+    HGH+Y+V + + G++DP TG V +  +++
Sbjct: 17  VSFSASHRLHSPSLSDEENLRVFGKCNNPNGHGHNYKVVVTVHGEIDPVTGMVMNLTDLK 76

Query: 57  QYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVRVYETPM 110
           +Y    +++ LDH  L+ ++    +   T EN+A++IW+ L   L    L  V+V+ET  
Sbjct: 77  EYMEEAIMKPLDHKNLDLDVPYFADAVSTTENVAVYIWESLQKLLPVGALYKVKVFETDN 136

Query: 111 SWVEYQG 117
           + V Y+G
Sbjct: 137 NIVVYKG 143


>gi|313894802|ref|ZP_07828362.1| queuosine biosynthesis protein QueD [Selenomonas sp. oral taxon 137
           str. F0430]
 gi|312976483|gb|EFR41938.1| queuosine biosynthesis protein QueD [Selenomonas sp. oral taxon 137
           str. F0430]
          Length = 126

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 65/116 (56%), Gaps = 11/116 (9%)

Query: 9   FEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDH 68
           FEAAHR+   P   KC R+HGH++ VE    G    + G + DF   ++  + +L+  DH
Sbjct: 10  FEAAHRVVDYP--GKCDRLHGHNWVVEAAFRGTQLDELGMLIDFKIAKKALAAVLDDYDH 67

Query: 69  HCLNEIEELE---NPTAENIAIWIWKRLSTS------LSILSSVRVYETPMSWVEY 115
           + LN+I       NPTAEN+A  I++RL+         + L+++ V+E+P S V Y
Sbjct: 68  YYLNDIPPFSEGLNPTAENLARIIYERLAAREELAGTGAELAALTVWESPKSSVTY 123


>gi|323135765|ref|ZP_08070848.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Methylocystis sp. ATCC 49242]
 gi|322398856|gb|EFY01375.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Methylocystis sp. ATCC 49242]
          Length = 124

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 39/120 (32%), Positives = 66/120 (55%), Gaps = 3/120 (2%)

Query: 1   MKITQAFTFEAAHRL--PRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQY 58
            ++ +   FEAAH L  P  P+  K   +HGHS+R+ + + G+ +    +V D   + + 
Sbjct: 4   FEVYRELYFEAAHALYDPEAPEGGKYRNLHGHSFRLRVTLRGERNAGEEWVMDLGKLGRR 63

Query: 59  FSPLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYE-TPMSWVEYQG 117
            + L E+LDH  LN++E L  PT EN+ ++IW+ L+ SL  L  V ++  +      Y+G
Sbjct: 64  LAELRERLDHSFLNDLEGLGKPTLENLCVYIWRDLAPSLPGLYEVGLFRDSCFEGCVYRG 123


>gi|111222165|ref|YP_712959.1| 6-pyruvoyl tetrahydrobiopterin synthase [Frankia alni ACN14a]
 gi|111149697|emb|CAJ61389.1| 6-pyruvoyl tetrahydrobiopterin synthase [Frankia alni ACN14a]
          Length = 130

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 41/120 (34%), Positives = 62/120 (51%), Gaps = 5/120 (4%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +I++ F F A+HRL  +P  HKC R+HGH+Y V + + G+     GF+ D+  +     
Sbjct: 6   FEISKTFEFSASHRLSGLPADHKCARLHGHNYTVRVQLRGETLDPVGFLLDYGELSPVRD 65

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVR----VYETPMSWVEYQ 116
            +   LDH  LN   +  NPTAE +A  +   +   + I   VR    V ETP +W  Y+
Sbjct: 66  WIDAALDHQHLNACLDF-NPTAELLAQHLAGTVRQLVPIPDGVRVAVGVSETPRTWAFYR 124


>gi|292492811|ref|YP_003528250.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Nitrosococcus halophilus Nc4]
 gi|291581406|gb|ADE15863.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Nitrosococcus halophilus Nc4]
          Length = 129

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 38/113 (33%), Positives = 63/113 (55%), Gaps = 8/113 (7%)

Query: 9   FEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDH 68
           F +AH L   P   +C RMHGH++++E+ +      + G   DF  I++    L  +LDH
Sbjct: 13  FASAHTLRDYP--GECRRMHGHNWKLEVEVTAQALDQQGMAMDFKAIKESARNLCAQLDH 70

Query: 69  HCLNEIEELE--NPTAENIAIWIWKRLSTSL----SILSSVRVYETPMSWVEY 115
             LN+I   +  NPTAEN+A + ++ LS  L    + +S++ ++ET  + V Y
Sbjct: 71  RYLNDIPPFDQINPTAENLAAFFYRGLSEKLNNERAQVSAITLWETERACVRY 123


>gi|196002325|ref|XP_002111030.1| expressed hypothetical protein [Trichoplax adhaerens]
 gi|190586981|gb|EDV27034.1| expressed hypothetical protein [Trichoplax adhaerens]
          Length = 142

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 43/129 (33%), Positives = 71/129 (55%), Gaps = 14/129 (10%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           I +  +F AAHRL               KC+    HGH+Y++E+ ++G++D KTG V + 
Sbjct: 10  IKRIESFSAAHRLHSPFFTDEENRALYGKCNHENGHGHNYKLEVTLKGEIDLKTGMVMNI 69

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSILSSVRVYET 108
            +++   +  ++++LDH  L+ ++    N   TAENIA++IW  L   L IL  V +YET
Sbjct: 70  ADLKVIINEVIMKQLDHKNLDKDVPYFANYPSTAENIAVYIWDCLIEHLPILYEVLLYET 129

Query: 109 PMSWVEYQG 117
             +   Y+G
Sbjct: 130 DKNVAIYRG 138


>gi|332290758|ref|YP_004429367.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Krokinobacter diaphorus 4H-3-7-5]
 gi|332168844|gb|AEE18099.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Krokinobacter diaphorus 4H-3-7-5]
          Length = 136

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 48/135 (35%), Positives = 72/135 (53%), Gaps = 18/135 (13%)

Query: 1   MKIT--QAFTFEAAHRLPRVPKT--------HKCHRM--HGHSYRVELVMEGDVDPKTGF 48
           M+IT  +   F AAHRL R             KC     HGH+Y + + + G++DP+TGF
Sbjct: 1   MRITAHRKAHFNAAHRLYRADWDDAKNMQIFGKCSNPNFHGHNYDLTVSVSGEIDPETGF 60

Query: 49  VDDFFNIEQYFS-PLLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSL--SILSS 102
           + D   ++      + + LDH  LN E+ E +  NPTAENIA+ I K++   L       
Sbjct: 61  LIDLKILKDIIKAEVEDYLDHKNLNLEVPEFKTLNPTAENIAVVIHKKIKAVLDPKFDLE 120

Query: 103 VRVYETPMSWVEYQG 117
           + +YETP ++V Y+G
Sbjct: 121 ITLYETPRNFVTYKG 135


>gi|320530178|ref|ZP_08031248.1| queuosine biosynthesis protein QueD [Selenomonas artemidis F0399]
 gi|320137611|gb|EFW29523.1| queuosine biosynthesis protein QueD [Selenomonas artemidis F0399]
          Length = 126

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 64/116 (55%), Gaps = 11/116 (9%)

Query: 9   FEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDH 68
           FEAAHR+   P   KC R+HGH++ VE    G      G + DF   ++  + +L+  DH
Sbjct: 10  FEAAHRVVDYP--GKCDRLHGHNWVVEAAFRGTQLDDLGMLIDFKVAKKALAAVLDDYDH 67

Query: 69  HCLNEIEELE---NPTAENIAIWIWKRLSTS------LSILSSVRVYETPMSWVEY 115
           + LN+I       NPTAEN+A  I++RL+         + L+++ V+E+P S V Y
Sbjct: 68  YYLNDIPPFSEGVNPTAENLARIIYERLAAREELAGTGAELAALTVWESPKSSVTY 123


>gi|1421148|pdb|1GTQ|A Chain A, 6-Pyruvoyl Tetrahydropterin Synthase
 gi|1421149|pdb|1GTQ|B Chain B, 6-Pyruvoyl Tetrahydropterin Synthase
 gi|4929885|pdb|1B66|A Chain A, 6-Pyruvoyl Tetrahydropterin Synthase
 gi|4929886|pdb|1B66|B Chain B, 6-Pyruvoyl Tetrahydropterin Synthase
 gi|6980450|pdb|1B6Z|A Chain A, 6-Pyruvoyl Tetrahydropterin Synthase
 gi|6980451|pdb|1B6Z|B Chain B, 6-Pyruvoyl Tetrahydropterin Synthase
          Length = 140

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 69/127 (54%), Gaps = 16/127 (12%)

Query: 7   FTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDFFNIE 56
            +F A+HRL          +    KC+    HGH+Y+V + + G++DP TG V +  +++
Sbjct: 13  VSFSASHRLHSPSLSAEENLKVFGKCNNPNGHGHNYKVVVTIHGEIDPVTGMVMNLTDLK 72

Query: 57  QYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVRVYETPM 110
           +Y    +++ LDH  L+ ++    +   T EN+A++IW+ L   L    L  V+VYET  
Sbjct: 73  EYMEEAIMKPLDHKNLDLDVPYFADVVSTTENVAVYIWENLQRLLPVGALYKVKVYETDN 132

Query: 111 SWVEYQG 117
           + V Y+G
Sbjct: 133 NIVVYKG 139


>gi|297617394|ref|YP_003702553.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Syntrophothermus lipocalidus DSM 12680]
 gi|297145231|gb|ADI01988.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Syntrophothermus lipocalidus DSM 12680]
          Length = 125

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 63/121 (52%), Gaps = 8/121 (6%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++T      AAH+L       +C R+HGH++++E+ + G+     G + DF  ++Q  + 
Sbjct: 3   QVTVQVEIAAAHQLRDYE--GECARVHGHTWQIEVTVRGNDLDPQGMLIDFRKLKQLVNL 60

Query: 62  LLEKLDHHCLNEIEELEN--PTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
           ++   DH  LN++   +   PTAEN+A  I++ +   L      L  V V E+P +W  +
Sbjct: 61  VVAGYDHSLLNDVPPFDRVTPTAENLAKKIFEDIEARLEAPGVILEKVTVRESPRAWATF 120

Query: 116 Q 116
           +
Sbjct: 121 R 121


>gi|221219790|gb|ACM08556.1| 6-pyruvoyl tetrahydrobiopterin synthase [Salmo salar]
          Length = 204

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 39/131 (29%), Positives = 67/131 (51%), Gaps = 17/131 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+  +F A HRL               KC+    HGH+Y+ E+ + G +D  TG V + 
Sbjct: 74  ITRVQSFSACHRLHSPTLSDEVNKRIFGKCNNPNGHGHNYK-EVTVRGKIDRHTGMVMNI 132

Query: 53  FNIEQYFSPLLE-KLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVRVY 106
            +++Q+   ++   LDH  L+ ++    N   T EN+A++IW  +   L   +L  V+++
Sbjct: 133 TDLKQHIEEVIMIPLDHKNLDKDVPYFANVVSTTENVAVYIWDNMVKQLPANLLYEVKIH 192

Query: 107 ETPMSWVEYQG 117
           ET  + V Y+G
Sbjct: 193 ETDKNIVVYRG 203


>gi|304315892|ref|YP_003851037.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302777394|gb|ADL67953.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 123

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 45/119 (37%), Positives = 72/119 (60%), Gaps = 9/119 (7%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYF- 59
           MK+T+ FTF++AH L +     KC  +HGH+Y++E+ +EG V+ + G V DF  ++    
Sbjct: 1   MKVTKVFTFDSAHNLTKY--NGKCENLHGHTYKLEVTVEGSVNDE-GIVIDFAELKAIVE 57

Query: 60  SPLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVE 114
           + +++KLDH  LN++    N T ENI  W WK L   L      L S++++ETP ++ E
Sbjct: 58  NQVVKKLDHMYLNDVLGF-NTTCENIITWAWKILEPLLRTERYHLYSIKLWETPTNFAE 115


>gi|86130723|ref|ZP_01049323.1| 6-pyruvoyl tetrahydropterin synthase [Dokdonia donghaensis MED134]
 gi|85819398|gb|EAQ40557.1| 6-pyruvoyl tetrahydropterin synthase [Dokdonia donghaensis MED134]
          Length = 136

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 48/135 (35%), Positives = 72/135 (53%), Gaps = 18/135 (13%)

Query: 1   MKIT--QAFTFEAAHRLPRVPK--------THKCHRM--HGHSYRVELVMEGDVDPKTGF 48
           M+IT  +   F AAHRL R             KC     HGH+Y + + + G++D +TGF
Sbjct: 1   MRITAHRKAHFNAAHRLYRPDWNDEKNSQIFGKCSNPNFHGHNYDLTVSVTGEIDTETGF 60

Query: 49  VDDFFNIEQYFSPL-LEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSL--SILSS 102
           + D   ++        + LDH  LN E++E +  NPTAENIA+ I+ R+  +L       
Sbjct: 61  LIDLKILKDIIKAQVEDYLDHKNLNLEVQEFKELNPTAENIAVVIYNRIKKALEPKFDLE 120

Query: 103 VRVYETPMSWVEYQG 117
           V +YETP ++V Y+G
Sbjct: 121 VTLYETPRNFVTYKG 135


>gi|86158936|ref|YP_465721.1| 6-pyruvoyl tetrahydropterin synthase [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85775447|gb|ABC82284.1| 6-pyruvoyl tetrahydropterin synthase [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 138

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 63/124 (50%), Gaps = 11/124 (8%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I++ F F AAH++       KC R+HGH++RV +        + G V DF ++++  + 
Sbjct: 15  EISKDFVFSAAHQIR--FHGGKCERLHGHNWRVRVHARASTLNRIGMVIDFADLQKLVAE 72

Query: 62  LLEKLDHHCLNEIEEL--ENPTAENIAIWIWKRLSTSLSILS-------SVRVYETPMSW 112
           +  + DH  +NE+     EN TAE IA + ++ +S  L+ L         V V+E   S 
Sbjct: 73  VGSRFDHQNVNEVAPFDQENTTAELIARFFYREMSRRLAELEGGRVTVARVDVWENEGSL 132

Query: 113 VEYQ 116
             Y+
Sbjct: 133 AIYR 136


>gi|292669397|ref|ZP_06602823.1| 6-pyruvoyl tetrahydrobiopterin synthase [Selenomonas noxia ATCC
           43541]
 gi|292648958|gb|EFF66930.1| 6-pyruvoyl tetrahydrobiopterin synthase [Selenomonas noxia ATCC
           43541]
          Length = 126

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 41/116 (35%), Positives = 65/116 (56%), Gaps = 11/116 (9%)

Query: 9   FEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDH 68
           FEAAHR+   P   KC R+HGH++ VE   +G    + G + DF   ++  + +L+  DH
Sbjct: 10  FEAAHRVVNYP--GKCDRLHGHNWAVEATFQGTELDELGMLIDFKIAKKALAAVLDDFDH 67

Query: 69  HCLNEIEELE---NPTAENIAIWIWKRLSTSL------SILSSVRVYETPMSWVEY 115
           + LN+        NPTAEN+A  I++RL+         + L+++ V+E+P S V Y
Sbjct: 68  YYLNDFPPFSEGINPTAENLARIIFERLAARAEVQTSPAELTALTVWESPKSSVTY 123


>gi|7110709|ref|NP_035350.1| 6-pyruvoyl tetrahydrobiopterin synthase [Mus musculus]
 gi|24638151|sp|Q9R1Z7|PTPS_MOUSE RecName: Full=6-pyruvoyl tetrahydrobiopterin synthase; Short=PTP
           synthase; Short=PTPS
 gi|4105095|gb|AAD02249.1| 6-pyruvoyl-tetrahydropterin synthase [Mus musculus]
 gi|12832727|dbj|BAB22231.1| unnamed protein product [Mus musculus]
 gi|22137413|gb|AAH29013.1| 6-pyruvoyl-tetrahydropterin synthase [Mus musculus]
 gi|74150902|dbj|BAE27590.1| unnamed protein product [Mus musculus]
 gi|148693790|gb|EDL25737.1| 6-pyruvoyl-tetrahydropterin synthase, isoform CRA_b [Mus musculus]
          Length = 144

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 39/127 (30%), Positives = 69/127 (54%), Gaps = 16/127 (12%)

Query: 7   FTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDFFNIE 56
            +F A+HRL          +    KC+    HGH+Y+V + + G++DP TG V +  +++
Sbjct: 17  VSFSASHRLHSPSLSDEENLRVFGKCNNPNGHGHNYKVVVTVHGEIDPVTGMVMNLTDLK 76

Query: 57  QYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVRVYETPM 110
           +Y    +++ LDH  L+ ++    +   T EN+A++IW+ L   L    L  V+V+ET  
Sbjct: 77  EYMEEAIMKPLDHKNLDLDVPYFADAVSTTENVAVYIWESLQKLLPVGALYKVKVFETDN 136

Query: 111 SWVEYQG 117
           + V Y+G
Sbjct: 137 NIVVYKG 143


>gi|224083189|ref|XP_002192300.1| PREDICTED: 6-pyruvoyltetrahydropterin synthase [Taeniopygia
           guttata]
          Length = 147

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 66/132 (50%), Gaps = 16/132 (12%)

Query: 2   KITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDD 51
           +++++ TF A  RL          +    KC+    HGH+Y+V + + G++DP +G V +
Sbjct: 10  RLSRSVTFSACLRLRSKSLSDEENLKLFGKCNNPNGHGHNYKVVVTVRGEIDPVSGMVMN 69

Query: 52  FFNIEQYFSP-LLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSI--LSSVRV 105
              +++     ++E LDH  L+ ++        T ENIA++IW  L   L    L  V V
Sbjct: 70  LTELKELMQEAIMEPLDHKNLDKDVPYFSEVVSTTENIAVFIWDSLQKLLPQGILYKVEV 129

Query: 106 YETPMSWVEYQG 117
            ET  + V Y+G
Sbjct: 130 QETEQNVVVYKG 141


>gi|20808732|ref|NP_623903.1| 6-pyruvoyl-tetrahydropterin synthase [Thermoanaerobacter
           tengcongensis MB4]
 gi|20517374|gb|AAM25507.1| 6-pyruvoyl-tetrahydropterin synthase [Thermoanaerobacter
           tengcongensis MB4]
          Length = 122

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 46/119 (38%), Positives = 70/119 (58%), Gaps = 9/119 (7%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M++T+ FTF++AH L       KC  +HGH+YR+E+ +EG  D + G V DF  +++  +
Sbjct: 1   MRVTKIFTFDSAHNLVNY--HGKCEELHGHTYRLEVTVEGYPDEE-GMVLDFVKLKEIVN 57

Query: 61  PL-LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
              ++KLDH  LNE+    N T ENI +W+WK L   L      L  + ++ETP S+ E
Sbjct: 58  EKIIKKLDHKYLNEVLGF-NTTCENILLWMWKELEGELKGPNYKLYKLTLWETPTSFAE 115


>gi|255034280|ref|YP_003084901.1| hypothetical protein Dfer_0467 [Dyadobacter fermentans DSM 18053]
 gi|254947036|gb|ACT91736.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Dyadobacter fermentans DSM 18053]
          Length = 138

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 42/129 (32%), Positives = 67/129 (51%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           + +   F AAHRL               KC+    HGH+Y + + + G +DP+TG+V D 
Sbjct: 7   VFRKEHFNAAHRLHNPAWSDEQNEAVFGKCNNPSFHGHNYELIVQVTGPLDPETGYVMDM 66

Query: 53  FNIEQYFSPL-LEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLS--ILSSVRVY 106
             +        +++ DH  LN ++EE +  NPTAENIAI I+  +   +   +   +R+Y
Sbjct: 67  KLLSAILKESVIDRFDHRNLNLDVEEFKTLNPTAENIAIVIYSIIRPKIDAGLDLKIRLY 126

Query: 107 ETPMSWVEY 115
           ET  ++VEY
Sbjct: 127 ETERNFVEY 135


>gi|194760392|ref|XP_001962425.1| GF15457 [Drosophila ananassae]
 gi|190616122|gb|EDV31646.1| GF15457 [Drosophila ananassae]
          Length = 168

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 67/132 (50%), Gaps = 17/132 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T+  TF A HRL          +    KC+  HGH  +Y VE+ + G +D +TG V + 
Sbjct: 9   LTRRETFSACHRLHSPQLSDAENLEVFGKCNNFHGHGHNYTVEITVRGPIDQRTGMVLNI 68

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSI---LSSVRV 105
             ++      ++++LDH  L+ ++E       T EN+A++IW  +   L     L  V++
Sbjct: 69  TELKDAIETVIMKRLDHKNLDKDVEYFSKTPSTTENLAVYIWDNIRLQLKKPELLYEVKI 128

Query: 106 YETPMSWVEYQG 117
            ETP + + Y+G
Sbjct: 129 QETPKNIISYRG 140


>gi|268315767|ref|YP_003289486.1| hypothetical protein Rmar_0192 [Rhodothermus marinus DSM 4252]
 gi|262333301|gb|ACY47098.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Rhodothermus marinus DSM 4252]
          Length = 138

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 45/131 (34%), Positives = 73/131 (55%), Gaps = 16/131 (12%)

Query: 3   ITQAFTFEAAHRLPRV--------PKTHKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+   F AAHRL                C+    HGH+Y +E+ + G+ DP+TGFV + 
Sbjct: 6   VTRRVHFNAAHRLHNPARSEAWNRETFGPCNHPNWHGHNYVLEVTVAGEPDPETGFVLNL 65

Query: 53  FNIEQYFSPLL-EKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVRVY 106
            ++++     + +KLDH  LN +++ L+   PT EN+A+ IW+ L  +L    L  +R+Y
Sbjct: 66  SHLKEILETRILQKLDHKNLNLDVDFLQGVIPTTENLAVAIWRELEDALPAGRLHRIRLY 125

Query: 107 ETPMSWVEYQG 117
           ET  ++VEY G
Sbjct: 126 ETEHNYVEYYG 136


>gi|239618309|ref|YP_002941631.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Kosmotoga olearia TBF 19.5.1]
 gi|239507140|gb|ACR80627.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Kosmotoga olearia TBF 19.5.1]
          Length = 119

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 42/121 (34%), Positives = 70/121 (57%), Gaps = 10/121 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             IT+  TF+AAH L       KC ++HGH+YR+++ ++G+ D + G V DF  +++   
Sbjct: 2   FYITKEVTFDAAHNLTSY--HGKCEKLHGHTYRLQVTIKGEPDEE-GMVIDFAELKKVIK 58

Query: 61  PLL-EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEY 115
             + +KLDH  +N++  +  PTAE IA WI+  L   +      L  + ++ETP S+V Y
Sbjct: 59  EKILDKLDHSYINDL--IPQPTAEYIARWIFDELEPLVKTDKRKLFEIVLWETPTSFVRY 116

Query: 116 Q 116
           +
Sbjct: 117 R 117


>gi|120436707|ref|YP_862393.1| tetrahydrobiopterin biosynthesis-like protein [Gramella forsetii
           KT0803]
 gi|117578857|emb|CAL67326.1| conserved tetrahydrobiopterin biosynthesis-like protein [Gramella
           forsetii KT0803]
          Length = 136

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 50/135 (37%), Positives = 72/135 (53%), Gaps = 18/135 (13%)

Query: 1   MKIT--QAFTFEAAHRLPRVPKT--------HKCHR--MHGHSYRVELVMEGDVDPKTGF 48
           M+IT  +   F AAHRL R             KC     HGH+Y + + + G+ DP+TGF
Sbjct: 1   MRITVHRKAHFNAAHRLYRKDWDDERNFGVFGKCSNPHYHGHNYELIVSVTGEPDPETGF 60

Query: 49  VDDFFNIEQYFS-PLLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSILS--S 102
           V D   +++     + E  DH  LN E+ E E+  PTAE+IA+ IW +L T +       
Sbjct: 61  VMDLKILKELIYLEVEEAFDHKNLNVEVPEFEDLIPTAEHIAVVIWNKLRTRIQEDHDLK 120

Query: 103 VRVYETPMSWVEYQG 117
           V +YETP ++V Y+G
Sbjct: 121 VTLYETPRNFVSYKG 135


>gi|91216574|ref|ZP_01253540.1| putative 6-pyruvoyl tetrahydropterin synthase [Psychroflexus
           torquis ATCC 700755]
 gi|91185368|gb|EAS71745.1| putative 6-pyruvoyl tetrahydropterin synthase [Psychroflexus
           torquis ATCC 700755]
          Length = 136

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 50/135 (37%), Positives = 73/135 (54%), Gaps = 18/135 (13%)

Query: 1   MKIT--QAFTFEAAHRLPRVPKT--------HKCHRMH--GHSYRVELVMEGDVDPKTGF 48
           MK+T  +   F AAHRL R             KC+  H  GH+Y +   + GD+DP+TG+
Sbjct: 1   MKVTVHRKAHFNAAHRLYRKDWDFEKNNKVFGKCNNPHFHGHNYELIASVTGDIDPETGY 60

Query: 49  VDDFFNIEQYFS-PLLEKLDHHCLNE-IEELE--NPTAENIAIWIWKRLSTSLSILS--S 102
           V D   ++      + +  DH  LNE + E +  NPTAENI++ IW +L T L+      
Sbjct: 61  VIDIKVLKDMIKTEVEDAFDHKNLNEQVPEFKDLNPTAENISVVIWNKLKTKLNKNHDLE 120

Query: 103 VRVYETPMSWVEYQG 117
           V +YETP ++V Y+G
Sbjct: 121 VTLYETPRNFVTYKG 135


>gi|332521029|ref|ZP_08397489.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Lacinutrix algicola 5H-3-7-4]
 gi|332043559|gb|EGI79755.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Lacinutrix algicola 5H-3-7-4]
          Length = 135

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 44/135 (32%), Positives = 70/135 (51%), Gaps = 18/135 (13%)

Query: 1   MKIT--QAFTFEAAHRLPRVPK--------THKCHR--MHGHSYRVELVMEGDVDPKTGF 48
           MK+T  +   F AAHRL R             KC+    HGH+Y +   + G++D +TG+
Sbjct: 1   MKVTVSRRAHFNAAHRLYRKDWSETKNNAVFGKCNNPNYHGHNYELIASVTGNIDQETGY 60

Query: 49  VDDFFNIEQYFS-PLLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLS--ILSS 102
           V D   ++Q     + +  DH  LN ++ E +  NPTAENI + I+ ++   L   +   
Sbjct: 61  VIDMKVLKQIIKTEIEDAFDHKNLNLDVPEFKTLNPTAENIVVIIYNKIKAKLESHLDLE 120

Query: 103 VRVYETPMSWVEYQG 117
           + +YETP ++V Y G
Sbjct: 121 ITLYETPRNFVTYSG 135


>gi|163755850|ref|ZP_02162968.1| 6-pyruvoyl tetrahydrobiopterin synthase [Kordia algicida OT-1]
 gi|161324371|gb|EDP95702.1| 6-pyruvoyl tetrahydrobiopterin synthase [Kordia algicida OT-1]
          Length = 136

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 45/131 (34%), Positives = 71/131 (54%), Gaps = 16/131 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHR--MHGHSYRVELVMEGDVDPKTGFVDDF 52
           +++   F AAHRL R             KC+    HGH+Y + + + G ++P+TGFV D 
Sbjct: 5   VSRRAHFNAAHRLYRPDWDDAKNNEIFGKCNNPNYHGHNYELIVSVTGPINPETGFVMDV 64

Query: 53  FNIEQYFS-PLLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSL--SILSSVRVY 106
             ++      + +  DH  LN ++ E +  NPTAENI + IW +L T +  S+   V +Y
Sbjct: 65  KVLKDLIRSEVEDAFDHKNLNLDVPEFKNLNPTAENIVVVIWNKLRTHISTSLDLEVVLY 124

Query: 107 ETPMSWVEYQG 117
           ETP ++V+Y G
Sbjct: 125 ETPRNFVKYTG 135


>gi|116620168|ref|YP_822324.1| putative 6-pyruvoyl tetrahydropterin synthase [Candidatus
           Solibacter usitatus Ellin6076]
 gi|116223330|gb|ABJ82039.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Candidatus Solibacter usitatus Ellin6076]
          Length = 124

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 65/123 (52%), Gaps = 9/123 (7%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++T   TF A H L       KC  +HGH+YR ++ +EG+     G + DF  +++   
Sbjct: 2   FEVTIEETFAAGHALRNYK--GKCENVHGHNYRCQVTLEGEQLDSIGLLVDFVELKRVVH 59

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLS-----ILSSVRVYETPMSWV 113
            +L+++DH  LNE    +  NP+AEN+A +I+  +   L       ++ VR++ET  +  
Sbjct: 60  SVLDRMDHQWLNEFPPFDVLNPSAENMAKYIYDEVKGGLKTAEGVRIAMVRLWETDTAHA 119

Query: 114 EYQ 116
            Y+
Sbjct: 120 TYR 122


>gi|306833727|ref|ZP_07466853.1| 6-pyruvoyltetrahydropterin synthase [Streptococcus bovis ATCC
           700338]
 gi|304424064|gb|EFM27204.1| 6-pyruvoyltetrahydropterin synthase [Streptococcus bovis ATCC
           700338]
          Length = 148

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 45/120 (37%), Positives = 70/120 (58%), Gaps = 9/120 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+YR+++ + G +    G   DF +++Q +   
Sbjct: 25  VSKEFTFDAAHHLFNYD--GKCKALHGHTYRLQIAVSG-LLDDRGMAVDFGDLKQIYKKH 81

Query: 63  LEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI-----LSSVRVYETPMSWVEYQ 116
           LE  LDHH LNE     N TAEN+  WI+K+++  L       +  VR+YETP S+ E++
Sbjct: 82  LEPSLDHHYLNESLPYMNTTAENMVYWIFKQVAQYLPKEREIRVEYVRLYETPTSFAEFR 141


>gi|187777938|ref|ZP_02994411.1| hypothetical protein CLOSPO_01530 [Clostridium sporogenes ATCC
           15579]
 gi|187774866|gb|EDU38668.1| hypothetical protein CLOSPO_01530 [Clostridium sporogenes ATCC
           15579]
          Length = 117

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 46/122 (37%), Positives = 67/122 (54%), Gaps = 10/122 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M + + F F+AAH L       KC R+HGH+Y + + + G+ D +   V DF  ++    
Sbjct: 1   MILIKKFKFDAAHNLIHY--HGKCERLHGHTYGLVIKISGEPDKED-MVIDFTELKAIVK 57

Query: 61  PLL-EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
             + + LDH  +NEI  ++ PTAENIA+WIW +L T L      L  + V+ET  S V Y
Sbjct: 58  ENVLDILDHAYINEI--IKQPTAENIAVWIWDKLYTKLKRDNCSLYEIEVWETETSGVVY 115

Query: 116 QG 117
            G
Sbjct: 116 SG 117


>gi|197121749|ref|YP_002133700.1| queuosine biosynthesis protein QueD [Anaeromyxobacter sp. K]
 gi|220916543|ref|YP_002491847.1| queuosine biosynthesis protein QueD [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|196171598|gb|ACG72571.1| queuosine biosynthesis protein QueD [Anaeromyxobacter sp. K]
 gi|219954397|gb|ACL64781.1| queuosine biosynthesis protein QueD [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 130

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 64/124 (51%), Gaps = 11/124 (8%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I++ F F AAH++       KC R+HGH++RV +        + G V DF ++++  + 
Sbjct: 7   EISKDFVFSAAHQIR--FHGGKCERLHGHNWRVRVHARASTLNRIGMVIDFADLQRLVAE 64

Query: 62  LLEKLDHHCLNEIEEL--ENPTAENIAIWIWKRLSTSLSIL-------SSVRVYETPMSW 112
           +  + DH  +NE+     EN TAE +A + ++ +S  L+ L       S V V+E   S 
Sbjct: 65  VGSRFDHQNVNEVAPFDQENTTAELLARFFYQEMSRRLADLEGGRVTVSRVDVWENEGSL 124

Query: 113 VEYQ 116
             Y+
Sbjct: 125 AVYR 128


>gi|150025836|ref|YP_001296662.1| 6-pyruvoyltetrahydrobiopterin synthase [Flavobacterium
           psychrophilum JIP02/86]
 gi|149772377|emb|CAL43857.1| Probable 6-pyruvoyltetrahydrobiopterin synthase [Flavobacterium
           psychrophilum JIP02/86]
          Length = 136

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 44/131 (33%), Positives = 68/131 (51%), Gaps = 16/131 (12%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           I++   F AAHRL R             KC+    HGH+Y + + + G +DP+TG+V D 
Sbjct: 5   ISRKAHFNAAHRLYRKDWTFEKNDAVFGKCNNPNFHGHNYDLTVSVTGKIDPETGYVIDV 64

Query: 53  FNIEQYFSPL-LEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSIL--SSVRVY 106
             +         +K DH  LN ++ E +  NPTAENI + IW ++   ++      V +Y
Sbjct: 65  KLLSDIIKEEIEDKFDHKNLNLDVPEFQDLNPTAENIVVVIWNKIRKRINPDMSLEVILY 124

Query: 107 ETPMSWVEYQG 117
           ETP ++V Y+G
Sbjct: 125 ETPRNFVTYKG 135


>gi|289207599|ref|YP_003459665.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thioalkalivibrio sp. K90mix]
 gi|288943230|gb|ADC70929.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thioalkalivibrio sp. K90mix]
          Length = 127

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 35/113 (30%), Positives = 61/113 (53%), Gaps = 8/113 (7%)

Query: 9   FEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDH 68
           F +AH L   P   +C  MHGH+++VE  ++ +     G   DF  ++     +  +LDH
Sbjct: 13  FASAHTLRDYP--GQCANMHGHNWKVEAEVQAETLDDAGMAVDFKVVKTAAREIAGQLDH 70

Query: 69  HCLNEIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEY 115
             LN++   +  NPTAENIA W ++++S  L+     + ++ ++ET  + V Y
Sbjct: 71  RYLNDVPPFDTVNPTAENIAQWFFRQMSERLNRPGLRMHALTLWETDRACVRY 123


>gi|206901173|ref|YP_002250341.1| 6-pyruvoyl-tetrahydropterin synthase [Dictyoglomus thermophilum
           H-6-12]
 gi|206740276|gb|ACI19334.1| 6-pyruvoyl-tetrahydropterin synthase [Dictyoglomus thermophilum
           H-6-12]
          Length = 125

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 49/122 (40%), Positives = 73/122 (59%), Gaps = 10/122 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYF- 59
           M + + F F+AAH L       KC R+HGH+YR+ +++EG  D + G + DF  ++    
Sbjct: 1   MFVIRKFKFDAAHNLESYK--GKCERLHGHTYRLVVIVEGIPDSE-GMIIDFVELKDIVK 57

Query: 60  SPLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
             +++ LDH  +NEI  ++ PTAENIAIWIW+RL   L      L  ++V+ET  S V Y
Sbjct: 58  REVIDILDHSYINEI--IKQPTAENIAIWIWQRLEEKLKRGNCHLYEIQVWETEDSGVIY 115

Query: 116 QG 117
           +G
Sbjct: 116 RG 117


>gi|254448310|ref|ZP_05061772.1| probable 6-pyruvoyltetrahydrobiopterin synthase [gamma
           proteobacterium HTCC5015]
 gi|198262177|gb|EDY86460.1| probable 6-pyruvoyltetrahydrobiopterin synthase [gamma
           proteobacterium HTCC5015]
          Length = 332

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 47/114 (41%), Positives = 67/114 (58%), Gaps = 8/114 (7%)

Query: 4   TQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLL 63
            + + FEAAH LP VP+ HKC R+HGH + V L+                ++++++ PL 
Sbjct: 102 WRRYRFEAAHFLPNVPEGHKCGRLHGHGFEVTLLA--------PLRWSAESLDEHWQPLY 153

Query: 64  EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           E+L  HCLN I  LENPT+E +A WIW++L  S++ L SV V ET  +   Y G
Sbjct: 154 ERLHGHCLNRIVGLENPTSEVLAEWIWRQLIDSITDLLSVDVRETVTAGCRYDG 207



 Score = 76.0 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 36/113 (31%), Positives = 56/113 (49%), Gaps = 6/113 (5%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I +    E A +L    +        GHSYRV L +E  +D   G+  D+ +++  F P
Sbjct: 211 RIWKQQEAECAVQLAGFDEPM------GHSYRVRLHLEAPLDKVMGWTQDYGDVKTQFQP 264

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVE 114
           L  +LDHHCLNEI     P+   +A W+ + L  +L  L+ + V+ TP     
Sbjct: 265 LYRQLDHHCLNEILPSGEPSDLAVAEWLRQGLGEALPALNRIDVHSTPEEGAI 317


>gi|258511916|ref|YP_003185350.1| hypothetical protein Aaci_1949 [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257478642|gb|ACV58961.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Alicyclobacillus acidocaldarius subsp. acidocaldarius
           DSM 446]
          Length = 155

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 43/121 (35%), Positives = 67/121 (55%), Gaps = 12/121 (9%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +T+ FTF+AAH L       KC  +HGH+Y++ + + G V    G V DF ++++ F  +
Sbjct: 31  VTKEFTFDAAHHLHAYD--GKCANLHGHTYKLVITVSGRV-NDIGIVVDFGDLKRLFDEV 87

Query: 63  LE-KLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS--------ILSSVRVYETPMSWV 113
           ++ +LDH  LNE+    N TAEN+ +WIW+ L  +L          L  + +YETP S  
Sbjct: 88  IKRRLDHQYLNEVLPPMNTTAENMIVWIWEELERALEAYGRDRDVRLERLELYETPTSRA 147

Query: 114 E 114
            
Sbjct: 148 S 148


>gi|89890643|ref|ZP_01202153.1| 6-pyruvoyl-tetrahydropterin synthase [Flavobacteria bacterium
           BBFL7]
 gi|89517558|gb|EAS20215.1| 6-pyruvoyl-tetrahydropterin synthase [Flavobacteria bacterium
           BBFL7]
          Length = 136

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 46/135 (34%), Positives = 70/135 (51%), Gaps = 18/135 (13%)

Query: 1   MKIT--QAFTFEAAHRLPRVPK--------THKCHRM--HGHSYRVELVMEGDVDPKTGF 48
           M IT  +   F AAHRL R             KC+    HGH+Y +E+ + G VDP+TG+
Sbjct: 1   MIITAYRKAHFNAAHRLHRSDWSDQKNAAIFGKCNNPNFHGHNYNLEVGVTGKVDPETGY 60

Query: 49  VDDFFNIEQYFS-PLLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSILS--S 102
           + D   ++      + +  DH  LN E+ E +  NPTAENIA  I+ ++   L       
Sbjct: 61  LIDLKILKDVIKSEVEDAFDHKNLNVEVPEFKTLNPTAENIAYVIYNKIKAKLDSKYDIE 120

Query: 103 VRVYETPMSWVEYQG 117
           +++YET  ++V Y+G
Sbjct: 121 IKLYETERNFVVYKG 135


>gi|148654865|ref|YP_001275070.1| putative 6-pyruvoyl tetrahydropterin synthase [Roseiflexus sp.
           RS-1]
 gi|148566975|gb|ABQ89120.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Roseiflexus sp. RS-1]
          Length = 275

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/130 (31%), Positives = 63/130 (48%), Gaps = 16/130 (12%)

Query: 4   TQAFTFEAAHRLPRVPK--------THKCHRM--HGHSYRVELVMEGDVDPKTGFVDDFF 53
           T+ F F AAHR  R              C     HGH+Y +++ + G++DP+TG V +  
Sbjct: 5   TRRFEFSAAHRYWRPDWSAEENERVFGPCAYPYGHGHNYTLDVTITGELDPRTGMVMNMT 64

Query: 54  NIEQYFSPLLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS---ILSSVRVYE 107
            ++   S +L + DH  LN +     +  PT ENI   +W+ ++  L     L  +R+YE
Sbjct: 65  ELKSLVSEVLNEFDHKHLNEDTPYFRDQLPTTENIVRVLWRLIAARLPVAARLVRLRLYE 124

Query: 108 TPMSWVEYQG 117
           T   W EY G
Sbjct: 125 TGDLWAEYDG 134



 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 41/127 (32%), Positives = 66/127 (51%), Gaps = 14/127 (11%)

Query: 5   QAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDFFN 54
           + +TF AAHRL          +    KC+    HGH+Y +E+ + G VDP TG V D   
Sbjct: 142 RVYTFSAAHRLHSPLLSDEENLAIYGKCNNPNGHGHTYTLEVSVAGPVDPDTGMVIDLAT 201

Query: 55  IEQYFSPLLEKLDHHCLN-EIEEL--ENPTAENIAIWIWKRLSTSLS-ILSSVRVYETPM 110
           +++    +L+++D+  L+ EI     +  TAENI I++W  L+      L  + ++ET  
Sbjct: 202 MDRTVRSVLDRIDYRHLDREIAAFATKPSTAENIVIYLWDELAPRFEGRLRHLTLWETRK 261

Query: 111 SWVEYQG 117
           +  EY G
Sbjct: 262 NVFEYAG 268


>gi|195443380|ref|XP_002069395.1| GK18684 [Drosophila willistoni]
 gi|194165480|gb|EDW80381.1| GK18684 [Drosophila willistoni]
          Length = 168

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 69/132 (52%), Gaps = 17/132 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T+  TF A HRL          +    KC+  HGH  +Y VE+ + G +D +TG V + 
Sbjct: 9   LTRRETFSACHRLHSPQLSDAENLEVFGKCNNFHGHGHNYTVEITVRGPIDSRTGMVLNI 68

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSI---LSSVRV 105
             +++     ++++LDH  L+ ++E       T EN+A++IW  +   L     L  V++
Sbjct: 69  TELKEAIETVIMKRLDHKNLDKDVEYFAKTPSTTENLAVYIWDNIRLQLKKPELLYEVKI 128

Query: 106 YETPMSWVEYQG 117
           +ETP + + Y+G
Sbjct: 129 HETPKNIITYRG 140


>gi|154250445|ref|YP_001411270.1| putative 6-pyruvoyl tetrahydropterin synthase [Fervidobacterium
           nodosum Rt17-B1]
 gi|154154381|gb|ABS61613.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Fervidobacterium nodosum Rt17-B1]
          Length = 118

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 48/119 (40%), Positives = 75/119 (63%), Gaps = 10/119 (8%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTF+AAH L  V    KC ++HGH+Y++++++ G+ D + G V DF ++++     
Sbjct: 4   VVKEFTFDAAHNL--VEYHGKCEKLHGHTYKLQIMVCGERDKE-GMVIDFIDLKKIVQEE 60

Query: 63  L-EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEYQ 116
           +   LDH  +NEI  +  P+AENIA WIW +L   LS     LS VR++ETP S+V Y+
Sbjct: 61  VLSYLDHAYINEI--IPQPSAENIAEWIWNKLEEKLSSERYKLSEVRLWETPTSFVIYR 117


>gi|260798572|ref|XP_002594274.1| hypothetical protein BRAFLDRAFT_275566 [Branchiostoma floridae]
 gi|229279507|gb|EEN50285.1| hypothetical protein BRAFLDRAFT_275566 [Branchiostoma floridae]
          Length = 150

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/131 (29%), Positives = 69/131 (52%), Gaps = 16/131 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +++  +F A+HRL          +    KC+    HGH+Y+VE+ +  +VDP TG   + 
Sbjct: 19  LSRIESFSASHRLHSNQLSDEDNLRIFGKCNNPNGHGHNYKVEVTLRKEVDPVTGMAMNL 78

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI--LSSVRVY 106
            +++      ++E LDH  L+ ++   ++   T EN+AI+IW  +   L    L  V+++
Sbjct: 79  VDLKGIMQRAIMEPLDHKNLDKDVPYFQSLVSTTENVAIYIWDNMVNLLPEGSLYEVKIH 138

Query: 107 ETPMSWVEYQG 117
           ET  + V Y+G
Sbjct: 139 ETDKNIVCYRG 149


>gi|146298032|ref|YP_001192623.1| putative 6-pyruvoyl tetrahydropterin synthase [Flavobacterium
           johnsoniae UW101]
 gi|146152450|gb|ABQ03304.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Flavobacterium johnsoniae UW101]
          Length = 136

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 45/131 (34%), Positives = 67/131 (51%), Gaps = 16/131 (12%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           I++   F AAHRL R             KC+    HGH+Y + + + G +DP+TGFV D 
Sbjct: 5   ISRKAHFNAAHRLHRKDWSLEKNNAVFGKCNNPNFHGHNYGLTVSVTGKIDPETGFVLDV 64

Query: 53  FNIEQYFSPLLE-KLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSI--LSSVRVY 106
             +       +E   DH  LN ++ E +  NPTAENIA+ IW ++   +       V +Y
Sbjct: 65  KVLADIILEEVEIPFDHKNLNLDVPEFQDLNPTAENIAVVIWNKIRKRIQPDFDLEVVLY 124

Query: 107 ETPMSWVEYQG 117
           ET  ++V Y+G
Sbjct: 125 ETDRNFVTYKG 135


>gi|195161773|ref|XP_002021736.1| GL26673 [Drosophila persimilis]
 gi|198472898|ref|XP_002133137.1| GA29012 [Drosophila pseudoobscura pseudoobscura]
 gi|194103536|gb|EDW25579.1| GL26673 [Drosophila persimilis]
 gi|198139211|gb|EDY70539.1| GA29012 [Drosophila pseudoobscura pseudoobscura]
          Length = 168

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 67/132 (50%), Gaps = 17/132 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+  TF A HRL          +    KC+    HGH+Y VE+ + G +D +TG V + 
Sbjct: 9   LTRRETFSACHRLHSPQLTDAENLEVFGKCNNFNGHGHNYTVEITVRGPIDQRTGMVLNI 68

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSI---LSSVRV 105
             ++      +++ LDH  L+ ++E       T EN+A++IW  +   L     L  V++
Sbjct: 69  TELKDAIEAVIMKNLDHKNLDKDVEYFAKTPSTTENLAVYIWNNIRLQLKKPELLYEVKI 128

Query: 106 YETPMSWVEYQG 117
           +ETP + + Y+G
Sbjct: 129 HETPKNIISYRG 140


>gi|289579204|ref|YP_003477831.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermoanaerobacter italicus Ab9]
 gi|289528917|gb|ADD03269.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermoanaerobacter italicus Ab9]
          Length = 122

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 47/119 (39%), Positives = 71/119 (59%), Gaps = 9/119 (7%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MK+T+ FTF++AH L       KC  +HGH+Y++E+ +EG  D + G V DF  +++  +
Sbjct: 1   MKVTKIFTFDSAHNLVNY--NGKCEELHGHTYKLEVTVEGKPDGE-GMVIDFVKLKEIVN 57

Query: 61  PL-LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
              ++KLDH  LNE+    N T ENI +W+WK L   L      L  +R++ETP S+ E
Sbjct: 58  EKVVKKLDHKYLNEVLGF-NTTCENILLWMWKELEAVLKGDNYHLYKLRLWETPTSFTE 115


>gi|225710240|gb|ACO10966.1| 6-pyruvoyl tetrahydrobiopterin synthase [Caligus rogercresseyi]
          Length = 140

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/134 (30%), Positives = 67/134 (50%), Gaps = 19/134 (14%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+   F AAHRL               KC+    HGH+Y +E+ +  +  PKTGFV + 
Sbjct: 5   LTRREHFCAAHRLHSDSLTSEENQELFGKCNNPNGHGHNYNMEITVSSEPCPKTGFVMNL 64

Query: 53  FNIEQYFSPLLEK-LDHHCLN-EIEELEN----PTAENIAIWIWKRLSTSLSI---LSSV 103
            ++++  +  + + LDH  ++ ++          TAENIAI+IW  L+        L  V
Sbjct: 65  VDLKELIATHVLRTLDHRNIDLDVPYFAQGKKTSTAENIAIYIWDCLNPHFGDGVSLYEV 124

Query: 104 RVYETPMSWVEYQG 117
           R++ET  + V Y+G
Sbjct: 125 RLWETEKNSVAYRG 138


>gi|148922917|ref|NP_001092237.1| 6-pyruvoyl tetrahydrobiopterin synthase [Danio rerio]
 gi|148745615|gb|AAI42596.1| Pts protein [Danio rerio]
          Length = 139

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/131 (29%), Positives = 67/131 (51%), Gaps = 16/131 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+  +F A HRL               KC+    HGH+Y VE+ + G +D  TG V + 
Sbjct: 8   ITRVCSFSACHRLHSKCLSDEENKRTFGKCNNPNGHGHNYTVEVTVRGKIDKNTGMVMNL 67

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVRVY 106
            +++++    +++ LDH  L+ ++    +   T EN++++IW  L   L    L  ++VY
Sbjct: 68  TDLKEFIEEAVMKPLDHKNLDLDVPYFADVVSTTENLSVFIWDGLQKLLPHDSLYEIKVY 127

Query: 107 ETPMSWVEYQG 117
           ET  + V Y+G
Sbjct: 128 ETAKNIVIYRG 138


>gi|291486761|dbj|BAI87830.1| 6-pyruvoyl-tetrahydropterin synthase [Papilio xuthus]
          Length = 166

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 42/132 (31%), Positives = 68/132 (51%), Gaps = 17/132 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+  TF + HRL               KC+    HGH+Y V + ++G VDP TG V + 
Sbjct: 9   ITRRETFSSCHRLHSPFLSDEDNKKLYGKCNNPNGHGHNYVVLVTVKGPVDPHTGMVMNV 68

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSI---LSSVRV 105
            +++Q+    ++E LDH  L+ ++   +    T EN+AI+IW +L   +     L  V++
Sbjct: 69  HDLKQFMQKAIMEPLDHKNLDQDVPYFKAVVSTTENLAIFIWDQLQKIMDKPQLLHEVKI 128

Query: 106 YETPMSWVEYQG 117
            ET  + V Y+G
Sbjct: 129 LETEKNHVVYRG 140


>gi|306831582|ref|ZP_07464740.1| 6-pyruvoyltetrahydropterin synthase [Streptococcus gallolyticus
           subsp. gallolyticus TX20005]
 gi|325978488|ref|YP_004288204.1| 6-pyruvoyl tetrahydrobiopterin synthase [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
 gi|304426367|gb|EFM29481.1| 6-pyruvoyltetrahydropterin synthase [Streptococcus gallolyticus
           subsp. gallolyticus TX20005]
 gi|325178416|emb|CBZ48460.1| 6-pyruvoyl tetrahydrobiopterin synthase [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
          Length = 148

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 44/120 (36%), Positives = 69/120 (57%), Gaps = 9/120 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y +++ + G +    G   DF +++Q +   
Sbjct: 25  VSKEFTFDAAHHLFNYD--GKCKALHGHTYCLQIAVSG-LLDDRGMAVDFGDLKQIYKKH 81

Query: 63  LEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI-----LSSVRVYETPMSWVEYQ 116
           LE  LDHH LNE     N TAEN+  WI+K+++  L       +  VR+YETP S+ E++
Sbjct: 82  LEPSLDHHYLNESLPYMNTTAENMVYWIFKQVAQHLPKEREIRVEYVRLYETPTSFAEFR 141


>gi|325954168|ref|YP_004237828.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Weeksella virosa DSM 16922]
 gi|323436786|gb|ADX67250.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Weeksella virosa DSM 16922]
          Length = 136

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/135 (35%), Positives = 70/135 (51%), Gaps = 18/135 (13%)

Query: 1   MKIT--QAFTFEAAHRLPRVPK--------THKCHR--MHGHSYRVELVMEGDVDPKTGF 48
           MK+T  +   F AAHRL               KC     HGH+Y + + + GD+DP TGF
Sbjct: 1   MKVTVNRKAHFNAAHRLYNPKWTDEKNREIFGKCSNPNYHGHNYELIVSVRGDIDPDTGF 60

Query: 49  VDDFFNIEQYFS-PLLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSI--LSS 102
           V +  ++ +     + + LDH  LN +I + +  NPTAENI I I+ R+   L       
Sbjct: 61  VMNLDDLRKIIEVEVEDYLDHKNLNLDIVDFQNLNPTAENIVIIIYNRIRAKLENHLDLK 120

Query: 103 VRVYETPMSWVEYQG 117
           V ++ETP ++VEY G
Sbjct: 121 VTLFETPRNFVEYSG 135


>gi|295695133|ref|YP_003588371.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Bacillus tusciae DSM 2912]
 gi|295410735|gb|ADG05227.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Bacillus tusciae DSM 2912]
          Length = 144

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 44/121 (36%), Positives = 71/121 (58%), Gaps = 13/121 (10%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + FTF+AAHRL       KC ++HGH+YR+E+ ++G  DP+ G V DF  I+     +
Sbjct: 16  VVKQFTFDAAHRLEAYE--GKCAQLHGHTYRLEVEIKGHPDPR-GLVIDFNEIKALVERV 72

Query: 63  L-EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI--------LSSVRVYETPMSWV 113
           + E+ DH  LN+     N TAEN+ +++++ L+ +L          L  VR++ETP S+ 
Sbjct: 73  VLERFDHRYLNDEVPF-NTTAENLVVFLYEELAKALRQTPRATDVNLERVRLWETPTSYA 131

Query: 114 E 114
           E
Sbjct: 132 E 132


>gi|168178225|ref|ZP_02612889.1| putative 6-pyruvoyl tetrahydropterin synthase [Clostridium
           botulinum NCTC 2916]
 gi|168184047|ref|ZP_02618711.1| queuosine biosynthesis protein QueD [Clostridium botulinum Bf]
 gi|237794117|ref|YP_002861669.1| putative 6-pyruvoyl tetrahydropterin synthase [Clostridium
           botulinum Ba4 str. 657]
 gi|182671450|gb|EDT83424.1| putative 6-pyruvoyl tetrahydropterin synthase [Clostridium
           botulinum NCTC 2916]
 gi|182672850|gb|EDT84811.1| queuosine biosynthesis protein QueD [Clostridium botulinum Bf]
 gi|229263592|gb|ACQ54625.1| putative 6-pyruvoyl tetrahydropterin synthase [Clostridium
           botulinum Ba4 str. 657]
          Length = 117

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 46/122 (37%), Positives = 67/122 (54%), Gaps = 10/122 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M + + F F+AAH L       KC R+HGH+Y + + + G+ D +   V DF  ++    
Sbjct: 1   MILIKKFKFDAAHNLIHY--HGKCERLHGHTYGLVIKISGEPDKED-MVIDFTELKAIVK 57

Query: 61  PLL-EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
             + + LDH  +N+I  +E PTAENIA+WIW +L T L      L  + V+ET  S V Y
Sbjct: 58  ENVLDILDHAYINDI--IEQPTAENIAVWIWNKLYTKLKRDNCSLYEIEVWETETSGVVY 115

Query: 116 QG 117
            G
Sbjct: 116 NG 117


>gi|148378819|ref|YP_001253360.1| putative 6-pyruvoyl tetrahydropterin synthase [Clostridium
           botulinum A str. ATCC 3502]
 gi|153934004|ref|YP_001383205.1| putative 6-pyruvoyl tetrahydropterin synthase [Clostridium
           botulinum A str. ATCC 19397]
 gi|153934509|ref|YP_001386754.1| putative 6-pyruvoyl tetrahydropterin synthase [Clostridium
           botulinum A str. Hall]
 gi|148288303|emb|CAL82380.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Clostridium
           botulinum A str. ATCC 3502]
 gi|152930048|gb|ABS35548.1| queuosine biosynthesis protein QueD [Clostridium botulinum A str.
           ATCC 19397]
 gi|152930423|gb|ABS35922.1| queuosine biosynthesis protein QueD [Clostridium botulinum A str.
           Hall]
          Length = 117

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 46/122 (37%), Positives = 67/122 (54%), Gaps = 10/122 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M + + F F+AAH L       KC R+HGH+Y + + + G+ D +   V DF  ++    
Sbjct: 1   MILIKKFKFDAAHNLIHY--HGKCERLHGHTYGLVIKISGERDKED-MVIDFTELKAIVK 57

Query: 61  PLL-EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
             + + LDH  +N+I  +E PTAENIA+WIW +L T L      L  + V+ET  S V Y
Sbjct: 58  ENVLDILDHAYINDI--IEQPTAENIAVWIWDKLYTKLKRDNCSLYEIEVWETETSGVVY 115

Query: 116 QG 117
            G
Sbjct: 116 NG 117


>gi|150021138|ref|YP_001306492.1| putative 6-pyruvoyl tetrahydropterin synthase [Thermosipho
           melanesiensis BI429]
 gi|149793659|gb|ABR31107.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermosipho melanesiensis BI429]
          Length = 120

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 47/120 (39%), Positives = 73/120 (60%), Gaps = 10/120 (8%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +T+ FTF+AAH L +     KC ++HGH+Y++ + + G  D + G V DF  +++     
Sbjct: 4   VTKEFTFDAAHNLIKY--HGKCEKLHGHTYKLLVTVAGKKDEE-GMVIDFLELKKIVKEN 60

Query: 63  L-EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEYQG 117
           +   LDH  +NEI  +E P+AENIA WIW+RL   L+     L  +++YETP S+V  +G
Sbjct: 61  VLNILDHSYINEI--IEQPSAENIAEWIWERLKEKLNTERYFLYEIKLYETPTSYVTLRG 118


>gi|320108731|ref|YP_004184321.1| hypothetical protein AciPR4_3574 [Terriglobus saanensis SP1PR4]
 gi|319927252|gb|ADV84327.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Terriglobus saanensis SP1PR4]
          Length = 125

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/125 (31%), Positives = 61/125 (48%), Gaps = 11/125 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++T   TF + H L       KC   HGH+Y+V + + G     +G + DF  ++Q   
Sbjct: 2   FEVTVEATFSSGHYLRNY--RGKCENPHGHNYKVLVTLVGKELDASGLLLDFKLLKQVMR 59

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLSILSSVRV-------YETPMS 111
           P+++ LDH  +N++E     NP+AEN+A + +   S  L  +S  RV       YET  S
Sbjct: 60  PVVDYLDHQMINDLEPFTTVNPSAENLAKYFFDETSKQLFEMSEGRVSVKQSTIYETDTS 119

Query: 112 WVEYQ 116
              Y 
Sbjct: 120 MATYY 124


>gi|114328968|ref|YP_746125.1| queuosine biosynthesis protein queD [Granulibacter bethesdensis
           CGDNIH1]
 gi|114317142|gb|ABI63202.1| queuosine biosynthesis protein queD [Granulibacter bethesdensis
           CGDNIH1]
          Length = 130

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/105 (42%), Positives = 67/105 (63%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I + FTFEAAH L R  +T    R+HGHSYRVE+V+ G VDP +G + D   +++  + 
Sbjct: 13  EIGKQFTFEAAHTLHREIETDSSLRIHGHSYRVEVVLRGGVDPDSGMLMDLGLLQRKMNA 72

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVY 106
           + + LDH  L+E+  L   T ENIA++IW+ L+  L  L+ V V+
Sbjct: 73  VRDALDHRLLDEVPGLAPATMENIALFIWRHLAPDLPALAEVSVF 117


>gi|218288586|ref|ZP_03492863.1| queuosine biosynthesis protein QueD [Alicyclobacillus
           acidocaldarius LAA1]
 gi|218241243|gb|EED08418.1| queuosine biosynthesis protein QueD [Alicyclobacillus
           acidocaldarius LAA1]
          Length = 155

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 43/121 (35%), Positives = 67/121 (55%), Gaps = 12/121 (9%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +T+ FTF+AAH L       KC  +HGH+Y++ + + G V    G V DF ++++ F  +
Sbjct: 31  VTKEFTFDAAHHLHAYD--GKCANLHGHTYKLVITVSGRV-NDIGIVVDFGDLKRLFEDV 87

Query: 63  LE-KLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS--------ILSSVRVYETPMSWV 113
           ++ +LDH  LNE+    N TAEN+ +WIW+ L  +L          L  + +YETP S  
Sbjct: 88  IKRRLDHQYLNEVLPPMNTTAENMIVWIWEELERALEAYGRDRDVRLERLELYETPTSRA 147

Query: 114 E 114
            
Sbjct: 148 S 148


>gi|313203029|ref|YP_004041686.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Paludibacter propionicigenes WB4]
 gi|312442345|gb|ADQ78701.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Paludibacter propionicigenes WB4]
          Length = 116

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 33/114 (28%), Positives = 63/114 (55%), Gaps = 2/114 (1%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           I++ F F A+H+L  +   H C R+HGH+Y +++ + G+   K GFV D+ +++     +
Sbjct: 4   ISKEFHFSASHQLHGLKNDHPCGRIHGHNYTLKIFLRGEP-NKDGFVQDYNDLKPISDWV 62

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
              LDH  LN++ +    + EN++ +I+        +L +V + ETP +   Y+
Sbjct: 63  NNTLDHRHLNDVFDF-QTSVENMSKYIFDLFKPEFPLLVAVEMSETPKTNCRYE 115


>gi|153939050|ref|YP_001390178.1| putative 6-pyruvoyl tetrahydropterin synthase [Clostridium
           botulinum F str. Langeland]
 gi|152934946|gb|ABS40444.1| queuosine biosynthesis protein QueD [Clostridium botulinum F str.
           Langeland]
 gi|295318272|gb|ADF98649.1| queuosine biosynthesis protein QueD [Clostridium botulinum F str.
           230613]
          Length = 117

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 46/122 (37%), Positives = 66/122 (54%), Gaps = 10/122 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M + + F F+AAH L       KC R+HGH+Y + + + G+ D +   V DF  ++    
Sbjct: 1   MILIKKFKFDAAHNLIHY--HGKCERLHGHTYGLVIKISGERDKED-MVIDFTELKAIVK 57

Query: 61  PLL-EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
             +   LDH  +N+I  +E PTAENIA+WIW +L T L      L  + V+ET  S V Y
Sbjct: 58  ENVLNILDHAYINDI--MEQPTAENIAVWIWDKLYTKLKRDNCSLYEIEVWETETSGVVY 115

Query: 116 QG 117
            G
Sbjct: 116 NG 117


>gi|284048564|ref|YP_003398903.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Acidaminococcus fermentans DSM 20731]
 gi|283952785|gb|ADB47588.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Acidaminococcus fermentans DSM 20731]
          Length = 120

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/121 (37%), Positives = 69/121 (57%), Gaps = 8/121 (6%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M   + F F+AAH LP      KC  +HGH+Y++ + +EG  D +   +D          
Sbjct: 1   MICIKEFEFDAAHYLPNY--HGKCEHLHGHTYKLVVKVEGHPDQEGMVLDFVQFKHTVKD 58

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEYQ 116
            ++++LDHHCLN+I  L  P+AENIA+W+W +L   L+     L  V+V+ET  S + Y+
Sbjct: 59  LVVDQLDHHCLNDI--LPQPSAENIAVWVWNKLKEPLTGANYTLYEVQVWETRTSGIVYR 116

Query: 117 G 117
           G
Sbjct: 117 G 117


>gi|16331752|ref|NP_442480.1| hypothetical protein slr0078 [Synechocystis sp. PCC 6803]
 gi|6647718|sp|Q55798|QUED_SYNY3 RecName: Full=6-carboxy-5,6,7,8-tetrahydropterin synthase;
           Short=CPH4 synthase; AltName: Full=Queuosine
           biosynthesis protein queD
 gi|1001713|dbj|BAA10550.1| slr0078 [Synechocystis sp. PCC 6803]
          Length = 129

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 47/120 (39%), Positives = 67/120 (55%), Gaps = 8/120 (6%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVD----PKTGFVDDFFNIEQY 58
           I + F+FEAAH+LP      KC R+HGHS+R  + +  D       +TG V DF  ++ +
Sbjct: 4   IYKEFSFEAAHQLPH--HEGKCRRLHGHSFRGRVYVASDRLKTTGSETGMVMDFSVLKAH 61

Query: 59  FSP-LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTS-LSILSSVRVYETPMSWVEYQ 116
             P +   LDH+ LN+   LE+PT+E IA WI+ +L  + +  L SV V ET  S   Y 
Sbjct: 62  LDPLVKNHLDHYYLNDSLGLESPTSEAIAAWIFAKLEEAGVPGLHSVEVLETCTSAARYF 121


>gi|321478828|gb|EFX89785.1| hypothetical protein DAPPUDRAFT_230142 [Daphnia pulex]
          Length = 143

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 43/132 (32%), Positives = 68/132 (51%), Gaps = 17/132 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+  TF A+HRL               KC+    HGH+Y VE+ + G +D KTG V + 
Sbjct: 9   LTRRETFSASHRLHSPLLTDEENRKIFSKCNNPNGHGHNYTVEVTIRGPIDQKTGMVMNL 68

Query: 53  FNIEQYFSPLLEK-LDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI---LSSVRV 105
            +++ Y    + K +DH  L+ ++    N   T EN+A++IW  LS  L     L  V+V
Sbjct: 69  SDLKIYMEESIMKVMDHKNLDKDVPHFHNLVSTTENVAVFIWNSLSAQLPNSSLLYEVKV 128

Query: 106 YETPMSWVEYQG 117
           +ET  + + Y+G
Sbjct: 129 FETDKNIMVYRG 140


>gi|170755668|ref|YP_001780448.1| putative 6-pyruvoyl tetrahydropterin synthase [Clostridium
           botulinum B1 str. Okra]
 gi|169120880|gb|ACA44716.1| queuosine biosynthesis protein QueD [Clostridium botulinum B1 str.
           Okra]
          Length = 117

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 46/122 (37%), Positives = 67/122 (54%), Gaps = 10/122 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M + + F F+AAH L       KC R+HGH+Y + + + G+ D +   V DF  ++    
Sbjct: 1   MILIKKFKFDAAHNLIHY--HGKCERLHGHTYGLVIKISGERDKED-MVIDFTELKAIVK 57

Query: 61  PLL-EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
             + + LDH  +N+I  +E PTAENIA+WIW +L T L      L  + V+ET  S V Y
Sbjct: 58  ENVLDILDHAYINDI--IEQPTAENIAVWIWDKLYTKLERDNCSLYEIEVWETETSGVVY 115

Query: 116 QG 117
            G
Sbjct: 116 NG 117


>gi|225716602|gb|ACO14147.1| 6-pyruvoyl tetrahydrobiopterin synthase [Esox lucius]
          Length = 148

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 68/131 (51%), Gaps = 16/131 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+   F A+HRL               KC+    HGH+Y+VE+ + G +D  TG V + 
Sbjct: 17  LTRVQIFSASHRLHSLSLSDEVNKKIFGKCNNPNGHGHNYKVEVTVRGKIDRHTGMVMNI 76

Query: 53  FNIEQYFSPLLE-KLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVRVY 106
            +++Q+   ++   LDH  L+ ++    +   T EN+A++IW  +   L   +L  V+++
Sbjct: 77  TDLKQHVEDVVMIPLDHKNLDKDVPYFSDVVSTTENVAVYIWDNMVKRLPADLLYEVKIH 136

Query: 107 ETPMSWVEYQG 117
           ET  + + Y+G
Sbjct: 137 ETDKNVIVYRG 147


>gi|156740322|ref|YP_001430451.1| putative 6-pyruvoyl tetrahydropterin synthase [Roseiflexus
           castenholzii DSM 13941]
 gi|156231650|gb|ABU56433.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Roseiflexus castenholzii DSM 13941]
          Length = 280

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 43/130 (33%), Positives = 65/130 (50%), Gaps = 16/130 (12%)

Query: 4   TQAFTFEAAHRLPRVPK--------THKCHRM--HGHSYRVELVMEGDVDPKTGFVDDFF 53
           T+ F F AAHR  R              C     HGH+Y +++ + GD+DP+TG V +  
Sbjct: 5   TRRFEFSAAHRYWRSDWSAEENERVFGPCAYPYGHGHNYTLDVTITGDLDPRTGMVMNMT 64

Query: 54  NIEQYFSPLLEKLDHHCLN-EIEEL--ENPTAENIAIWIWKRLSTSLS---ILSSVRVYE 107
            ++   S +LE+ DH  LN +      + PT ENI   +W+ ++  L     L+ +R+YE
Sbjct: 65  ELKALVSEVLEEFDHKHLNEDTPYFCEQLPTTENIVRVLWRLIAARLPHTARLARLRLYE 124

Query: 108 TPMSWVEYQG 117
           T   W EY G
Sbjct: 125 TSDLWAEYDG 134



 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 41/127 (32%), Positives = 68/127 (53%), Gaps = 14/127 (11%)

Query: 5   QAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDFFN 54
           + + F AAHRL          +    KC+    HGH+Y +E+ + G VDP+TG V D   
Sbjct: 142 RMYAFSAAHRLHSPLLSDKENLAIYGKCNNPNGHGHTYTLEVTVAGPVDPETGMVIDLTA 201

Query: 55  IEQYFSPLLEKLDHHCLN-EIEEL--ENPTAENIAIWIWKRLSTSLS-ILSSVRVYETPM 110
           +++    +L++LD+  L+ EI     +  TAENI I++W+ L+      L  ++++ET  
Sbjct: 202 MDRTVRSVLDRLDYRHLDREIAAFATQPSTAENIVIYLWQELAPRFEGRLRHLKLWETRK 261

Query: 111 SWVEYQG 117
           +  EY G
Sbjct: 262 NVFEYTG 268


>gi|206890991|ref|YP_002248412.1| 6-pyruvoyl-tetrahydropterin synthase [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206742929|gb|ACI21986.1| 6-pyruvoyl-tetrahydropterin synthase [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 122

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 36/113 (31%), Positives = 60/113 (53%), Gaps = 8/113 (7%)

Query: 9   FEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDH 68
           F+AAH+L       KC  +HGH+++VE+ +  +   + G   DF  +++    ++ +LDH
Sbjct: 10  FDAAHQLKGYK--GKCENIHGHNWKVEVEVISEKLNEIGIALDFKELKKNVDEVVSQLDH 67

Query: 69  HCLNEIEELE--NPTAENIAIWIWKRLSTS----LSILSSVRVYETPMSWVEY 115
             +N+I      NP++ENIA WI+  L       L  L SV V+E+  +   Y
Sbjct: 68  TFINQIPPFTQLNPSSENIARWIYMSLKDKFNTTLVRLYSVTVWESDYASATY 120


>gi|147677738|ref|YP_001211953.1| 6-pyruvoyl-tetrahydropterin synthase [Pelotomaculum
           thermopropionicum SI]
 gi|146273835|dbj|BAF59584.1| 6-pyruvoyl-tetrahydropterin synthase [Pelotomaculum
           thermopropionicum SI]
          Length = 129

 Score =  107 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 39/125 (31%), Positives = 62/125 (49%), Gaps = 13/125 (10%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I    +F AAH +        C RMHGH++ VE V+ G    + G + DF  ++     
Sbjct: 3   EIVVRTSFAAAHSIKGYD--GPCSRMHGHTWLVEAVLRGGQLDQKGMLVDFKEVKNILRS 60

Query: 62  LLEKLDHHCLNEIEEL-----ENPTAENIAIWIWKRLSTSLSILSS------VRVYETPM 110
            + +LDH  LNEI+       ++PTAENIA +++ R+   +  L        VRV+E+  
Sbjct: 61  AVGELDHQNLNEIKPFAGGSGDSPTAENIARYLFCRIKPEIVKLERNIHLAMVRVWESDT 120

Query: 111 SWVEY 115
           +   Y
Sbjct: 121 AAASY 125


>gi|288905498|ref|YP_003430720.1| 6-pyruvoyl tetrahydrobiopterin synthase [Streptococcus gallolyticus
           UCN34]
 gi|288732224|emb|CBI13789.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Streptococcus
           gallolyticus UCN34]
          Length = 148

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 43/120 (35%), Positives = 69/120 (57%), Gaps = 9/120 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y +++ + G +    G   DF +++Q +   
Sbjct: 25  VSKEFTFDAAHHLFNYD--GKCKALHGHTYCLQIAVSG-LLDDRGMAVDFGDLKQIYKKH 81

Query: 63  LEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI-----LSSVRVYETPMSWVEYQ 116
           LE  LDHH LNE     N TAEN+  WI+K+++  L       +  +R+YETP S+ E++
Sbjct: 82  LEPSLDHHYLNESLPYMNTTAENMVYWIFKQVAQYLPKEREIRVEYIRLYETPTSFAEFR 141


>gi|322805137|emb|CBZ02701.1| queuosine biosynthesis QueD, PTPS-I / Folate biosynthesis protein
           PTPS-III, catalyzes a reaction that bypasses
           dihydroneopterin aldolase (FolB) [Clostridium botulinum
           H04402 065]
          Length = 117

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 46/122 (37%), Positives = 66/122 (54%), Gaps = 10/122 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M + + F F+AAH L       KC R+HGH+Y + + + G+ D +   V DF  ++    
Sbjct: 1   MILIKKFKFDAAHNLIHY--HGKCERLHGHTYGLVIKISGERDKED-MVIDFTELKAIVK 57

Query: 61  PLL-EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
             +   LDH  +NEI  ++ PTAENIA+WIW +L T L      L  + V+ET  S V Y
Sbjct: 58  ENVLNILDHAYINEI--IKQPTAENIAVWIWDKLYTKLKRDNCSLYEIEVWETETSGVIY 115

Query: 116 QG 117
            G
Sbjct: 116 NG 117


>gi|242008226|ref|XP_002424911.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Pediculus
           humanus corporis]
 gi|212508499|gb|EEB12173.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Pediculus
           humanus corporis]
          Length = 145

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 41/134 (30%), Positives = 73/134 (54%), Gaps = 19/134 (14%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T++  F A HRL               KC+ +  HGH+Y+VE+ ++G V P TG V + 
Sbjct: 9   LTRSEIFSACHRLHSKDLTEEENKKIYGKCNNINGHGHNYKVEVTLKGPVSPVTGMVVNI 68

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELEN----PTAENIAIWIWKRLSTSLSI---LSSV 103
            +++ Y    +++KLDH  ++ +++  +N     T EN+AI+I+  L + L     L  V
Sbjct: 69  TDLKSYMDEVIMKKLDHKNIDEDVDFFKNGGIVSTTENLAIYIFNELRSLLPNPNLLHKV 128

Query: 104 RVYETPMSWVEYQG 117
           +++ET  + V Y+G
Sbjct: 129 KIHETDKNSVVYRG 142


>gi|94971668|ref|YP_593716.1| putative 6-pyruvoyl tetrahydropterin synthase [Candidatus
           Koribacter versatilis Ellin345]
 gi|94553718|gb|ABF43642.1| preQ(0) biosynthesis protein QueD [Candidatus Koribacter versatilis
           Ellin345]
          Length = 125

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 35/124 (28%), Positives = 60/124 (48%), Gaps = 11/124 (8%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++T   TF A H L       KC   HGH+Y+V + ++G      G + DF +++    P
Sbjct: 3   EVTVEDTFAAGHYLRNYK--GKCENPHGHNYKVRVTLQGRELDHAGLLLDFKDLKVVMKP 60

Query: 62  LLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLS-------ILSSVRVYETPMSW 112
           +++ LDH  +N+I      NP+AENIA + +   +  L+        +  V ++ET  + 
Sbjct: 61  VVDYLDHQMMNDIPPFNEVNPSAENIARYFYDECNKFLAGQTSGRVRVKDVTIWETDTTT 120

Query: 113 VEYQ 116
             Y 
Sbjct: 121 ATYY 124


>gi|121603955|ref|YP_981284.1| putative 6-pyruvoyl tetrahydropterin synthase [Polaromonas
           naphthalenivorans CJ2]
 gi|120592924|gb|ABM36363.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Polaromonas naphthalenivorans CJ2]
          Length = 126

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 68/107 (63%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +++Q F F+AAH L R  +T    R+HGH+Y  E+ + G  DP TG V D   + +  + 
Sbjct: 10  ELSQTFFFDAAHTLDRAIETASSKRIHGHTYNAEVFLTGQPDPTTGMVIDLGLVRREVAL 69

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYET 108
           L E+LDHH L+E+E L  PT EN+  +I+++L  +L  L+SVRV+ T
Sbjct: 70  LREQLDHHLLDEVEGLGPPTLENLCQFIFRKLLPALPALTSVRVWRT 116


>gi|156379081|ref|XP_001631287.1| predicted protein [Nematostella vectensis]
 gi|156218325|gb|EDO39224.1| predicted protein [Nematostella vectensis]
          Length = 145

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 39/130 (30%), Positives = 62/130 (47%), Gaps = 15/130 (11%)

Query: 3   ITQAFTFEAAHRLPRV--------PKTHKCHR--MHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+  TF A+HRL               +C+    HGH+Y+V + +   VD  TG V + 
Sbjct: 11  ITRTETFSASHRLHNPTLTNQKNQELFGRCNNKNGHGHNYKVSVTVASTVDGTTGMVINL 70

Query: 53  FNIEQYFSPLLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI--LSSVRVYE 107
             ++     +L KLDH  L+ ++   +    TAEN+AI+I+ +L   L    L  V + E
Sbjct: 71  VTLKGKIEEVLGKLDHKNLDMDVAYFKTVVSTAENVAIYIYDQLKPLLPDGSLYEVGLIE 130

Query: 108 TPMSWVEYQG 117
           +      Y+G
Sbjct: 131 SETDAAVYRG 140


>gi|327400838|ref|YP_004341677.1| queuosine biosynthesis protein QueD [Archaeoglobus veneficus SNP6]
 gi|327316346|gb|AEA46962.1| queuosine biosynthesis protein QueD [Archaeoglobus veneficus SNP6]
          Length = 120

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 48/116 (41%), Positives = 69/116 (59%), Gaps = 10/116 (8%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I  + TF+AAH LP  P   KC + HGH+YRVE+ + G +  K G V DF  +++    
Sbjct: 4   EIGVSETFDAAHFLPSHP---KCGKTHGHTYRVEVTVRGRL--KNGMVMDFAELKKIVRE 58

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI---LSSVRVYETPMSWVE 114
           ++EK DH+ +NE   +ENPT EN+ I I+  +++ L     L  VRVYE P  W E
Sbjct: 59  VIEKYDHNLINEF--MENPTCENLCIAIFNEVASKLPAGVSLVRVRVYENPDKWAE 112


>gi|114051562|ref|NP_001040103.1| 6-pyruvoyltetrahydropterin synthase [Bombyx mori]
 gi|87248071|gb|ABD36088.1| 6-pyruvoyltetrahydropterin synthase [Bombyx mori]
          Length = 167

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 42/132 (31%), Positives = 68/132 (51%), Gaps = 17/132 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           I +  TF +AHRL               KC+    HGH+Y V + ++G VDP+TG V + 
Sbjct: 9   IIRRETFSSAHRLHSPFLSDEENKKVYGKCNNPNGHGHNYVVLVTVKGPVDPQTGMVMNI 68

Query: 53  FNIEQYFSPLL-EKLDHHCL-NEIEELEN--PTAENIAIWIWKRLS---TSLSILSSVRV 105
            ++++Y    + E LDH  L N++   +    T EN+AI++W +L        +L  V++
Sbjct: 69  TDLKKYIKTAILEPLDHKNLDNDVPYFKTMASTTENVAIYVWDQLQRIMEKPQLLHEVKI 128

Query: 106 YETPMSWVEYQG 117
            ET  + V Y+G
Sbjct: 129 LETEKNHVVYRG 140


>gi|223042777|ref|ZP_03612825.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus capitis
           SK14]
 gi|222443631|gb|EEE49728.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus capitis
           SK14]
          Length = 139

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 38/124 (30%), Positives = 62/124 (50%), Gaps = 12/124 (9%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ + F F AAH +P      KC R HGH+Y V + + GD     GF+ +F ++++   
Sbjct: 15  FELNKDFNFSAAHYIP-CEDAGKCMRTHGHTYFVNITIAGDELDHNGFLVNFADLKKLIH 73

Query: 61  PLLEKLDHHCLNEIEEL--ENPTAENIAIWIWKRLSTSL------SILSSVRVYETPMSW 112
               + DHH LN++E    +NP+ E +A  I+  +   L           V + ETP S+
Sbjct: 74  ---NQFDHHLLNDLEPFKGKNPSTEIVAQTIYTMVKDYLSKRDNQPKCVQVFLRETPTSY 130

Query: 113 VEYQ 116
           V Y+
Sbjct: 131 VVYR 134


>gi|226948105|ref|YP_002803196.1| queuosine biosynthesis protein QueD [Clostridium botulinum A2 str.
           Kyoto]
 gi|226843265|gb|ACO85931.1| queuosine biosynthesis protein QueD [Clostridium botulinum A2 str.
           Kyoto]
          Length = 117

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 46/122 (37%), Positives = 67/122 (54%), Gaps = 10/122 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M + + F F+AAH L       KC R+HGH+Y + + + G+ D +   V DF  ++    
Sbjct: 1   MILIKKFKFDAAHNLIHY--HGKCERLHGHTYGLVIKISGERDKED-MVIDFTELKAIVK 57

Query: 61  PLL-EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
             + + LDH  +NEI  ++ PTAENIA+WIW +L T L      L  + V+ET  S V Y
Sbjct: 58  ENVLDILDHAYINEI--IKQPTAENIAVWIWNKLYTKLKRDNCSLYEIEVWETETSGVVY 115

Query: 116 QG 117
            G
Sbjct: 116 NG 117


>gi|299135833|ref|ZP_07029017.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Acidobacterium sp. MP5ACTX8]
 gi|298601957|gb|EFI58111.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Acidobacterium sp. MP5ACTX8]
          Length = 125

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 39/125 (31%), Positives = 64/125 (51%), Gaps = 11/125 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++T    F + H L       KC   HGH+YRV + + G    + G + DF  ++Q   
Sbjct: 2   FEVTVQAGFSSGHYLRNY--HGKCENPHGHNYRVFVTLVGSELDEAGMLLDFKLLKQVLR 59

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLSILS--SVR-----VYETPMS 111
           P +E LDH  +N++E     NP+AEN+A + +++ ++ L  ++   VR     VYET  S
Sbjct: 60  PTVEYLDHQMINDLEPFTTLNPSAENLARYFFEQTASQLLNMAQGRVRVKDCTVYETDTS 119

Query: 112 WVEYQ 116
           +  Y 
Sbjct: 120 FARYY 124


>gi|229917715|ref|YP_002886361.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Exiguobacterium sp. AT1b]
 gi|229469144|gb|ACQ70916.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Exiguobacterium sp. AT1b]
          Length = 152

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 43/121 (35%), Positives = 67/121 (55%), Gaps = 9/121 (7%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I +  TF+AAH L       KC  +HGH+Y++++ + G      G   DF ++++ F  
Sbjct: 28  QIVKEVTFDAAHHLFDYD--GKCRALHGHTYKLQMGVSG-FLDNRGMTLDFGDLKKIFKE 84

Query: 62  LLEKL-DHHCLNEIEELENPTAENIAIWIWKRLSTSLS-----ILSSVRVYETPMSWVEY 115
            LE   DH  LNE     N TAEN+  WI+++L+T L       +  VR+YETP S+ E+
Sbjct: 85  ELEPYLDHRYLNESLPYMNTTAENMCYWIFEQLATHLPNERDVRVEFVRLYETPTSYAEF 144

Query: 116 Q 116
           +
Sbjct: 145 R 145


>gi|225714116|gb|ACO12904.1| 6-pyruvoyl tetrahydrobiopterin synthase [Lepeophtheirus salmonis]
          Length = 139

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 39/135 (28%), Positives = 68/135 (50%), Gaps = 20/135 (14%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+   F A+HRL          +    KC+    HGH+Y +E+ + G  DP TG   + 
Sbjct: 5   LTRREHFSASHRLHSNALSPHQNLQIFGKCNNPNGHGHNYVMEVTVSGPPDPITGMTMNL 64

Query: 53  FNIEQYFSPLL-EKLDHHCLN-EIEEL----ENPTAENIAIWIWKRLSTSLSI----LSS 102
            +++   S  + E LDH  ++ ++       +  T+EN+AI+IW+ L   L+     L  
Sbjct: 65  SDLKDLISHHVLEVLDHKNIDKDVPYFSLTNKTSTSENMAIFIWESLFPHLNEGFARLYE 124

Query: 103 VRVYETPMSWVEYQG 117
           V+++ET  + V Y+G
Sbjct: 125 VKLWETEKNIVVYRG 139


>gi|170761814|ref|YP_001786178.1| putative 6-pyruvoyl tetrahydropterin synthase [Clostridium
           botulinum A3 str. Loch Maree]
 gi|169408803|gb|ACA57214.1| queuosine biosynthesis protein QueD [Clostridium botulinum A3 str.
           Loch Maree]
          Length = 117

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 45/122 (36%), Positives = 67/122 (54%), Gaps = 10/122 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M + + F F++AH L       KC R+HGH+Y + + + G+ D +   V DF  ++    
Sbjct: 1   MILIKKFKFDSAHNLIHY--HGKCERLHGHTYGLVIKISGEPDKED-MVIDFTELKAIVK 57

Query: 61  PLL-EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
             + + LDH  +N+I  +E PTAENIA+WIW +L T L      L  + V+ET  S V Y
Sbjct: 58  ENVLDILDHAYINDI--IEQPTAENIAVWIWNKLYTKLKRDNCSLYEIEVWETETSGVVY 115

Query: 116 QG 117
            G
Sbjct: 116 NG 117


>gi|290561743|gb|ADD38269.1| 6-pyruvoyl tetrahydrobiopterin synthase [Lepeophtheirus salmonis]
          Length = 139

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 39/135 (28%), Positives = 68/135 (50%), Gaps = 20/135 (14%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+   F A+HRL          +    KC+    HGH+Y +E+ + G  DP TG   + 
Sbjct: 5   LTRREQFSASHRLHSNALSPHQNLQIFGKCNNPNGHGHNYVMEVTVSGPPDPITGMTMNL 64

Query: 53  FNIEQYFSPLL-EKLDHHCLN-EIEEL----ENPTAENIAIWIWKRLSTSLSI----LSS 102
            +++   S  + E LDH  ++ ++       +  T+EN+AI+IW+ L   L+     L  
Sbjct: 65  SDLKDLISHHVLEVLDHKNIDKDVPYFSLTNKTSTSENMAIFIWESLFPHLNEGFARLYE 124

Query: 103 VRVYETPMSWVEYQG 117
           V+++ET  + V Y+G
Sbjct: 125 VKLWETEKNIVVYRG 139


>gi|290561114|gb|ADD37959.1| 6-pyruvoyl tetrahydrobiopterin synthase [Lepeophtheirus salmonis]
          Length = 139

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 39/135 (28%), Positives = 68/135 (50%), Gaps = 20/135 (14%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+   F A+HRL          +    KC+    HGH+Y +E+ + G  DP TG   + 
Sbjct: 5   LTRREQFSASHRLHSNALSPHQNLQIFGKCNNPNGHGHNYVMEVTVSGPPDPITGMTMNL 64

Query: 53  FNIEQYFSPLL-EKLDHHCLN-EIEEL----ENPTAENIAIWIWKRLSTSLSI----LSS 102
            +++   S  + E LDH  ++ ++       +  T+EN+AI+IW+ L   L+     L  
Sbjct: 65  SDLKDLISHHVLEVLDHKNIDKDVPYFSLTNKTSTSENMAIFIWESLFPHLNEGFARLYE 124

Query: 103 VRVYETPMSWVEYQG 117
           V+++ET  + V Y+G
Sbjct: 125 VKLWETEKNIVVYRG 139


>gi|270308854|ref|YP_003330912.1| 6-pyruvoyl tetrahydrobiopterin synthase-like protein
           [Dehalococcoides sp. VS]
 gi|270154746|gb|ACZ62584.1| 6-pyruvoyl tetrahydrobiopterin synthase-like protein
           [Dehalococcoides sp. VS]
          Length = 123

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 42/120 (35%), Positives = 60/120 (50%), Gaps = 8/120 (6%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           ++    FEAAH L       KC  +HGH Y   L +      + G   DF  ++   S +
Sbjct: 4   LSVKKHFEAAHFLRGYK--GKCENLHGHRYEAALKVRVSKLDECGMGVDFKLLKTSLSEV 61

Query: 63  LEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSL----SILSSVRVYETPMSWVEYQ 116
           L+  DH CLN++   +  NP+AENIA  I+ RL   +    + L  V V+E+P S V YQ
Sbjct: 62  LQSYDHTCLNDLTPFDSQNPSAENIAKDIYNRLKPVITKNGAELYGVEVWESPDSSVLYQ 121


>gi|168700758|ref|ZP_02733035.1| 6-pyruvoyl tetrahydropterin synthase, putative [Gemmata
           obscuriglobus UQM 2246]
          Length = 157

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 38/133 (28%), Positives = 59/133 (44%), Gaps = 19/133 (14%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++T+   F   HRL       KC  +HGH+ +  + +E +     G V DF  I++   
Sbjct: 2   FRVTKEIHFCYGHRLLNY--AGKCRNLHGHNGKAVVTVETESLDALGMVVDFTEIKRVIG 59

Query: 61  PL-LEKLDHHCL---NE--IEELE-----------NPTAENIAIWIWKRLSTSLSILSSV 103
               + LDH  L   ++  I ELE           NPTAE IA  I+ R       ++ V
Sbjct: 60  KWIDDTLDHRMLLHQDDPIIPELERQGEPFIALDVNPTAETIARLIFDRAVAQGLPVTEV 119

Query: 104 RVYETPMSWVEYQ 116
            ++ET  S+  Y+
Sbjct: 120 ILWETENSFATYR 132


>gi|149280547|ref|ZP_01886664.1| probable 6-pyruvoyltetrahydropterin synthase (6-pyruvoyl
           tetrahydrobiopterin) synthase [Pedobacter sp. BAL39]
 gi|149228729|gb|EDM34131.1| probable 6-pyruvoyltetrahydropterin synthase (6-pyruvoyl
           tetrahydrobiopterin) synthase [Pedobacter sp. BAL39]
          Length = 136

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 40/135 (29%), Positives = 78/135 (57%), Gaps = 18/135 (13%)

Query: 1   MKITQAFTFEAAHRLPRVPKT--------HKCHR--MHGHSYRVELVMEGDVDPKTGFVD 50
           + IT+  +F AAH+L R   +         KC     HGH+Y++ + ++G+++P+TGF+ 
Sbjct: 2   IYITRKASFNAAHKLSRPDWSEDKNTEVYGKCANPNWHGHNYQLYVTVKGEINPETGFLV 61

Query: 51  DFFNIEQYF-SPLLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSL----SILSS 102
           D   ++    + ++EK+DH  LN +++ ++    + EN+ I IW  L+  +    + L +
Sbjct: 62  DLKWLKDLINNAVVEKIDHRNLNLDVDFMKGKLASTENLVIAIWDELAKLIAGSGAELHA 121

Query: 103 VRVYETPMSWVEYQG 117
           +++YET  ++VEY G
Sbjct: 122 IKIYETENNYVEYFG 136


>gi|322435897|ref|YP_004218109.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Acidobacterium sp. MP5ACTX9]
 gi|321163624|gb|ADW69329.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Acidobacterium sp. MP5ACTX9]
          Length = 146

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 46/133 (34%), Positives = 65/133 (48%), Gaps = 16/133 (12%)

Query: 1   MKITQAFTFEAAHRLPRVPK--------THKC--HRMHGHSYRVELVMEGDVDPKTGFVD 50
           + +T+   F AAH                 KC     HGH+Y +E+ + G+VDP TGFV 
Sbjct: 2   ILLTRKAEFSAAHFYWNDALSQQENERIFGKCANRNGHGHNYTLEVTVAGEVDPITGFVV 61

Query: 51  DFFNIEQYF-SPLLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI--LSSVR 104
           D   ++      ++   DH  LN EI +     PT ENIAI IW+RL+  +    L  VR
Sbjct: 62  DLKKLKDILEQEVVGVYDHRHLNLEIPDFATVIPTTENIAIAIWRRLAGKIPNATLHRVR 121

Query: 105 VYETPMSWVEYQG 117
           VYE P  + ++ G
Sbjct: 122 VYEMPDLFADFYG 134


>gi|57233618|ref|YP_182300.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Dehalococcoides
           ethenogenes 195]
 gi|57224066|gb|AAW39123.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Dehalococcoides
           ethenogenes 195]
          Length = 123

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 41/120 (34%), Positives = 61/120 (50%), Gaps = 8/120 (6%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           ++    FEAAH L       KC  +HGH Y V L +  +   + G   DF  ++     +
Sbjct: 4   LSVKKHFEAAHFLRGYK--GKCENLHGHRYEVALKVRANELDECGMGADFKVLKTSLGEV 61

Query: 63  LEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEYQ 116
           L+  DH CLN++   +  NP+AENI+  I+ +L   +S     L  V V+E+P S V YQ
Sbjct: 62  LQSYDHTCLNDLTPFDNQNPSAENISRDIYDKLKPVISRMGVELRGVEVWESPDSSVLYQ 121


>gi|255534031|ref|YP_003094403.1| hypothetical protein Phep_4150 [Pedobacter heparinus DSM 2366]
 gi|255347015|gb|ACU06341.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Pedobacter heparinus DSM 2366]
          Length = 137

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 42/135 (31%), Positives = 77/135 (57%), Gaps = 18/135 (13%)

Query: 1   MKITQAFTFEAAHRLPRVPKT--------HKCHR--MHGHSYRVELVMEGDVDPKTGFVD 50
           + IT+  +F AAH+L R   T         KC     HGH+Y++ + ++G+++P+TGF+ 
Sbjct: 2   IYITRKASFNAAHKLSRPDWTEAQNTEVYGKCANPNWHGHNYQLYVTVKGEINPETGFLV 61

Query: 51  DFFNIEQYFSPL-LEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI----LSS 102
           D   ++   +   ++K+DH  LN ++  ++    + EN+AI IW+ L   ++     L S
Sbjct: 62  DLKWLKDITNTYVVDKIDHKNLNLDVNFMKGKLASTENLAIAIWEELVNLIAESGAQLHS 121

Query: 103 VRVYETPMSWVEYQG 117
           +++YET  ++VEY G
Sbjct: 122 IKIYETENNFVEYFG 136


>gi|47214560|emb|CAF96233.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 148

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 36/131 (27%), Positives = 66/131 (50%), Gaps = 16/131 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+  +F A HRL               KC+    HGH+Y+ E+ + G +D  TG V + 
Sbjct: 17  ITRVQSFSACHRLHSIHLSDEENKKVYGKCNNPNGHGHNYKAEITVRGKIDHVTGMVMNL 76

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI--LSSVRVY 106
            ++++     +++ LDH  L+ ++        T EN+A++IW  ++  L    L  ++++
Sbjct: 77  TDLKRCIEEVIMDPLDHKNLDKDVPYFATVASTTENLAVYIWDNMAKVLPPSVLYEIKIH 136

Query: 107 ETPMSWVEYQG 117
           ET  + V Y+G
Sbjct: 137 ETDKNIVMYRG 147


>gi|305667783|ref|YP_003864070.1| putative 6-pyruvoyl tetrahydropterin synthase [Maribacter sp.
           HTCC2170]
 gi|88707620|gb|EAQ99862.1| putative 6-pyruvoyl tetrahydropterin synthase [Maribacter sp.
           HTCC2170]
          Length = 135

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 48/132 (36%), Positives = 70/132 (53%), Gaps = 16/132 (12%)

Query: 2   KITQAFTFEAAHRLPRVPKT--------HKCHR--MHGHSYRVELVMEGDVDPKTGFVDD 51
           K+++   F AAHRL R              C+    HGH+Y + + + G++D +TGFV D
Sbjct: 4   KVSRKAHFNAAHRLYRKDWDNSRNNEVFGICNNPNYHGHNYDLVVSVTGEIDKETGFVMD 63

Query: 52  FFNIEQYFSPLLEK-LDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSL--SILSSVRV 105
              ++      +E  LDH  LN E+ E E  NPTAENIA+ IW +L   +  S    V +
Sbjct: 64  MKVLKTLIKEKIEDSLDHKNLNVEVPEFENLNPTAENIAVVIWNKLRPYIDDSKELEVVL 123

Query: 106 YETPMSWVEYQG 117
           YETP ++V + G
Sbjct: 124 YETPRNFVTFSG 135


>gi|261364121|ref|ZP_05977004.1| queuosine biosynthesis protein QueD [Neisseria mucosa ATCC 25996]
 gi|288567700|gb|EFC89260.1| queuosine biosynthesis protein QueD [Neisseria mucosa ATCC 25996]
          Length = 140

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 45/141 (31%), Positives = 72/141 (51%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDV---DPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +  D     PK G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSDDPVRGGPKDGMVMDFTDLKA 58

Query: 58  YF-SPLLEKLDHHCL----NE-------IEELEN---------PTAENIAIWIWKRLSTS 96
                + +  DH  +    NE       + E  N          TAEN+A+ ++ RL  +
Sbjct: 59  IVKQHITDPFDHAFIYNGGNERECQIATLLEGWNMKTLCLPCRTTAENMAVEMYDRLKNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              + SV+++ETP S  EY+G
Sbjct: 119 GLKVCSVKLWETPTSCAEYEG 139


>gi|269792879|ref|YP_003317783.1| hypothetical protein Taci_1270 [Thermanaerovibrio acidaminovorans
           DSM 6589]
 gi|269100514|gb|ACZ19501.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermanaerovibrio acidaminovorans DSM 6589]
          Length = 121

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 44/118 (37%), Positives = 68/118 (57%), Gaps = 10/118 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MK+ + F+F AAH LPR     +C  +HGH+Y   + +EG  DP+ G + DF  ++    
Sbjct: 1   MKLKRRFSFSAAHWLPRYK--GRCEALHGHTYSFVITLEGSPDPE-GMIMDFTELKGLVE 57

Query: 61  PLL-EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWV 113
            ++  +LDH CLN++  LE PTAE ++ WI++ L+  L      L SV V+E+P    
Sbjct: 58  EMVLSRLDHSCLNDL--LEQPTAEALSRWIFEALADRLEAPNRRLESVEVFESPDCSA 113


>gi|317050691|ref|YP_004111807.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfurispirillum indicum S5]
 gi|316945775|gb|ADU65251.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfurispirillum indicum S5]
          Length = 125

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 36/124 (29%), Positives = 57/124 (45%), Gaps = 11/124 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++     F +AH L       KC  +HGH+Y V L + G+       + DF  ++    
Sbjct: 2   FELKVTEEFASAHNLRDY--QGKCENIHGHNYVVNLYVRGEKLQHNEMLVDFKVMKTCLR 59

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLSI-------LSSVRVYETPMS 111
            ++E LDH  LN++   +  NPT ENIA ++++     L+        +  V VYET  S
Sbjct: 60  EVMEYLDHKYLNDVPPFDQWNPTGENIARYVYQECKRLLAEQGVANATVWKVEVYETSTS 119

Query: 112 WVEY 115
              Y
Sbjct: 120 SATY 123


>gi|149372355|ref|ZP_01891543.1| 6-pyruvoyl tetrahydrobiopterin synthase [unidentified eubacterium
           SCB49]
 gi|149354745|gb|EDM43308.1| 6-pyruvoyl tetrahydrobiopterin synthase [unidentified eubacterium
           SCB49]
          Length = 135

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 46/131 (35%), Positives = 69/131 (52%), Gaps = 16/131 (12%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCHR--MHGHSYRVELVMEGDVDPKTGFVDDF 52
           + +   F AAHRL +             KC     HGH+Y +E+ + G++D +TGF+ D 
Sbjct: 5   VYRKAHFNAAHRLYKEEWSNEKNALIFGKCSNPNYHGHNYDLEVGVTGEIDEETGFLIDL 64

Query: 53  FNIEQYFSPLLE-KLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSI--LSSVRVY 106
             +++     +E   DH  LN E+E  +  NPT ENIAI I+ R+   L      SV++Y
Sbjct: 65  KILKKVIYEEVEVPFDHKNLNLEVEAFKTVNPTVENIAIEIYNRIVKRLDSRFDISVKLY 124

Query: 107 ETPMSWVEYQG 117
           ETP ++V Y G
Sbjct: 125 ETPRNFVVYTG 135


>gi|284929509|ref|YP_003422031.1| 6-pyruvoyl-tetrahydropterin synthase [cyanobacterium UCYN-A]
 gi|284809953|gb|ADB95650.1| 6-pyruvoyl-tetrahydropterin synthase [cyanobacterium UCYN-A]
          Length = 131

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 48/119 (40%), Positives = 66/119 (55%), Gaps = 8/119 (6%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKT----GFVDDFFNIEQY 58
           I + F FEAAH+LP      KC R+HGHS+   + +  +         G V DF +I  Y
Sbjct: 9   IYKEFRFEAAHKLPH--HKGKCSRLHGHSWVGRVYITQNNLHDEGSQKGMVMDFGDINNY 66

Query: 59  FSPLLEK-LDHHCLNEIEELENPTAENIAIWIWKRLST-SLSILSSVRVYETPMSWVEY 115
            +PL+E  LDH+ LNE   LE+PT+E +A WI+++L    L  L+ V V ET  S   Y
Sbjct: 67  LNPLIENFLDHYYLNETTGLESPTSEAVAQWIFEQLEKAKLPGLTMVEVKETCTSSASY 125


>gi|290462193|gb|ADD24144.1| 6-pyruvoyl tetrahydrobiopterin synthase [Lepeophtheirus salmonis]
          Length = 139

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 39/135 (28%), Positives = 68/135 (50%), Gaps = 20/135 (14%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+   F A+HRL          +    KC+    HGH+Y +E+ + G  DP TG   + 
Sbjct: 5   LTRREHFSASHRLHSNALSPHQNLQIFGKCNNPNGHGHNYVMEVAVSGPPDPITGMTMNL 64

Query: 53  FNIEQYFSPLL-EKLDHHCLN-EIEEL----ENPTAENIAIWIWKRLSTSLSI----LSS 102
            +++   S  + E LDH  ++ ++       +  T+EN+AI+IW+ L   L+     L  
Sbjct: 65  SDLKDLISHHVLEALDHKNIDKDVPYFSLTNKTSTSENMAIFIWESLFPHLNEGFARLYE 124

Query: 103 VRVYETPMSWVEYQG 117
           V+++ET  + V Y+G
Sbjct: 125 VKLWETEKNIVVYRG 139


>gi|317485420|ref|ZP_07944299.1| queuosine biosynthesis protein QueD [Bilophila wadsworthia 3_1_6]
 gi|316923379|gb|EFV44586.1| queuosine biosynthesis protein QueD [Bilophila wadsworthia 3_1_6]
          Length = 128

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 40/120 (33%), Positives = 64/120 (53%), Gaps = 8/120 (6%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPK-TGFVDDFFNIEQYFS 60
           K+T    F AAH L       KC  +HGH+Y VE+V++G    + T  + DF +++    
Sbjct: 7   KLTVRSEFCAAHALRHY--QGKCEHLHGHNYAVEVVVKGYTLSQNTELLMDFGDLKALLK 64

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLSI---LSSVRVYETPMSWVEY 115
             LE LDH  +N++   +  NP++EN+A +IW +++ SL     + SV V E  +    Y
Sbjct: 65  QALEPLDHAYINDVPPFDAVNPSSENLARYIWNQMAPSLPETVKMYSVTVAEKGIQSATY 124


>gi|332800182|ref|YP_004461681.1| queuosine biosynthesis protein QueD [Tepidanaerobacter sp. Re1]
 gi|332697917|gb|AEE92374.1| queuosine biosynthesis protein QueD [Tepidanaerobacter sp. Re1]
          Length = 118

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 44/122 (36%), Positives = 70/122 (57%), Gaps = 10/122 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M +T+ F F+AAH L  V    KC ++HGH+Y++ + +EG    +   + DF  ++    
Sbjct: 1   MILTRKFKFDAAHNL--VEYHGKCEKLHGHTYKLVVKLEGKPGKED-MIMDFSELKHVVE 57

Query: 61  -PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEY 115
             +L++LDH  LN+   ++ P+AENIA WIW RL   LS     L  ++V+ET    + Y
Sbjct: 58  SKILQQLDHSYLNDF--IKQPSAENIAKWIWDRLYDELSRENCRLYEIQVWETENCGIMY 115

Query: 116 QG 117
           +G
Sbjct: 116 RG 117


>gi|228477581|ref|ZP_04062214.1| 6-pyruvoyl-tetrahydropterin synthase [Streptococcus salivarius
           SK126]
 gi|228250725|gb|EEK09923.1| 6-pyruvoyl-tetrahydropterin synthase [Streptococcus salivarius
           SK126]
          Length = 147

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 42/120 (35%), Positives = 66/120 (55%), Gaps = 9/120 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y +++ + G    + G   DF +++  +   
Sbjct: 25  VSKEFTFDAAHHLFNYE--GKCKSLHGHTYHLQIAVSG-YLDERGMTFDFGDLKSIYKDH 81

Query: 63  LE-KLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI-----LSSVRVYETPMSWVEYQ 116
           LE +LDH  LNE     N TAEN+  WI++  S  L       L  VR+YETP ++ E++
Sbjct: 82  LEPQLDHRYLNETLPYMNTTAENMVFWIFQMTSQHLPEERGLRLEYVRLYETPTAFAEFR 141


>gi|225012660|ref|ZP_03703095.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Flavobacteria bacterium MS024-2A]
 gi|225003193|gb|EEG41168.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Flavobacteria bacterium MS024-2A]
          Length = 135

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 45/131 (34%), Positives = 70/131 (53%), Gaps = 16/131 (12%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCHR--MHGHSYRVELVMEGDVDPKTGFVDDF 52
           +++   F AAHRL +             KC     HGH+Y + + + G +DP+TG+V D 
Sbjct: 5   VSRKAHFNAAHRLFKKEWTDKQNEAIFGKCANPHYHGHNYELIVHVTGKIDPETGYVMDM 64

Query: 53  FNIEQYFSPLLEK-LDHHCLNE-IEELEN--PTAENIAIWIWKRLSTSLSILS--SVRVY 106
             ++      +E+ LDH  LNE + E  +  PTAENIA+ I+ +L   L+     SV +Y
Sbjct: 65  KVLKDLIKAEVEELLDHKNLNEQVAEFFDLIPTAENIAVVIYNKLKPHLNKAHTLSVTLY 124

Query: 107 ETPMSWVEYQG 117
           ETP ++V + G
Sbjct: 125 ETPRNFVTFSG 135


>gi|307297935|ref|ZP_07577739.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermotogales bacterium mesG1.Ag.4.2]
 gi|306916021|gb|EFN46404.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermotogales bacterium mesG1.Ag.4.2]
          Length = 122

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 43/121 (35%), Positives = 70/121 (57%), Gaps = 10/121 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             IT+ FTF+AAH L       KC ++HGH+Y++++ + G+   +   V DF  +++   
Sbjct: 2   FFITKEFTFDAAHNLTMY--HGKCEKLHGHTYKLQVTVAGEKQEED-MVIDFLKMKEIVR 58

Query: 61  -PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEY 115
             +L  LDH  +N++  L  PTAENIA WI+ +L+  +      L  V ++ETP S+V Y
Sbjct: 59  DEVLSVLDHSYINDV--LSQPTAENIAEWIFNKLAGKIRGNSFELYEVALWETPTSFVRY 116

Query: 116 Q 116
           +
Sbjct: 117 R 117


>gi|314933022|ref|ZP_07840388.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus
           caprae C87]
 gi|313654341|gb|EFS18097.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus
           caprae C87]
          Length = 139

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 63/124 (50%), Gaps = 12/124 (9%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ + F F AAH +P      KC R HGH+Y V + + GD     GF+ +F +++Q   
Sbjct: 15  FELNKDFNFSAAHYIPS-KDAGKCMRTHGHTYFVNITIAGDKLDHNGFLVNFSDLKQLIH 73

Query: 61  PLLEKLDHHCLNEIEEL--ENPTAENIAIWIWKRLSTSL------SILSSVRVYETPMSW 112
              ++ DH+ LN++E    ++P+ E +A  I+  +   L           V + ETP S+
Sbjct: 74  ---DQFDHYLLNDLEPFKGKSPSTEIVAQTIYTMVQDYLSNRDNQPKCVQVFLRETPTSY 130

Query: 113 VEYQ 116
           V Y+
Sbjct: 131 VVYR 134


>gi|320546947|ref|ZP_08041248.1| 6-pyruvoyltetrahydropterin synthase [Streptococcus equinus ATCC
           9812]
 gi|320448349|gb|EFW89091.1| 6-pyruvoyltetrahydropterin synthase [Streptococcus equinus ATCC
           9812]
          Length = 148

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 44/120 (36%), Positives = 65/120 (54%), Gaps = 9/120 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y ++L + G +        DF +I+Q +   
Sbjct: 25  VSKEFTFDAAHHL--YDYDGKCKALHGHTYHLQLAVSG-MLDNRAMAVDFGDIKQIYKDH 81

Query: 63  LEKL-DHHCLNEIEELENPTAENIAIWIWKRLSTSLSI-----LSSVRVYETPMSWVEYQ 116
           LE   DH  LNE     N TAEN+  WI+K+L   L       +  VR+YETP S+ E++
Sbjct: 82  LEPYLDHRYLNESLPYMNTTAENMVYWIFKQLEQYLPKERDTRVEYVRLYETPTSYAEFR 141


>gi|126662140|ref|ZP_01733139.1| 6-pyruvoyl tetrahydrobiopterin synthase [Flavobacteria bacterium
           BAL38]
 gi|126625519|gb|EAZ96208.1| 6-pyruvoyl tetrahydrobiopterin synthase [Flavobacteria bacterium
           BAL38]
          Length = 136

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 45/135 (33%), Positives = 72/135 (53%), Gaps = 18/135 (13%)

Query: 1   MKIT--QAFTFEAAHRLPRVPK--------THKCHRM--HGHSYRVELVMEGDVDPKTGF 48
           M++T  +   F AAHRL R             KC+    HGH+Y + + + G+VDP+TG+
Sbjct: 1   MRVTVSRKAHFNAAHRLYRKDWSMEKNQEVFGKCNNPNFHGHNYELIVSVTGEVDPETGY 60

Query: 49  VDDFFNIEQYFSPLLEK-LDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSI--LSS 102
           V D   +       +E+  DH  LN ++ E +  NPTAE+IA  IW +L   ++      
Sbjct: 61  VMDTKILSDLIKEHIEEAFDHKNLNKDVPEFKDLNPTAEHIAYIIWNKLRVLIATTIDLE 120

Query: 103 VRVYETPMSWVEYQG 117
           + +YETP +++ Y+G
Sbjct: 121 ITLYETPRNFITYKG 135


>gi|303242852|ref|ZP_07329316.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Acetivibrio cellulolyticus CD2]
 gi|302589598|gb|EFL59382.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Acetivibrio cellulolyticus CD2]
          Length = 127

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 45/117 (38%), Positives = 70/117 (59%), Gaps = 9/117 (7%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M IT+ FTF++AH L   P   KC  +HGH+Y++E+ ++G  D K G V DF ++     
Sbjct: 6   MSITKVFTFDSAHHLNDYP--GKCKNIHGHTYKLEVTLKGIPD-KNGLVIDFHDLNDMVE 62

Query: 61  PLL-EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSW 112
             +   +DH  LN+I +  NPT E I +WIW++LS S++     L  + ++ETP S+
Sbjct: 63  KEILSNIDHKYLNDIFDF-NPTCEMIGLWIWEQLSKSMTGLECNLEKLVLWETPTSY 118


>gi|161869453|ref|YP_001598620.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Neisseria
           meningitidis 053442]
 gi|304388251|ref|ZP_07370371.1| 6-pyruvoyltetrahydropterin synthase [Neisseria meningitidis ATCC
           13091]
 gi|161595006|gb|ABX72666.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Neisseria
           meningitidis 053442]
 gi|304337778|gb|EFM03927.1| 6-pyruvoyltetrahydropterin synthase [Neisseria meningitidis ATCC
           13091]
          Length = 140

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 42/141 (29%), Positives = 70/141 (49%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDV---DPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +  D     PK G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSDDPVRGGPKDGMVMDFTDLKA 58

Query: 58  YF-SPLLEKLDHHCL--------NEIEEL------------ENPTAENIAIWIWKRLSTS 96
                + +  DH  +        ++I  L               TAEN+A+ ++ RL  +
Sbjct: 59  IVKQHITDPFDHAFIYHGGNGRESQIAALLEGWNMKTLRLPCRTTAENMAVEMYDRLKNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              +  V+++ETP S  EY+G
Sbjct: 119 GLNVCRVKLWETPTSCAEYEG 139


>gi|293365937|ref|ZP_06612640.1| 6-pyruvoyltetrahydropterin synthase [Streptococcus oralis ATCC
           35037]
 gi|307702340|ref|ZP_07639298.1| queuosine biosynthesis protein QueD [Streptococcus oralis ATCC
           35037]
 gi|291315615|gb|EFE56065.1| 6-pyruvoyltetrahydropterin synthase [Streptococcus oralis ATCC
           35037]
 gi|307624143|gb|EFO03122.1| queuosine biosynthesis protein QueD [Streptococcus oralis ATCC
           35037]
          Length = 147

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 43/120 (35%), Positives = 66/120 (55%), Gaps = 9/120 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y +++ + G    + G   DF +I+  +   
Sbjct: 25  VSKEFTFDAAHHLFHYE--GKCKSLHGHTYHLQVAVSG-FLDERGMTYDFGDIKAIYKNY 81

Query: 63  LEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSLS-----ILSSVRVYETPMSWVEYQ 116
           LE  LDH  LNE     N TAEN+  WI++ +S  L       L  VR+YETP ++ E++
Sbjct: 82  LEPHLDHRYLNETLPYMNTTAENMVYWIFQTMSQELPDERGLRLEYVRLYETPTAFAEFR 141


>gi|289167419|ref|YP_003445688.1| 6-pyruvoyl-tetrahydropterin synthase [Streptococcus mitis B6]
 gi|307705449|ref|ZP_07642304.1| queuosine biosynthesis protein QueD [Streptococcus mitis SK597]
 gi|288906986|emb|CBJ21820.1| 6-pyruvoyl-tetrahydropterin synthase [Streptococcus mitis B6]
 gi|307620984|gb|EFO00066.1| queuosine biosynthesis protein QueD [Streptococcus mitis SK597]
          Length = 147

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 44/120 (36%), Positives = 66/120 (55%), Gaps = 9/120 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y +++ + G    + G   DF +I+  +   
Sbjct: 25  VSKEFTFDAAHHLFHYE--GKCKSLHGHTYHLQIAVSG-FLDERGMTYDFGDIKAIYKNY 81

Query: 63  LEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSLS-----ILSSVRVYETPMSWVEYQ 116
           LE  LDH  LNE     N TAEN+  WI++ +S  L       L  VR+YETP S+ E++
Sbjct: 82  LEPHLDHRYLNETLPYMNTTAENMVYWIFQTMSQELPDERGLRLEYVRLYETPTSFAEFR 141


>gi|70727186|ref|YP_254102.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus
           haemolyticus JCSC1435]
 gi|68447912|dbj|BAE05496.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus
           haemolyticus JCSC1435]
          Length = 139

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/124 (30%), Positives = 65/124 (52%), Gaps = 12/124 (9%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ + F F AAH +P      KC R HGH+Y V L + GD     GF+ +F ++++   
Sbjct: 15  FELNKDFNFSAAHYIPS-EDAGKCMRTHGHTYFVNLTIAGDKLDHNGFLINFSDLKKLIH 73

Query: 61  PLLEKLDHHCLNEIEELEN--PTAENIAIWIWKRLSTSL------SILSSVRVYETPMSW 112
              ++ DH+ LN++ + ++  P+ E +A  I+K + T L           V + ETP S+
Sbjct: 74  ---DQFDHYLLNDLPQFKDKSPSTEVVAQTIYKMVQTHLQNCDNQPECVQVYLRETPTSY 130

Query: 113 VEYQ 116
           V Y+
Sbjct: 131 VVYR 134


>gi|217967010|ref|YP_002352516.1| queuosine biosynthesis protein QueD [Dictyoglomus turgidum DSM
           6724]
 gi|217336109|gb|ACK41902.1| queuosine biosynthesis protein QueD [Dictyoglomus turgidum DSM
           6724]
          Length = 125

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 50/122 (40%), Positives = 70/122 (57%), Gaps = 10/122 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M + + F F+AAH L       KC ++HGH+YR+ +V+EG  D + G + DF  ++    
Sbjct: 1   MFLIREFKFDAAHNLESYK--GKCEKLHGHTYRLVIVVEGVPDSE-GMIIDFVELKDIVK 57

Query: 61  PL-LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
              +  LDH  +NEI  +  PTAENIAIW+WKRL   L      L  V+V+ET  S V Y
Sbjct: 58  EEVINVLDHSYINEI--MNQPTAENIAIWVWKRLEKKLQRDNCHLYEVQVWETEDSGVIY 115

Query: 116 QG 117
           +G
Sbjct: 116 RG 117


>gi|322388781|ref|ZP_08062378.1| 6-pyruvoyltetrahydropterin synthase [Streptococcus infantis ATCC
           700779]
 gi|321140400|gb|EFX35908.1| 6-pyruvoyltetrahydropterin synthase [Streptococcus infantis ATCC
           700779]
          Length = 147

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 43/120 (35%), Positives = 65/120 (54%), Gaps = 9/120 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y +++ + G      G   DF +I+  +   
Sbjct: 25  VSKEFTFDAAHHLFHYE--GKCKSLHGHTYHLQIAVSG-FLDDRGMTYDFGDIKAIYKDY 81

Query: 63  LEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSLS-----ILSSVRVYETPMSWVEYQ 116
           LE  LDH  LNE     N TAEN+  WI++ +S  L       L  VR+YETP ++ E++
Sbjct: 82  LEPHLDHRYLNETLPYMNTTAENMVYWIFQTMSQELPGERGLRLEYVRLYETPTAFAEFR 141


>gi|288574187|ref|ZP_06392544.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288569928|gb|EFC91485.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 121

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 46/119 (38%), Positives = 72/119 (60%), Gaps = 10/119 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M + + FTF+AAHRL R     KC  +HGH+YR+ + + G  D +   V DF  +++  S
Sbjct: 1   MLLRKEFTFDAAHRLERY--RGKCEALHGHTYRLAVTLNGRSDDED-MVFDFTELKRIVS 57

Query: 61  PLL-EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
             +  +LDH  LN++  ++ PTAENIA+W+W++L  S+      L SV+++ET  S V 
Sbjct: 58  EKILTELDHAYLNDV--MDQPTAENIALWVWRKLDESVKRPNCELHSVQIWETATSSVI 114


>gi|322434489|ref|YP_004216701.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Acidobacterium sp. MP5ACTX9]
 gi|321162216|gb|ADW67921.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Acidobacterium sp. MP5ACTX9]
          Length = 125

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 36/125 (28%), Positives = 64/125 (51%), Gaps = 11/125 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++T    F + H L       KC   HGH+Y+V + + G    + G + DF  ++Q   
Sbjct: 2   FEVTVEAGFSSGHYLRNY--RGKCENPHGHNYKVFVTLVGAELDEAGLLLDFKLLKQVMR 59

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLSILS--SVRV-----YETPMS 111
           P+++ LDH  +N+++  +  NP+AEN+A + +   +T L  ++   V+V     YET  S
Sbjct: 60  PVVDYLDHQMINDLKPFDEINPSAENLARYFFDNTATQLDEMTQGRVKVKDCTLYETDTS 119

Query: 112 WVEYQ 116
           +  Y 
Sbjct: 120 FARYY 124


>gi|298370140|ref|ZP_06981456.1| queuosine biosynthesis protein QueD [Neisseria sp. oral taxon 014
           str. F0314]
 gi|298281600|gb|EFI23089.1| queuosine biosynthesis protein QueD [Neisseria sp. oral taxon 014
           str. F0314]
          Length = 140

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 44/141 (31%), Positives = 71/141 (50%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDV---DPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +  D     PK G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSDDPVRGGPKDGMVMDFTDLKA 58

Query: 58  YFSPL-LEKLDHHCL----NE-------IEELEN---------PTAENIAIWIWKRLSTS 96
                  +  DH  +    N+       + E  N          TAEN+A+ ++ RL  +
Sbjct: 59  AVKKHITDPFDHAFIYHGGNDRECQIAALLEGWNMKTLCLPCRTTAENMAVEMYDRLKNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              + SV+++ETP S  EY+G
Sbjct: 119 GLKVCSVKLWETPTSCAEYEG 139


>gi|197106203|ref|YP_002131580.1| 6-pyruvoyl tetrahydrobiopterin synthase [Phenylobacterium zucineum
           HLK1]
 gi|196479623|gb|ACG79151.1| 6-pyruvoyl tetrahydrobiopterin synthase [Phenylobacterium zucineum
           HLK1]
          Length = 125

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 37/106 (34%), Positives = 56/106 (52%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT+A TF+AAH L   P       +HGHS++VE  + G      G+V D  ++++   
Sbjct: 6   FEITKAATFDAAHYLAEGPAHRPYTNLHGHSFKVEATVRGQPQEPVGWVADLADLDEALK 65

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVY 106
            +  +LDH  LNE   LE PT E++ ++  +RL      LS V V 
Sbjct: 66  AVAGELDHGLLNEKPGLERPTLEHLCLYFAERLRPRFPGLSRVVVS 111


>gi|302389145|ref|YP_003824966.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermosediminibacter oceani DSM 16646]
 gi|302199773|gb|ADL07343.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermosediminibacter oceani DSM 16646]
          Length = 125

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/122 (36%), Positives = 71/122 (58%), Gaps = 10/122 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M + + F F+AAH L  V    KC ++HGH+YR+ +V+EG  D + G + DF  ++    
Sbjct: 1   MFLIKEFKFDAAHNL--VKYKGKCEKLHGHTYRLVVVLEGTPDAE-GMIMDFLELKNIVE 57

Query: 61  PLL-EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEY 115
             + + LDH  +N+   +E P+AENIA+W+W+RL   +      L  V+V+ET  S   Y
Sbjct: 58  ENVLKFLDHSYIND--YIEQPSAENIAVWVWRRLEERVKRENCRLYEVQVWETATSGAVY 115

Query: 116 QG 117
           +G
Sbjct: 116 RG 117


>gi|261856269|ref|YP_003263552.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Halothiobacillus neapolitanus c2]
 gi|261836738|gb|ACX96505.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Halothiobacillus neapolitanus c2]
          Length = 152

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/120 (31%), Positives = 63/120 (52%), Gaps = 8/120 (6%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           ++    F AAH+L        C R+HGH++++ + + G      G V DF  +++     
Sbjct: 34  LSVTVDFAAAHQLHGYE--GNCARLHGHNWKIIVEVTGQKLDDVGMVIDFKAMKKAARAA 91

Query: 63  LEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSL----SILSSVRVYETPMSWVEYQ 116
            + LDH  LN+IE  +  NPTAE+IA+W +  L   L    + +S++ V+E   S V Y+
Sbjct: 92  AKTLDHQFLNQIEPFDRINPTAEHIAVWFFVELGRMLNQPNARVSAITVWENDYSAVTYR 151


>gi|307707500|ref|ZP_07643982.1| 6-pyruvoyl tetrahydrobiopterin synthase [Streptococcus mitis NCTC
           12261]
 gi|307616452|gb|EFN95643.1| 6-pyruvoyl tetrahydrobiopterin synthase [Streptococcus mitis NCTC
           12261]
          Length = 147

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/120 (35%), Positives = 66/120 (55%), Gaps = 9/120 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y +++ + G    + G   DF +I+  +   
Sbjct: 25  VSKEFTFDAAHHLFHYE--GKCKSLHGHTYHLQIAVSG-FLDERGMTYDFGDIKAIYKNY 81

Query: 63  LEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSLS-----ILSSVRVYETPMSWVEYQ 116
           LE  LDH  LNE     N TAEN+  WI++ ++  L       L  VR+YETP S+ E++
Sbjct: 82  LEPHLDHRYLNETLPYMNTTAENMVYWIFQTMNQELPDKRGLRLEYVRLYETPTSFAEFR 141


>gi|309798879|ref|ZP_07693140.1| 6-pyruvoyl tetrahydrobiopterin synthase [Streptococcus infantis
           SK1302]
 gi|308117528|gb|EFO54943.1| 6-pyruvoyl tetrahydrobiopterin synthase [Streptococcus infantis
           SK1302]
          Length = 147

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/120 (35%), Positives = 65/120 (54%), Gaps = 9/120 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y +++ + G      G   DF +I+  +   
Sbjct: 25  VSKEFTFDAAHHLFHYE--GKCKSLHGHTYHLQIAVSG-FLDDRGMTYDFGDIKAIYKDY 81

Query: 63  LEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSLS-----ILSSVRVYETPMSWVEYQ 116
           LE  LDH  LNE     N TAEN+  WI++ +S  L       L  VR+YETP ++ E++
Sbjct: 82  LEPHLDHRYLNETLPYMNTTAENMVYWIFQTMSQELPDERGLRLEYVRLYETPTAFAEFR 141


>gi|254669982|emb|CBA04669.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Neisseria
           meningitidis alpha153]
 gi|261393102|emb|CAX50699.1| putative 6-pyruvoyl tetrahydrobiopterin synthase (PTPS; PTP
           synthase) [Neisseria meningitidis 8013]
 gi|308388710|gb|ADO31030.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Neisseria
           meningitidis alpha710]
 gi|325133663|gb|EGC56320.1| queuosine biosynthesis protein QueD [Neisseria meningitidis M13399]
 gi|325143845|gb|EGC66160.1| queuosine biosynthesis protein QueD [Neisseria meningitidis
           M01-240013]
 gi|325203618|gb|ADY99071.1| queuosine biosynthesis protein QueD [Neisseria meningitidis
           M01-240355]
 gi|325206621|gb|ADZ02074.1| queuosine biosynthesis protein QueD [Neisseria meningitidis
           M04-240196]
          Length = 140

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 42/141 (29%), Positives = 70/141 (49%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDV---DPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +  D     PK G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSDDPVRGGPKDGMVMDFTDLKA 58

Query: 58  YF-SPLLEKLDHHCL--------NEIEEL------------ENPTAENIAIWIWKRLSTS 96
                + +  DH  +        ++I  L               TAEN+A+ ++ RL  +
Sbjct: 59  IVKQHITDPFDHAFIYHGGNGRESQIAALLEGWNMKTLRLPCRTTAENMAVEMYDRLKNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              +  V+++ETP S  EY+G
Sbjct: 119 GLNVCRVKLWETPTSCAEYEG 139


>gi|328947401|ref|YP_004364738.1| queuosine biosynthesis protein QueD [Treponema succinifaciens DSM
           2489]
 gi|328447725|gb|AEB13441.1| queuosine biosynthesis protein QueD [Treponema succinifaciens DSM
           2489]
          Length = 128

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 37/126 (29%), Positives = 61/126 (48%), Gaps = 13/126 (10%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++     F AAH L       KC  +HGH+Y+V   + G    + G + DF  +++   
Sbjct: 2   FEVRVTADFSAAHFLRDY--NGKCENLHGHNYKVYAHVRGTELDRGGMLLDFTKLKKTLR 59

Query: 61  PLLEKLDHHCLNEIEELE-NPTAENIAIWIWKRLSTSLSI----------LSSVRVYETP 109
            +  K+DH  LN+IE  E NP+AE IA++I+  +   + +          L ++ V+ET 
Sbjct: 60  EVCGKIDHTNLNDIEFFEQNPSAERIAVYIYNHIIEGIPLLKKTDGKKAWLYAIDVFETE 119

Query: 110 MSWVEY 115
            S   Y
Sbjct: 120 TSRARY 125


>gi|312865297|ref|ZP_07725525.1| queuosine biosynthesis protein QueD [Streptococcus downei F0415]
 gi|311099408|gb|EFQ57624.1| queuosine biosynthesis protein QueD [Streptococcus downei F0415]
          Length = 148

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 46/120 (38%), Positives = 70/120 (58%), Gaps = 9/120 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+YR+++ + G +  + G V DF +++  +   
Sbjct: 26  VSKEFTFDAAHHLFHYE--GKCKSLHGHTYRLQIAISG-MLDERGMVFDFADLKTIYKEH 82

Query: 63  LEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSLSIL-----SSVRVYETPMSWVEYQ 116
           LE  LDH  LNE     N TAEN+  WI+K    +LS +      SVR+YETP S+ E++
Sbjct: 83  LEPHLDHRYLNESLPYMNTTAENMVYWIYKTFEANLSQIRGLRMESVRLYETPSSYAEFR 142


>gi|284035925|ref|YP_003385855.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Spirosoma linguale DSM 74]
 gi|283815218|gb|ADB37056.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Spirosoma linguale DSM 74]
          Length = 143

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/129 (33%), Positives = 64/129 (49%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHR--MHGHSYRVELVMEGDVDPKTGFVDDF 52
           + +   F AAHRL     +         KC+    HGH+Y + + + G +D +TG+V D 
Sbjct: 13  VFRKEHFNAAHRLNNPNWSDEKNTRVYGKCNNPNYHGHNYELIVQVIGPIDDETGYVIDM 72

Query: 53  FNIEQYFSPL-LEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSI--LSSVRVY 106
             +         ++ DH  LN + EE    NP+AENIAI I+  L   LS      +R+Y
Sbjct: 73  KLLSDLIKEHVTDRFDHKNLNLDTEEFADLNPSAENIAIVIYNILRNQLSEGLDLKIRLY 132

Query: 107 ETPMSWVEY 115
           ET  ++VEY
Sbjct: 133 ETERNFVEY 141


>gi|51012481|gb|AAT92556.1| 6-pyruvoyl tetrahydropterin synthase [Danio rerio]
          Length = 143

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/130 (29%), Positives = 66/130 (50%), Gaps = 16/130 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+  +F A HRL               KC+    HGH+Y VE+ + G +D  TG V + 
Sbjct: 14  ITRVCSFSACHRLHSKCLSDEENKRTFGKCNNPNGHGHNYTVEVTVRGKIDKNTGMVMNL 73

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVRVY 106
            +++++    +++ LDH  L+ ++    +   T EN++++IW  L   L    L  ++VY
Sbjct: 74  TDLKEFIEEAVMKPLDHKNLDLDVPYFADVVSTTENLSVFIWDGLQKLLPHDSLYEIKVY 133

Query: 107 ETPMSWVEYQ 116
           ET  + V Y+
Sbjct: 134 ETAKNIVIYR 143


>gi|312879661|ref|ZP_07739461.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Aminomonas paucivorans DSM 12260]
 gi|310782952|gb|EFQ23350.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Aminomonas paucivorans DSM 12260]
          Length = 121

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 46/121 (38%), Positives = 71/121 (58%), Gaps = 10/121 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M++ + FTF+AAH L  V    KC R+HGH+YR+ + +EG  D + G V DF  +++   
Sbjct: 1   MRLRRDFTFDAAHNL--VAYHGKCERLHGHTYRLGVTLEGTPDEE-GMVLDFVELKRIVR 57

Query: 61  PLL-EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEY 115
             + +++DH  LN++     PTAEN+A W ++RL   L      L+SV V+ET  S V +
Sbjct: 58  EQVLDQVDHAYLNDLVP--QPTAENLARWAFQRLDAPLHRPHCRLTSVEVFETADSSVTF 115

Query: 116 Q 116
            
Sbjct: 116 Y 116


>gi|17986378|ref|NP_539012.1| vacuolar ATP synthase 16 KD proteolipid subunit [Brucella
           melitensis bv. 1 str. 16M]
 gi|17981968|gb|AAL51276.1| vacuolar ATP synthase 16 kd proteolipid subunit [Brucella
           melitensis bv. 1 str. 16M]
          Length = 148

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/104 (31%), Positives = 53/104 (50%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT+ F F A+H+L  +P  H+C R+HGH+Y VE+ +        GFV D+  +     
Sbjct: 2   FRITKEFHFSASHQLTGLPADHQCARLHGHNYIVEVELSAPDLDTHGFVRDYHELAALKH 61

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVR 104
            + +  DH  LN++   E  TAE +A   +         +S+VR
Sbjct: 62  YIDDTFDHRHLNDVLGHEQTTAERLAKHFFDWCHARWPEISAVR 105


>gi|91787389|ref|YP_548341.1| putative 6-pyruvoyl tetrahydropterin synthase [Polaromonas sp.
           JS666]
 gi|91696614|gb|ABE43443.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Polaromonas sp. JS666]
          Length = 120

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 65/105 (61%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I+Q F F+AAH L R  +     R+HGH+Y  E+ + G+ D  TG V D   + +  + 
Sbjct: 4   EISQTFYFDAAHTLKRAIEAESSKRVHGHTYNAEVFVAGEPDEATGMVMDLGLVRREIAV 63

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVY 106
           L E+LDHH L++++ L  PT E++  +I+++L   L  L+SVRV+
Sbjct: 64  LREELDHHLLDDVKGLGPPTLESLCQFIFRKLDARLPGLTSVRVW 108


>gi|322377477|ref|ZP_08051968.1| 6-pyruvoyltetrahydropterin synthase [Streptococcus sp. M334]
 gi|321281677|gb|EFX58686.1| 6-pyruvoyltetrahydropterin synthase [Streptococcus sp. M334]
          Length = 147

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/120 (35%), Positives = 66/120 (55%), Gaps = 9/120 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y +++ + G    + G   DF +I+  +   
Sbjct: 25  VSKEFTFDAAHHLFHYE--GKCKSLHGHTYHLQIAVSG-FLDERGMTYDFGDIKAVYKNY 81

Query: 63  LEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSLS-----ILSSVRVYETPMSWVEYQ 116
           LE  LDH  LNE     N TAEN+  WI++ +S  L       L  VR+YETP ++ E++
Sbjct: 82  LEPHLDHRYLNETLPYMNTTAENMVYWIFQTMSQELPDERGLRLEYVRLYETPTAFAEFR 141


>gi|270293086|ref|ZP_06199297.1| 6-pyruvoyltetrahydropterin synthase [Streptococcus sp. M143]
 gi|270279065|gb|EFA24911.1| 6-pyruvoyltetrahydropterin synthase [Streptococcus sp. M143]
          Length = 147

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/120 (35%), Positives = 66/120 (55%), Gaps = 9/120 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y +++ + G    + G   DF +I+  +   
Sbjct: 25  VSKEFTFDAAHHLFHYE--GKCKSLHGHTYHLQIAVSG-FLDERGMTYDFGDIKAIYKNF 81

Query: 63  LEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSLS-----ILSSVRVYETPMSWVEYQ 116
           LE  LDH  LNE     N TAEN+  WI++ +S  L       L  VR+YETP ++ E++
Sbjct: 82  LEPHLDHRYLNETLPYMNTTAENMVYWIFQTMSQELPDERGLRLEYVRLYETPTAFAEFR 141


>gi|327403031|ref|YP_004343869.1| hypothetical protein Fluta_1033 [Fluviicola taffensis DSM 16823]
 gi|327318539|gb|AEA43031.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Fluviicola taffensis DSM 16823]
          Length = 190

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/133 (29%), Positives = 69/133 (51%), Gaps = 18/133 (13%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCHR--MHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F AAH+L R             KC     HGH++ + + ++G+ +P+TGFV + 
Sbjct: 53  ITRREHFNAAHKLWREEWSDEKNEEVFGKCSNKNWHGHNFELFVTVKGEPNPETGFVINL 112

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI----LSSVR 104
            ++       ++E++DH  LN ++  L+    + EN+AI IWK +   +      L  ++
Sbjct: 113 KDLSVIIKELVIEEVDHKNLNLDVPFLKGKLASTENLAIEIWKIIDAPIQEAGGQLCKIK 172

Query: 105 VYETPMSWVEYQG 117
           + ET  ++VEY G
Sbjct: 173 LVETENNYVEYFG 185


>gi|238926279|ref|ZP_04658039.1| possible 6-pyruvoyltetrahydropterin synthase [Selenomonas flueggei
           ATCC 43531]
 gi|238885959|gb|EEQ49597.1| possible 6-pyruvoyltetrahydropterin synthase [Selenomonas flueggei
           ATCC 43531]
          Length = 126

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 42/117 (35%), Positives = 64/117 (54%), Gaps = 11/117 (9%)

Query: 9   FEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDH 68
           FEAAHR+   P   KC R+HGH++ VE V  G      G + DF   +     +L+  DH
Sbjct: 10  FEAAHRVVGYP--GKCDRLHGHNWVVEAVFRGTELDGLGMLIDFKTAKAALMAVLDAFDH 67

Query: 69  HCLNEIEELE---NPTAENIAIWIWKRLSTSL------SILSSVRVYETPMSWVEYQ 116
             +NE+   +   NPTAEN+A  I++RL+         + L+++ V+E+P S V Y+
Sbjct: 68  RYINELPPFDGEVNPTAENLACIIYERLAARTEVMESSAHLAALTVWESPKSSVTYE 124


>gi|322375721|ref|ZP_08050233.1| 6-pyruvoyltetrahydropterin synthase [Streptococcus sp. C300]
 gi|321279429|gb|EFX56470.1| 6-pyruvoyltetrahydropterin synthase [Streptococcus sp. C300]
          Length = 147

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/120 (35%), Positives = 66/120 (55%), Gaps = 9/120 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y +++ + G    + G   DF +I+  +   
Sbjct: 25  VSKEFTFDAAHHLFHYE--GKCKSLHGHTYHLQIAVSG-FLDERGMTYDFGDIKAIYKNY 81

Query: 63  LEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSLS-----ILSSVRVYETPMSWVEYQ 116
           LE  LDH  LNE     N TAEN+  WI++ +S  L       L  VR+YETP ++ E++
Sbjct: 82  LEPHLDHRYLNETLPYMNTTAENMVYWIFQTMSQELPDERGLRLEYVRLYETPTAFAEFR 141


>gi|306824722|ref|ZP_07458066.1| 6-pyruvoyltetrahydropterin synthase [Streptococcus sp. oral taxon
           071 str. 73H25AP]
 gi|304432933|gb|EFM35905.1| 6-pyruvoyltetrahydropterin synthase [Streptococcus sp. oral taxon
           071 str. 73H25AP]
          Length = 147

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/120 (35%), Positives = 66/120 (55%), Gaps = 9/120 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y +++ + G    + G   DF +I+  +   
Sbjct: 25  VSKEFTFDAAHHLFHYE--GKCKSLHGHTYHLQIAVSG-FLDERGMTYDFGDIKAIYKNY 81

Query: 63  LEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSLS-----ILSSVRVYETPMSWVEYQ 116
           LE  LDH  LNE     N TAEN+  WI++ +S  L       L  VR+YETP ++ E++
Sbjct: 82  LEPHLDHRYLNETLPYMNTTAENMVYWIFQTMSQELPDERSLRLEYVRLYETPTAFAEFR 141


>gi|301063546|ref|ZP_07204072.1| queuosine biosynthesis protein QueD [delta proteobacterium NaphS2]
 gi|300442355|gb|EFK06594.1| queuosine biosynthesis protein QueD [delta proteobacterium NaphS2]
          Length = 128

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/121 (32%), Positives = 63/121 (52%), Gaps = 8/121 (6%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +I     F AAH L   P    C R+HGH++ +++ +        G   DF +I++   
Sbjct: 5   FEIYVQTHFSAAHALNGYPGD--CARVHGHNWIIDVFVRCRKLDDIGIGIDFRDIKKSVK 62

Query: 61  PLLEKLDHHCLNEIEEL--ENPTAENIAIWIWKRLSTSL----SILSSVRVYETPMSWVE 114
            +L+ LDH  LN++      NPT+ENIA ++++ LS  L    + +S V+V ETP +   
Sbjct: 63  NVLKGLDHFNLNDLPVFQDMNPTSENIARFLYRELSLQLNSDTATVSKVKVSETPGAGAF 122

Query: 115 Y 115
           Y
Sbjct: 123 Y 123


>gi|260902344|ref|ZP_05910739.1| queuosine biosynthesis protein QueD [Vibrio parahaemolyticus
          AQ4037]
 gi|308106533|gb|EFO44073.1| queuosine biosynthesis protein QueD [Vibrio parahaemolyticus
          AQ4037]
          Length = 100

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 50/89 (56%), Positives = 66/89 (74%)

Query: 2  KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
          ++ + F FEAAH LP VP+ HKC R+HGHS+ V L +EG+VDP TG+V DF  I+  F P
Sbjct: 4  ELYKEFMFEAAHHLPHVPEGHKCGRLHGHSFLVRLYVEGEVDPHTGWVVDFAEIKAAFKP 63

Query: 62 LLEKLDHHCLNEIEELENPTAENIAIWIW 90
          +  +LDH+ LN+IE LENPT+E +A WIW
Sbjct: 64 IYNRLDHYYLNDIERLENPTSEVLAKWIW 92


>gi|163789310|ref|ZP_02183751.1| 6-pyruvoyl tetrahydrobiopterin synthase [Flavobacteriales bacterium
           ALC-1]
 gi|159875378|gb|EDP69441.1| 6-pyruvoyl tetrahydrobiopterin synthase [Flavobacteriales bacterium
           ALC-1]
          Length = 136

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/135 (33%), Positives = 70/135 (51%), Gaps = 18/135 (13%)

Query: 1   MKIT--QAFTFEAAHRLPRVPK--------THKCHRM--HGHSYRVELVMEGDVDPKTGF 48
           M++T  +   F AAHRL R              C+    HGH+Y +   + G++DP+TG+
Sbjct: 1   MRVTVHRKAHFNAAHRLYRKDWSFEENDAVFGLCNNPNFHGHNYELIASVTGEIDPETGY 60

Query: 49  VDDFFNIEQYFS-PLLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSL-SILS-S 102
           V D   ++      + +  DH  LN E+EE +  NPTAENIA+ I+ ++   L       
Sbjct: 61  VIDVKILKGIIKSEVEDAFDHKNLNVEVEEFKDLNPTAENIAVVIYDKVKAKLDPKFHLE 120

Query: 103 VRVYETPMSWVEYQG 117
           + +YETP ++V Y G
Sbjct: 121 ITLYETPRNFVTYSG 135


>gi|92118710|ref|YP_578439.1| putative 6-pyruvoyl tetrahydropterin synthase [Nitrobacter
           hamburgensis X14]
 gi|91801604|gb|ABE63979.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Nitrobacter hamburgensis X14]
          Length = 121

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 42/117 (35%), Positives = 62/117 (52%), Gaps = 2/117 (1%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++T++F FEAAH LP          +HGHS+R E+ + G  DP TG V D   +E+    
Sbjct: 3   ELTKSFRFEAAHSLPGTTFGAASMEIHGHSFRAEVSVRGTPDPATGMVLDLGLLERGMGE 62

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYE-TPMSWVEYQG 117
           +  KLDH  LN +E L  PT EN+A +IW  +  +   ++ V V+  +      Y G
Sbjct: 63  VRNKLDHKLLNNVEGLGPPTLENLARFIWDHVQPA-GQVTRVSVHRDSCGESCTYFG 118


>gi|218781045|ref|YP_002432363.1| queuosine biosynthesis protein QueD [Desulfatibacillum alkenivorans
           AK-01]
 gi|218762429|gb|ACL04895.1| queuosine biosynthesis protein QueD [Desulfatibacillum alkenivorans
           AK-01]
          Length = 122

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/120 (32%), Positives = 66/120 (55%), Gaps = 8/120 (6%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++     F AAHRL  V   HKC  +HGH+++VE+ ++GD   + G + DF  I++    
Sbjct: 3   ELKVKTDFAAAHRLTLV--GHKCENLHGHNWKVEVCIKGDGLDEGGVLMDFGVIKKSLRG 60

Query: 62  LLEKLDHHCLNEIEELENP--TAENIAIWIWKRLSTSL----SILSSVRVYETPMSWVEY 115
           ++E+LDH  LNE+E       ++ENIA  I  +L  ++    + + SV  +E+  +   Y
Sbjct: 61  IMEELDHKFLNELEMFSECPPSSENIARIIADKLGAAVNSDKARVYSVTAWESDNASATY 120


>gi|323141071|ref|ZP_08075976.1| queuosine biosynthesis protein QueD [Phascolarctobacterium sp. YIT
           12067]
 gi|322414447|gb|EFY05261.1| queuosine biosynthesis protein QueD [Phascolarctobacterium sp. YIT
           12067]
          Length = 118

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 47/122 (38%), Positives = 67/122 (54%), Gaps = 10/122 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M I + F F+AAH LP      KC  +HGH+Y++ + +EG  D + G V DF  ++    
Sbjct: 1   MIIIKEFDFDAAHYLPAY--NGKCEHLHGHTYKLVVKVEGTPDHE-GMVIDFIKLKNLVK 57

Query: 61  PLL-EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
             +   LDH CLN+I  L  P+AENI++W+W +L   L      L  V V+ET  S   Y
Sbjct: 58  EEVLAHLDHACLNDI--LPVPSAENISVWVWNKLVELLKSDHYHLYEVEVWETRTSGCVY 115

Query: 116 QG 117
           +G
Sbjct: 116 RG 117


>gi|315613639|ref|ZP_07888546.1| 6-pyruvoyltetrahydropterin synthase [Streptococcus sanguinis ATCC
           49296]
 gi|315314330|gb|EFU62375.1| 6-pyruvoyltetrahydropterin synthase [Streptococcus sanguinis ATCC
           49296]
          Length = 147

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 42/120 (35%), Positives = 66/120 (55%), Gaps = 9/120 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y +++ + G    + G   DF +I+  +   
Sbjct: 25  VSKEFTFDAAHHLFHYE--GKCKSLHGHTYHLQIAVSG-FLDERGMTYDFGDIKAIYKNY 81

Query: 63  LEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSLS-----ILSSVRVYETPMSWVEYQ 116
           +E  LDH  LNE     N TAEN+  WI++ +S  L       L  VR+YETP ++ E++
Sbjct: 82  IEPHLDHRYLNETLPYMNTTAENMVYWIFQTMSQELPDERGLRLEYVRLYETPTAFAEFR 141


>gi|121533883|ref|ZP_01665709.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermosinus carboxydivorans Nor1]
 gi|121307394|gb|EAX48310.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermosinus carboxydivorans Nor1]
          Length = 130

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 46/124 (37%), Positives = 67/124 (54%), Gaps = 14/124 (11%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVME------GDVDPKTGFVDDFFNI 55
           + T+ FTF+AAH LP      KC +MHGH+YR+E+ +E          P+ G V DF  +
Sbjct: 7   RTTKIFTFDAAHFLPG--HEGKCAQMHGHTYRLEVTVERKDGGVATGGPEDGMVIDFGRL 64

Query: 56  EQYFSPL-LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPM 110
                   ++KLDH  LN+      PT+EN+A  I+  LS  L+     +  V ++ETP 
Sbjct: 65  SALIKDRVVDKLDHKVLNDCFPFR-PTSENMARHIFIELSAILANEDVNVVRVVLWETPT 123

Query: 111 SWVE 114
           S+VE
Sbjct: 124 SYVE 127


>gi|329940402|ref|ZP_08289683.1| putative 6-pyruvoyl tetrahydropterin synthase [Streptomyces
           griseoaurantiacus M045]
 gi|329300463|gb|EGG44360.1| putative 6-pyruvoyl tetrahydropterin synthase [Streptomyces
           griseoaurantiacus M045]
          Length = 136

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 48/120 (40%), Positives = 66/120 (55%), Gaps = 4/120 (3%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             I + F FEA HRLPR+P  HKC R HGHSY VE+++        GFV DF  +  + S
Sbjct: 13  FTIGKKFGFEAGHRLPRLPHEHKCSRQHGHSYEVEVILTASALEDPGFVTDFGALAPFKS 72

Query: 61  PLLEKLDHHCLNEIEELENPT---AENIAIWIWKRLSTSLS-ILSSVRVYETPMSWVEYQ 116
            L  +LDHH L+EI   E  +   A+ +A W  + L + ++  L +V V ET  SW  + 
Sbjct: 73  FLDTELDHHNLHEILPFEPTSERLAQFLAGWFVQNLQSEIAGRLVAVLVRETASSWARFD 132


>gi|121997907|ref|YP_001002694.1| putative 6-pyruvoyl tetrahydropterin synthase [Halorhodospira
           halophila SL1]
 gi|121589312|gb|ABM61892.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Halorhodospira halophila SL1]
          Length = 258

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 49/114 (42%), Positives = 66/114 (57%), Gaps = 11/114 (9%)

Query: 4   TQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLL 63
            +AF FEAAHRLP VP+ H C RMHGH Y V L   G  DP+         + + ++PL 
Sbjct: 38  WRAFRFEAAHRLPYVPEGHPCGRMHGHGYLVVLEAAG-GDPE--------ALGEAWAPLG 88

Query: 64  EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           + LD  CLN+   L+NPT+E IA+W+W++L      L  + V+ET  S   Y G
Sbjct: 89  QALDRACLNDF--LDNPTSELIAVWLWEQLRPRCPGLIRLHVHETEHSGCTYDG 140



 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 2/112 (1%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           I +A  FEAA  +     T    R+HGH YR+ + +   +D   G+  D+ +++  F+P+
Sbjct: 145 IWKAQRFEAATCVADADDTR--ARLHGHGYRLRVHVTAPLDRVLGWTLDYGDVKAAFAPV 202

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVE 114
            E LDH  L+ I  LE+    ++A W  +     L  L  V  YE       
Sbjct: 203 REALDHQRLDTIAGLESGDVASLAAWAARAARQRLPELLRVDCYERDGVGAI 254


>gi|225077245|ref|ZP_03720444.1| hypothetical protein NEIFLAOT_02300 [Neisseria flavescens
           NRL30031/H210]
 gi|224951389|gb|EEG32598.1| hypothetical protein NEIFLAOT_02300 [Neisseria flavescens
           NRL30031/H210]
          Length = 140

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 45/141 (31%), Positives = 71/141 (50%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDV---DPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +   V     K G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSAPVIQGGAKDGMVMDFTDLKA 58

Query: 58  YF-SPLLEKLDHHCL----NEIEE-----LEN-----------PTAENIAIWIWKRLSTS 96
                + +  DH  +    NE E      LE             TAEN+++ I+ RL  +
Sbjct: 59  IVKQHITDPFDHAFIYHGNNERESQIAALLEGWNMKTLRLPCRTTAENMSVEIYGRLKNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              + SV+++ETP S  EY+G
Sbjct: 119 GVKVCSVKLWETPTSCAEYEG 139


>gi|217077661|ref|YP_002335379.1| queuosine biosynthesis protein QueD [Thermosipho africanus TCF52B]
 gi|217037516|gb|ACJ76038.1| queuosine biosynthesis protein QueD [Thermosipho africanus TCF52B]
          Length = 120

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 47/117 (40%), Positives = 72/117 (61%), Gaps = 10/117 (8%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L  V    KC ++HGH+Y++ + + G+ D + G V DF  +++     
Sbjct: 4   VSKEFTFDAAHNL--VKYHGKCEKLHGHTYKLVVTVAGEKDEE-GMVIDFLELKRIVQEK 60

Query: 63  L-EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVE 114
           +  +LDH  +NEI  +  P+AENIA WIWK+L T L      L  ++VYETP S+V 
Sbjct: 61  VLNRLDHSYINEI--IPQPSAENIAEWIWKQLETELHSERYFLYEIKVYETPTSYVT 115


>gi|328952438|ref|YP_004369772.1| queuosine biosynthesis protein QueD [Desulfobacca acetoxidans DSM
           11109]
 gi|328452762|gb|AEB08591.1| queuosine biosynthesis protein QueD [Desulfobacca acetoxidans DSM
           11109]
          Length = 124

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/121 (30%), Positives = 66/121 (54%), Gaps = 8/121 (6%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++     F AAHRL       KC  +HGH+++VE+ +  D   + G V DF  I+     
Sbjct: 3   ELKVITQFAAAHRLDNF--YGKCEALHGHNWKVEIFLRADGLDEAGLVMDFGKIKSRAHE 60

Query: 62  LLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
           +L ++DH  LNE+   +  NP++ENIA ++++RL  +++     +S + V+E+  +   Y
Sbjct: 61  ILSEIDHTFLNELPAFKTQNPSSENIARYLFERLGAAINNDRVTVSRISVWESDNTSASY 120

Query: 116 Q 116
            
Sbjct: 121 F 121


>gi|242372944|ref|ZP_04818518.1| possible 6-pyruvoyltetrahydropterin synthase [Staphylococcus
           epidermidis M23864:W1]
 gi|242349428|gb|EES41029.1| possible 6-pyruvoyltetrahydropterin synthase [Staphylococcus
           epidermidis M23864:W1]
          Length = 139

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 34/124 (27%), Positives = 62/124 (50%), Gaps = 12/124 (9%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ + F F AAH +P      KC R HGH+Y + + + GD     GF+ +F ++++   
Sbjct: 15  FELNKDFNFSAAHYIPS-EDAGKCMRTHGHTYFINITIAGDTLDHNGFLVNFSDLKKLIH 73

Query: 61  PLLEKLDHHCLNEIEEL--ENPTAENIAIWIWKRLSTSL------SILSSVRVYETPMSW 112
              ++ DH+ LN++     ++P+ E +A  I+  +   L           V + ETP S+
Sbjct: 74  ---DQFDHYLLNDLTPFKGKSPSTEIVAQTIYNMVQDYLSDRDNQPQCVQVYLRETPTSY 130

Query: 113 VEYQ 116
           V Y+
Sbjct: 131 VVYR 134


>gi|325129658|gb|EGC52473.1| queuosine biosynthesis protein QueD [Neisseria meningitidis
           OX99.30304]
 gi|325135883|gb|EGC58495.1| queuosine biosynthesis protein QueD [Neisseria meningitidis M0579]
 gi|325202684|gb|ADY98138.1| queuosine biosynthesis protein QueD [Neisseria meningitidis
           M01-240149]
 gi|325207570|gb|ADZ03022.1| queuosine biosynthesis protein QueD [Neisseria meningitidis
           NZ-05/33]
          Length = 140

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 42/141 (29%), Positives = 70/141 (49%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGD---VDPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +  D     PK G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSDDLVRGGPKDGMVMDFTDLKA 58

Query: 58  YF-SPLLEKLDHHCL--------NEIEEL------------ENPTAENIAIWIWKRLSTS 96
                + +  DH  +        ++I  L               TAEN+A+ ++ RL  +
Sbjct: 59  IVKQHITDPFDHAFIYHGGNGRESQIAALLEGWNMKTLRLPCRTTAENMAVEMYDRLKNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              +  V+++ETP S  EY+G
Sbjct: 119 GLNVCRVKLWETPTSCAEYEG 139


>gi|258516744|ref|YP_003192966.1| hypothetical protein Dtox_3631 [Desulfotomaculum acetoxidans DSM
           771]
 gi|257780449|gb|ACV64343.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfotomaculum acetoxidans DSM 771]
          Length = 125

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 61/122 (50%), Gaps = 8/122 (6%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++     F++AH L   P   KC  +HGH++ +E+V++G+    TG + DF  ++    
Sbjct: 5   FELKVTEHFDSAHYLREYP--GKCKNVHGHTWYIEVVLQGENLDSTGILIDFSELKGLIK 62

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
            ++E  DH  LNE    E  NPT+EN+A + +  +   LS     L  V V E+  +   
Sbjct: 63  NIIEPFDHQLLNEQVPFEVDNPTSENLARYFYHEIKKKLSDKPVKLVRVTVSESRATAAA 122

Query: 115 YQ 116
           Y 
Sbjct: 123 YF 124


>gi|307719431|ref|YP_003874963.1| 6-pyruvoyl tetrahydropterin synthase [Spirochaeta thermophila DSM
           6192]
 gi|306533157|gb|ADN02691.1| putative 6-pyruvoyl tetrahydropterin synthase [Spirochaeta
           thermophila DSM 6192]
          Length = 142

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 38/111 (34%), Positives = 56/111 (50%), Gaps = 5/111 (4%)

Query: 8   TFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLD 67
           TF AAH L       KC  +HGH+YRV     G    + G V DF  +++    +L +LD
Sbjct: 23  TFAAAHYLSSY--HGKCETLHGHNYRVRAYAAGRKLDEGGMVLDFGILKKALREVLARLD 80

Query: 68  HHCLNEIEEL-ENPTAENIAIWIWKRLSTSLSI--LSSVRVYETPMSWVEY 115
           H  LN+     ENP+AE IA ++++ +   L    +  V V+ET  +   Y
Sbjct: 81  HTNLNDHPFFQENPSAERIATYVYEEMVKKLPGTPIWKVEVFETDENLAIY 131


>gi|319891710|ref|YP_004148585.1| Queuosine biosynthesis QueD, PTPS-I [Staphylococcus
           pseudintermedius HKU10-03]
 gi|317161406|gb|ADV04949.1| Queuosine biosynthesis QueD, PTPS-I [Staphylococcus
           pseudintermedius HKU10-03]
          Length = 143

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 38/124 (30%), Positives = 65/124 (52%), Gaps = 12/124 (9%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ + F F AAH +P   +  KC R+HGH+Y V L + GD     GF+ +F  ++    
Sbjct: 15  FELNKDFNFSAAHFIPD-ERAGKCTRVHGHTYFVNLTIGGDELDSMGFLINFSELKSLIH 73

Query: 61  PLLEKLDHHCLNEIEEL--ENPTAENIAIWIWKRLSTSLSIL------SSVRVYETPMSW 112
              ++ DH+ LN++     ++P+ E +A  I+  +S  L+ L        V + ETP S+
Sbjct: 74  ---DQFDHYLLNDLVPFQGKSPSTEIVAQTIYDIVSARLAELPNAPKCLQVFLRETPTSY 130

Query: 113 VEYQ 116
           V Y+
Sbjct: 131 VVYR 134


>gi|222150714|ref|YP_002559867.1| 6-pyruvoyl tetrahydrobiopterin synthase homolog [Macrococcus
           caseolyticus JCSC5402]
 gi|222119836|dbj|BAH17171.1| 6-pyruvoyl tetrahydrobiopterin synthase homolog [Macrococcus
           caseolyticus JCSC5402]
          Length = 137

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/125 (29%), Positives = 67/125 (53%), Gaps = 12/125 (9%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ +   F AAH +P   K   C R+HGH+Y V + + G+   + GF+ +F +I+   +
Sbjct: 15  FELNKDINFSAAHLIPN-EKAGVCSRVHGHTYFVNVTIGGNELDEMGFLVNFRDIKSIIN 73

Query: 61  PLLEKLDHHCLNEIEELEN--PTAENIAIWIWKRLSTSL------SILSSVRVYETPMSW 112
              +  DH  +N++E  +N  P+ EN+A  I++++   L        +  V + ETP S+
Sbjct: 74  ---DTFDHRLMNDLEAFQNTPPSTENVAKLIFEKIEAHLDTLSHGPKVLQVYLRETPTSY 130

Query: 113 VEYQG 117
           V Y+G
Sbjct: 131 VLYRG 135


>gi|330684952|gb|EGG96631.1| queuosine biosynthesis protein QueD [Staphylococcus epidermidis
           VCU121]
          Length = 139

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 35/124 (28%), Positives = 65/124 (52%), Gaps = 12/124 (9%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ + F F AAH +P      KC R HGH+Y V + + GD     GF+ +F ++++   
Sbjct: 15  FELNKDFNFSAAHYIPS-EDAGKCMRTHGHTYFVNITIAGDELDHNGFLVNFSDLKKLIH 73

Query: 61  PLLEKLDHHCLNEIEEL--ENPTAENIAIWIWKRLSTSL------SILSSVRVYETPMSW 112
              ++ DH+ LN++ +   ++P+ E +A  I++ + + L           V + ETP S+
Sbjct: 74  ---DQFDHYLLNDLVQFKGKSPSTEIVAQTIYQMVQSYLKDQKNQPKCVQVYLRETPTSY 130

Query: 113 VEYQ 116
           V Y+
Sbjct: 131 VVYR 134


>gi|313673523|ref|YP_004051634.1| preq(0) biosynthesis protein qued [Calditerrivibrio nitroreducens
           DSM 19672]
 gi|312940279|gb|ADR19471.1| preQ(0) biosynthesis protein QueD [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 119

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 38/119 (31%), Positives = 62/119 (52%), Gaps = 5/119 (4%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            K+     F +AH L        C R+HGH+++VE+ + GD     G + DF  +++   
Sbjct: 2   FKVRVIDHFSSAHNLRGYE--GNCERLHGHNWKVEVELMGDKLDHIGMLVDFKVLKKSLK 59

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLSIL-SSVRVYETPMSWVEYQ 116
            ++++LDH  LNE    +  NPT+EN+A +I+ RL      L   V V+E+  +  EY 
Sbjct: 60  KIIDELDHTYLNEHPYFKDVNPTSENMAKYIFLRLKEDFGTLVHKVAVWESHNAVAEYF 118


>gi|153004220|ref|YP_001378545.1| putative 6-pyruvoyl tetrahydropterin synthase [Anaeromyxobacter sp.
           Fw109-5]
 gi|152027793|gb|ABS25561.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Anaeromyxobacter sp. Fw109-5]
          Length = 130

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 33/125 (26%), Positives = 62/125 (49%), Gaps = 11/125 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +I++ F F AAH++       KC R+HGH++R+ +        + G V DF ++++  +
Sbjct: 6   FEISKEFLFSAAHQIR--FHGGKCERLHGHNWRIRVHARASELNRIGMVIDFADLQRIVA 63

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLSI-------LSSVRVYETPMS 111
            +  + DH  +NEI   +  N TAE +A   ++  + ++         +S V V+E   S
Sbjct: 64  DIGGRFDHQNVNEIPPFDELNTTAELLARHFYEEANRAVLEREGGRVRVSKVEVWENEGS 123

Query: 112 WVEYQ 116
              Y+
Sbjct: 124 LAVYR 128


>gi|307707095|ref|ZP_07643892.1| queuosine biosynthesis protein QueD [Streptococcus mitis SK321]
 gi|307617621|gb|EFN96791.1| queuosine biosynthesis protein QueD [Streptococcus mitis SK321]
          Length = 147

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 42/120 (35%), Positives = 66/120 (55%), Gaps = 9/120 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y +++ + G    + G   DF +I+  +   
Sbjct: 25  VSKEFTFDAAHHLFHYE--GKCKSLHGHTYHLQIAVSG-FLDERGMTYDFGDIKAIYKNY 81

Query: 63  LEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSLS-----ILSSVRVYETPMSWVEYQ 116
           LE  LDH  LNE     N TAEN+  WI++ ++  L       L  VR+YETP ++ E++
Sbjct: 82  LEPHLDHRYLNETLPYMNTTAENMVYWIFQTMNQELPDERGLRLEYVRLYETPTAFAEFR 141


>gi|323465120|gb|ADX77273.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus
           pseudintermedius ED99]
          Length = 143

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 38/124 (30%), Positives = 65/124 (52%), Gaps = 12/124 (9%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ + F F AAH +P   +  KC R+HGH+Y V L + GD     GF+ +F  ++    
Sbjct: 15  FELNKDFNFSAAHFIPD-ERAGKCTRVHGHTYFVNLTIGGDELDSMGFLINFSELKSLIH 73

Query: 61  PLLEKLDHHCLNEIEEL--ENPTAENIAIWIWKRLSTSLSIL------SSVRVYETPMSW 112
              ++ DH+ LN++     ++P+ E +A  I+  +S  L+ L        V + ETP S+
Sbjct: 74  ---DQFDHYLLNDLVPFQGKSPSTEIVAQTIYDIVSARLAELPNAPKCLQVFLRETPTSY 130

Query: 113 VEYQ 116
           V Y+
Sbjct: 131 VIYR 134


>gi|27377593|ref|NP_769122.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bradyrhizobium japonicum
           USDA 110]
 gi|27350738|dbj|BAC47747.1| bll2482 [Bradyrhizobium japonicum USDA 110]
          Length = 121

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 40/117 (34%), Positives = 64/117 (54%), Gaps = 2/117 (1%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++T++F FEAAH L           +HGHS+R E+ + G  DP+TG V D   +++    
Sbjct: 3   ELTKSFRFEAAHSLSGTTFGAASEEIHGHSFRAEVTVRGTPDPETGMVVDLGLLQRAIED 62

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYE-TPMSWVEYQG 117
           +   LDH  LN+IE L  PT EN++ ++W+RL   +  L+ V ++  +      Y G
Sbjct: 63  VRLTLDHKFLNKIEALGKPTLENLSRFVWERLQ-HIGKLTRVSIHRDSCNESCTYYG 118


>gi|315186149|gb|EFU19911.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Spirochaeta thermophila DSM 6578]
          Length = 142

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/111 (33%), Positives = 56/111 (50%), Gaps = 5/111 (4%)

Query: 8   TFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLD 67
           TF AAH L       KC  +HGH+YRV     G    + G V DF  +++    +L +LD
Sbjct: 23  TFAAAHYLASY--HGKCETLHGHNYRVRAYAAGRKLDEGGMVLDFGILKKALREVLARLD 80

Query: 68  HHCLNEIEEL-ENPTAENIAIWIWKRLSTSLSI--LSSVRVYETPMSWVEY 115
           H  LN+     +NP+AE IA ++++ +   L    +  V V+ET  +   Y
Sbjct: 81  HTNLNDHPFFQDNPSAERIATYVYEEMVKKLPGTPIWKVEVFETDENLAVY 131


>gi|116749417|ref|YP_846104.1| putative 6-pyruvoyl tetrahydropterin synthase [Syntrophobacter
           fumaroxidans MPOB]
 gi|116698481|gb|ABK17669.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Syntrophobacter fumaroxidans MPOB]
          Length = 126

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 38/114 (33%), Positives = 65/114 (57%), Gaps = 8/114 (7%)

Query: 9   FEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDH 68
           F AAH L   P    C R+HGH++ VE+ +E     + G   DF++I++    ++ ++DH
Sbjct: 13  FSAAHLLRDYPGD--CARLHGHNWTVEVYVECRELDEIGIGIDFYDIDKALKQIMVEMDH 70

Query: 69  HCLNEIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEYQ 116
             LN++   +  NPT+EN+A ++++ LS  L      +  V+V ETP + V Y+
Sbjct: 71  CNLNDLAAFKDRNPTSENLARYVYRELSGKLDAPAIKVVKVKVCETPDAGVTYR 124


>gi|330799131|ref|XP_003287601.1| 6-pyruvoyltetrahydropterin synthase [Dictyostelium purpureum]
 gi|325082387|gb|EGC35870.1| 6-pyruvoyltetrahydropterin synthase [Dictyostelium purpureum]
          Length = 135

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 39/128 (30%), Positives = 68/128 (53%), Gaps = 13/128 (10%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFN 54
           +T+   F ++HRL               KC   HGH+Y +E+ ++G+V+P  G   +   
Sbjct: 7   LTRREVFSSSHRLFSDSLSLEENKKVYGKCINSHGHNYTLEVSVKGEVNPDIGMFMNITE 66

Query: 55  IEQYFS-PLLEKLDHHCL-NEIEELEN--PTAENIAIWIWKRLSTSLSI-LSSVRVYETP 109
           +++     +++KLDH  L  ++ EL+    T EN++I+IW +L   L   L  VR+ ET 
Sbjct: 67  LKEVIKTEVMDKLDHKNLEEDVPELKGIVTTTENLSIFIWDQLYKHLKNFLYEVRILETE 126

Query: 110 MSWVEYQG 117
            ++V Y+G
Sbjct: 127 NNFVVYRG 134


>gi|225874259|ref|YP_002755718.1| putative 6-pyruvoyl tetrahydropterin synthase [Acidobacterium
           capsulatum ATCC 51196]
 gi|225791917|gb|ACO32007.1| putative 6-pyruvoyl tetrahydropterin synthase [Acidobacterium
           capsulatum ATCC 51196]
          Length = 125

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 36/124 (29%), Positives = 64/124 (51%), Gaps = 11/124 (8%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++T    F + H L       KC   HGH+Y+V++ ++G      G + DF +++    P
Sbjct: 3   EVTVERGFSSGHYLRNYK--GKCENPHGHNYKVKITLQGKELDAAGLLLDFKDLKHVMRP 60

Query: 62  LLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLSIL--SSVRV-----YETPMSW 112
           ++++LDH  +N++E     NP+AEN+A + +   +  L+ +  S VRV     YET  + 
Sbjct: 61  VIDRLDHQMINDLEPFTQINPSAENLARYFYDETNKQLAEMTGSRVRVKDCTIYETDTTT 120

Query: 113 VEYQ 116
             Y 
Sbjct: 121 ATYY 124


>gi|209886115|ref|YP_002289972.1| 6-pyruvoyl tetrahydrobiopterin synthase [Oligotropha
           carboxidovorans OM5]
 gi|209874311|gb|ACI94107.1| 6-pyruvoyl tetrahydrobiopterin synthase [Oligotropha
           carboxidovorans OM5]
          Length = 121

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 41/117 (35%), Positives = 64/117 (54%), Gaps = 2/117 (1%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++T++F FEAAH L           +HGHS+R E+ + G  DP TG V D   +EQ  + 
Sbjct: 3   ELTKSFRFEAAHSLKGTTLGESSEEIHGHSFRAEVTVRGTPDPATGMVMDLGLLEQKIAA 62

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYE-TPMSWVEYQG 117
           +   LDH  LN+IE L  PT EN++ +IW+++  +   ++ V V+  +      Y G
Sbjct: 63  IRSALDHKFLNKIEALGVPTLENLSRYIWEQVQGA-GNVTRVSVHRDSCGESCTYFG 118


>gi|307709657|ref|ZP_07646109.1| queuosine biosynthesis protein QueD [Streptococcus mitis SK564]
 gi|307619555|gb|EFN98679.1| queuosine biosynthesis protein QueD [Streptococcus mitis SK564]
          Length = 147

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 42/120 (35%), Positives = 66/120 (55%), Gaps = 9/120 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y +++ + G    + G   DF +I+  +   
Sbjct: 25  VSKEFTFDAAHHLFHYE--GKCKSLHGHTYHLQIAVSG-FLDERGMAYDFGDIKAIYKNY 81

Query: 63  LEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSLS-----ILSSVRVYETPMSWVEYQ 116
           LE  LDH  LNE     N TAEN+  WI++ ++  L       L  VR+YETP ++ E++
Sbjct: 82  LEPHLDHRYLNETLPYMNTTAENMVYWIFQTMNQELPDERGLRLEYVRLYETPTAFAEFR 141


>gi|94264592|ref|ZP_01288376.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [delta proteobacterium MLMS-1]
 gi|93454946|gb|EAT05183.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [delta proteobacterium MLMS-1]
          Length = 122

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 56/120 (46%), Gaps = 8/120 (6%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           I     F + H L   P    C + HGH+++VE+ +  D   + G   DF +++     +
Sbjct: 4   IFTESHFSSGHHLRNYP--GNCEKPHGHNWKVEVTVRADELDQLGMGLDFRDLKGAVKEV 61

Query: 63  LEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLSIL----SSVRVYETPMSWVEYQ 116
           ++ LDH  LN+    +  NP++ENIA +I+  L   L         V V ET    V Y+
Sbjct: 62  IDDLDHRDLNDHPAFQEINPSSENIARYIFVELKKRLQNDRCRPHKVTVRETDACGVTYR 121


>gi|94266660|ref|ZP_01290337.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [delta proteobacterium MLMS-1]
 gi|93452707|gb|EAT03258.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [delta proteobacterium MLMS-1]
          Length = 122

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 56/120 (46%), Gaps = 8/120 (6%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           I     F + H L   P    C + HGH+++VE+ +  D   + G   DF +++     +
Sbjct: 4   IFTESHFSSGHHLRNYP--GNCEKPHGHNWKVEVTVRADELDQLGMGLDFRDLKGAVKEV 61

Query: 63  LEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLSIL----SSVRVYETPMSWVEYQ 116
           ++ LDH  LN+    +  NP++ENIA +I+  L   L         V V ET    V Y+
Sbjct: 62  VDDLDHRDLNDHPAFQEINPSSENIARYIFVELKKRLQNDRCRPHKVTVRETDACGVTYR 121


>gi|152979670|ref|YP_001345299.1| putative 6-pyruvoyl tetrahydropterin synthase [Actinobacillus
           succinogenes 130Z]
 gi|150841393|gb|ABR75364.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Actinobacillus succinogenes 130Z]
          Length = 139

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 39/140 (27%), Positives = 70/140 (50%), Gaps = 27/140 (19%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGD---VDPKTGFVDDFFNIEQ 57
            ++++ F+F+ AH L       KC  +HGH+Y++++ + G+     PK G V DF ++++
Sbjct: 2   FRVSKEFSFDMAHILDG--HDGKCQNLHGHTYKLQVEVSGELYRQGPKKGMVMDFADLKE 59

Query: 58  YFSP-LLEKLDHHCLNEIEELENP--------------------TAENIAIWIWKRLSTS 96
                +LE +DH  + +                           TAE +A +++ RL   
Sbjct: 60  IVKSLILEPMDHAFIYDTNSERECKIAALLTELNSKTFGIPSRTTAEEMARFMFNRLKPE 119

Query: 97  LSILSSVRVYETPMSWVEYQ 116
           L  LS+VR++ETP S+ EY+
Sbjct: 120 LP-LSAVRLWETPTSFCEYR 138


>gi|56420005|ref|YP_147323.1| 6-pyruvoyltetrahydropterin synthase [Geobacillus kaustophilus
           HTA426]
 gi|56379847|dbj|BAD75755.1| 6-pyruvoyltetrahydropterin synthase(PTP synthase) [Geobacillus
           kaustophilus HTA426]
          Length = 134

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 45/128 (35%), Positives = 69/128 (53%), Gaps = 14/128 (10%)

Query: 4   TQAFTFEAAHRLP--------RVPKTHKCHR--MHGHSYRVELVMEGDVDPKTGFVDDFF 53
           T+ + F +AHRL               KC+    HGH+Y +E+ + G  DP TG V +  
Sbjct: 2   TRRYYFSSAHRLHSDQLTNEENQRLFGKCNNRYGHGHNYCLEVTVIGKPDPITGMVVNLA 61

Query: 54  NIEQYFS-PLLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSILSSVRVYETP 109
            +++  +  +L K DH  LN + +E +  NPTAENI I IW+ L+  LS L  + ++ET 
Sbjct: 62  ELDEIVNREVLVKFDHKHLNLDTDEFKQINPTAENIVIVIWELLAPHLSSLYKIGLWETQ 121

Query: 110 MSWVEYQG 117
            ++ EY G
Sbjct: 122 KNYFEYFG 129


>gi|226226185|ref|YP_002760291.1| 6-pyruvoyl tetrahydropterin synthase family protein [Gemmatimonas
           aurantiaca T-27]
 gi|226089376|dbj|BAH37821.1| 6-pyruvoyl tetrahydropterin synthase family protein [Gemmatimonas
           aurantiaca T-27]
          Length = 137

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 66/131 (50%), Gaps = 16/131 (12%)

Query: 3   ITQAFTFEAAHRLPRV--------PKTHKCHR--MHGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+   F AAHR+               KC+    HGH+Y +++ + G V   TG+V D 
Sbjct: 6   VTRRLRFNAAHRVHNPALSDADNTRLFGKCNNPNWHGHNYTLDVSVRGPVAEDTGYVIDL 65

Query: 53  FNIEQYF-SPLLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSL--SILSSVRVY 106
             +       +L + DH   N ++  ++  NPT ENI + +W+ L  ++  + L  +R++
Sbjct: 66  GALRAIVEREVLSQTDHRNFNIDVPYMQGINPTTENIVVAMWQVLGPAIAPATLQRLRLW 125

Query: 107 ETPMSWVEYQG 117
           ET  ++V+Y G
Sbjct: 126 ETENNYVDYSG 136


>gi|299541810|ref|ZP_07052133.1| 6-pyruvoyl tetrahydrobiopterin synthase [Lysinibacillus fusiformis
           ZC1]
 gi|298725548|gb|EFI66189.1| 6-pyruvoyl tetrahydrobiopterin synthase [Lysinibacillus fusiformis
           ZC1]
          Length = 156

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 44/119 (36%), Positives = 64/119 (53%), Gaps = 9/119 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           I++ FTF+AAH L       KC  +HGH+YR  L + G  D +   +D     E +   +
Sbjct: 31  ISKEFTFDAAHHLHHYE--GKCKNLHGHTYRAILGLSGYTDERGLMIDFGDIKEIWKHKI 88

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS-------ILSSVRVYETPMSWVE 114
              LDH  LNE   L N TAENI +WI+++L+ +L         +  +R+YETP S+ E
Sbjct: 89  EIHLDHRYLNETLPLMNTTAENIVVWIYEKLTEALLDEGYNGVRVEFIRLYETPTSYAE 147


>gi|118785718|ref|XP_314842.3| AGAP008730-PA [Anopheles gambiae str. PEST]
 gi|116127868|gb|EAA10120.3| AGAP008730-PA [Anopheles gambiae str. PEST]
          Length = 175

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 42/132 (31%), Positives = 71/132 (53%), Gaps = 17/132 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+   F A HRL     +         KC+    HGH+Y VE+ + G VD KTG V + 
Sbjct: 9   LTRKECFSACHRLHSPFLSEEANRQVYGKCNNPNGHGHNYTVEVTVRGPVDGKTGMVMNI 68

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLS---TSLSILSSVRV 105
            ++++Y +  +++KLDH  L+ ++   +N   T EN+AI+IW  L        +L  +++
Sbjct: 69  TDLKEYMNQAIMKKLDHLNLDKDVPYFKNLASTTENVAIFIWDSLKLIMDKPELLYEIKI 128

Query: 106 YETPMSWVEYQG 117
           +ET  + V Y+G
Sbjct: 129 HETDKNAVIYRG 140


>gi|331265894|ref|YP_004325524.1| 6-pyruvoyl-tetrahydropterin synthase [Streptococcus oralis Uo5]
 gi|326682566|emb|CBZ00183.1| 6-pyruvoyl-tetrahydropterin synthase [Streptococcus oralis Uo5]
          Length = 147

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 43/119 (36%), Positives = 65/119 (54%), Gaps = 9/119 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y +++ + G    + G   DF +I+  +   
Sbjct: 25  VSKEFTFDAAHHLFHYE--GKCKSLHGHTYHLQVAVSG-FLDERGMTYDFGDIKAIYKNY 81

Query: 63  LEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSLS-----ILSSVRVYETPMSWVEY 115
           LE  LDH  LNE     N TAEN+  WI++ +S  L       L  VR+YETP ++ E+
Sbjct: 82  LEPHLDHRYLNETLPYMNTTAENMVYWIFQTMSQELPDERGLRLEYVRLYETPTAFAEF 140


>gi|126651678|ref|ZP_01723881.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus sp. B14905]
 gi|126591627|gb|EAZ85733.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus sp. B14905]
          Length = 157

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 42/120 (35%), Positives = 63/120 (52%), Gaps = 10/120 (8%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L +     KC  +HGH+YRV L + G  D +   +D     + +   +
Sbjct: 31  VSKEFTFDAAHHLHQYE--GKCKSLHGHTYRVVLGLSGYTDERGLMIDFGDIKKIWKQKI 88

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSS--------VRVYETPMSWVE 114
              LDH  LNE     N TAENI +WI+++L  +L             +R+YETP S+ E
Sbjct: 89  DIHLDHRYLNETLPPMNTTAENIVVWIYEKLVEALHEEQRENGACVEFIRLYETPTSYAE 148


>gi|311747881|ref|ZP_07721666.1| 6-pyruvoyl tetrahydrobiopterin synthase [Algoriphagus sp. PR1]
 gi|126575875|gb|EAZ80185.1| 6-pyruvoyl tetrahydrobiopterin synthase [Algoriphagus sp. PR1]
          Length = 136

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 46/135 (34%), Positives = 69/135 (51%), Gaps = 18/135 (13%)

Query: 1   MKIT--QAFTFEAAHRLPRVPK--------THKCHRMH--GHSYRVELVMEGDVDPKTGF 48
           MK+T  +   F AAHRL               KC+  H  GH+Y + + + G++DP+TG+
Sbjct: 1   MKVTVFRKEHFNAAHRLHNPDWSDEQNKAVFGKCNNPHFHGHNYELIVKLRGEIDPRTGY 60

Query: 49  VDDFFNIEQYFSPLL-EKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSILSS-- 102
           V D   +       + ++ DH  LN + +E    NPTAENIA+ IW  L   +       
Sbjct: 61  VYDMKLLSDLIKEFVLKRFDHKNLNLDTDEFIQLNPTAENIAVVIWNILREKIDRKFELT 120

Query: 103 VRVYETPMSWVEYQG 117
           +R+YET  ++VEY G
Sbjct: 121 IRLYETERNFVEYDG 135


>gi|20089834|ref|NP_615909.1| 6-pyruvoyltetrahydropterin synthase [Methanosarcina acetivorans
           C2A]
 gi|19914780|gb|AAM04389.1| 6-pyruvoyltetrahydropterin synthase [Methanosarcina acetivorans
           C2A]
          Length = 123

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 67/122 (54%), Gaps = 9/122 (7%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++     F AAH+L  V K  KC  +HGH++++E+ + G+     G + DF  ++Q  S
Sbjct: 2   FELKVVTHFAAAHQLKMVAK--KCENLHGHNWKIEVCVAGEKLNDAGIMMDFGELKQNVS 59

Query: 61  PLLEKLDHHCLNEIEELEN---PTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWV 113
            + + LDH+ LNE++  ++   P++ENIA++I   L   L      ++SV  +E+  +  
Sbjct: 60  EITKTLDHNFLNELDYFDDNNPPSSENIAVYIANSLKAMLKDPEIRVASVTAWESENACA 119

Query: 114 EY 115
            Y
Sbjct: 120 TY 121


>gi|66501026|ref|XP_395481.2| PREDICTED: 6-pyruvoyl tetrahydrobiopterin synthase-like isoform 1
           [Apis mellifera]
          Length = 142

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 68/132 (51%), Gaps = 17/132 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+     + HRL     T         KC+    HGH+Y VE+ + G VDP TG V + 
Sbjct: 8   LTRKEVISSCHRLHNENLTEEENKKIYGKCNNYWGHGHNYTVEVTVCGPVDPITGMVMNI 67

Query: 53  FNIEQYFSPL-LEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI---LSSVRV 105
            +++ Y   + +++LDH  L+ ++   +N   T EN+AI+++  L   +     L  V++
Sbjct: 68  SDLKLYMKKVLMDQLDHKNLDKDVPYFKNIISTTENVAIYVFNELKKIMPNSDLLYEVKI 127

Query: 106 YETPMSWVEYQG 117
           +ET  + V Y+G
Sbjct: 128 FETDKNIVIYRG 139


>gi|298209289|ref|YP_003717468.1| 6-pyruvoyltetrahydropterin synthase [Croceibacter atlanticus
           HTCC2559]
 gi|83849216|gb|EAP87085.1| 6-pyruvoyltetrahydropterin synthase [Croceibacter atlanticus
           HTCC2559]
          Length = 136

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 47/135 (34%), Positives = 70/135 (51%), Gaps = 18/135 (13%)

Query: 1   MKIT--QAFTFEAAHRLPRVPK--------THKCHR--MHGHSYRVELVMEGDVDPKTGF 48
           MK+T  +   F AAHRL R             KC     HGH+Y + + + G+VDP+TGF
Sbjct: 1   MKLTVHRKAHFNAAHRLFRKDWSDKKNNEVFGKCSNPNYHGHNYELIVSVTGNVDPETGF 60

Query: 49  VDDFFNIEQYFSPLLE-KLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSL--SILSS 102
           V D   ++      +E   DH  LN E+EE  +  PT E+I+  I+++L   +  S    
Sbjct: 61  VIDLGQLKDLIYKEIEVPFDHKNLNVEVEEFRDLIPTTEHISYVIYQKLRKHIDSSKELE 120

Query: 103 VRVYETPMSWVEYQG 117
           + +YETP ++V Y G
Sbjct: 121 ITLYETPRNFVTYSG 135


>gi|307205336|gb|EFN83684.1| 6-pyruvoyl tetrahydrobiopterin synthase [Harpegnathos saltator]
          Length = 137

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 67/131 (51%), Gaps = 16/131 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+  T   +HRL     +         KC+    HGH+Y VE+ + G VD  TG V + 
Sbjct: 6   LTRKETISCSHRLHNEHLSEQDNKLIYGKCNNFWGHGHNYTVEITIRGPVDSTTGMVMNL 65

Query: 53  FNIEQYFSPLLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI---LSSVRVY 106
            +++ Y   +L ++DH  L+ +++  ++   T EN+AI+I+  +   +     L  ++V 
Sbjct: 66  SDLKVYVQKVLGQMDHKNLDKDVDYFKSVVSTTENVAIYIFTEMKKLMPKPELLYEIKVC 125

Query: 107 ETPMSWVEYQG 117
           ET  + V Y+G
Sbjct: 126 ETDKNIVSYRG 136


>gi|328766607|gb|EGF76660.1| hypothetical protein BATDEDRAFT_28226 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 141

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 42/134 (31%), Positives = 74/134 (55%), Gaps = 19/134 (14%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+A  F AAHR+          V    KC+    HGH+YRVE+ ++G +DP TG V + 
Sbjct: 6   VTRAINFSAAHRMHSKAMTNEENVALYGKCNHVNGHGHNYRVEVSIKGKIDPITGMVLNL 65

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS-----ILSSV 103
            ++++  S  +++ LDH  ++ ++   ++   TAE I ++IW+++   L       L  V
Sbjct: 66  TDLKECMSRSIMDTLDHRNVDLDVPYFQDKVSTAEMITVYIWEQMLKYLPVSKTCSLYEV 125

Query: 104 RVYETPMSWVEYQG 117
           ++YET  + V Y+G
Sbjct: 126 KLYETNNNIVIYRG 139


>gi|148244444|ref|YP_001219138.1| 6-pyruvoyltetrahydropterin synthase [Candidatus Vesicomyosocius
           okutanii HA]
 gi|146326271|dbj|BAF61414.1| 6-pyruvoyltetrahydropterin synthase [Candidatus Vesicomyosocius
           okutanii HA]
          Length = 125

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 62/113 (54%), Gaps = 8/113 (7%)

Query: 9   FEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDH 68
           F +AH L   P    C R+HGH+++VE+++        G V DF +I++    ++++LDH
Sbjct: 10  FASAHSLRNYPGD--CSRLHGHNWQVEVMVGSKELNNNGIVIDFRDIKKQTKTVVKRLDH 67

Query: 69  HCLNEIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEY 115
             LN+I   +  NPT+EN+A + +  +   ++     + +V ++ET    V Y
Sbjct: 68  QYLNKIVPFDKLNPTSENLAKYFFDEVGRLININDVKVKAVTIWETSRVSVTY 120


>gi|326798733|ref|YP_004316552.1| hypothetical protein Sph21_1319 [Sphingobacterium sp. 21]
 gi|326549497|gb|ADZ77882.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Sphingobacterium sp. 21]
          Length = 137

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 40/135 (29%), Positives = 69/135 (51%), Gaps = 18/135 (13%)

Query: 1   MKITQAFTFEAAHRLPRVPK--------THKCHR--MHGHSYRVELVMEGDVDPKTGFVD 50
           + IT+   F AAH+L R             KC     HGH+Y + + ++G++DP TGFV 
Sbjct: 2   IYITRRERFSAAHKLYRDDWSLEENEATFGKCSNPNWHGHNYELFVTIKGEIDPATGFVM 61

Query: 51  DFFNIEQYF-SPLLEKLDHHCLNEIEEL---ENPTAENIAIWIWKRLSTSL----SILSS 102
           D   ++      ++EKLDH  +N   +    +  + E +A+ I+ +L + +    + L S
Sbjct: 62  DLRILKTIILQHVVEKLDHRNVNLDVDFMRGKMASTEVLAVEIFNQLKSPIETAGAQLHS 121

Query: 103 VRVYETPMSWVEYQG 117
           +++ ET  + VEY G
Sbjct: 122 IKLQETENNSVEYFG 136


>gi|78485733|ref|YP_391658.1| putative 6-pyruvoyl tetrahydropterin synthase [Thiomicrospira
           crunogena XCL-2]
 gi|78364019|gb|ABB41984.1| 6-pyruvoyl tetrahydrobiopterin synthase [Thiomicrospira crunogena
           XCL-2]
          Length = 125

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 36/113 (31%), Positives = 63/113 (55%), Gaps = 8/113 (7%)

Query: 9   FEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDH 68
           F +AH L   P    C ++HGH++++E+ + GD     G + DF  I+++   ++ +LDH
Sbjct: 13  FASAHSLRGYPGD--CAKLHGHNWKIEVQVVGDKLNDIGMLVDFKEIKRHAKEVISELDH 70

Query: 69  HCLNEIEEL--ENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEY 115
             LN+      +NPTAENIA +I+K++   +      + S+ V+E   + V Y
Sbjct: 71  TFLNDHPHFKEKNPTAENIAEYIYKQIQQRIQSSTVKMHSLTVWENDRNCVIY 123


>gi|327399223|ref|YP_004340092.1| queuosine biosynthesis protein QueD [Hippea maritima DSM 10411]
 gi|327181852|gb|AEA34033.1| queuosine biosynthesis protein QueD [Hippea maritima DSM 10411]
          Length = 124

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 40/122 (32%), Positives = 60/122 (49%), Gaps = 8/122 (6%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT    F AAHRL        C  +HGH++ VE+ +  D   K     DF  ++    
Sbjct: 2   FEITITDDFAAAHRLNNY--NGACENLHGHNFIVEVSVLCDKLDKAYIAIDFKELKSLTK 59

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
            ++ KLDH  LNE+E  +  NPT+E IA +I++ L  +L       S V V+E+  +   
Sbjct: 60  EIVSKLDHRYLNELEPFKSTNPTSEMIAKYIFEELKKALKDRSCKPSKVSVFESLKAKAT 119

Query: 115 YQ 116
           Y 
Sbjct: 120 YF 121


>gi|78213852|ref|YP_382631.1| 6-pyruvoyltetrahydropterin synthase [Synechococcus sp. CC9605]
 gi|78198311|gb|ABB36076.1| 6-pyruvoyltetrahydropterin synthase [Synechococcus sp. CC9605]
          Length = 306

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 45/130 (34%), Positives = 68/130 (52%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL R   +         KC R HGH  +Y V++ + G++DP+TG V D 
Sbjct: 156 LTIRTHFAAAHRLARPELSQEENEAIYGKCARPHGHGHNYLVDVTVRGEIDPRTGMVCDL 215

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSL----SILSSVR 104
             +++     ++E  DH  LN ++   E    TAENIA+ I  RLS+ +    + L  VR
Sbjct: 216 SALQRLVDDLVVEPFDHTFLNKDVPFFEECVPTAENIALHIADRLSSPIKAIGASLHKVR 275

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 276 LQESPNNAAE 285



 Score = 86.8 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 57/134 (42%), Gaps = 21/134 (15%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F A+HR                 C     HGH+Y + + M G      G V + 
Sbjct: 18  ITRRACFSASHRYWLPELSADDNAARFGPCALAPGHGHNYELIVSMAG-GLDADGMVLNL 76

Query: 53  FNIEQYF-SPLLEKLDHHCLNEI-EELEN-------PTAENIAIWIWKRLSTSLSILSSV 103
             ++    + +  +LD   LNE   E +        PT E +   IW+RLS  L  ++++
Sbjct: 77  SEVKHAIRNEVTGQLDFRFLNEAWPEFDVSTPTGCLPTTEALVRVIWQRLSPDLP-ITAL 135

Query: 104 RVYETPMSWVEYQG 117
           R+YE P  W +Y G
Sbjct: 136 RLYEQPGLWADYLG 149


>gi|56756767|gb|AAW26555.1| SJCHGC07336 protein [Schistosoma japonicum]
          Length = 145

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 38/133 (28%), Positives = 68/133 (51%), Gaps = 18/133 (13%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+  +F A HRL          V    KC+    HGH+Y++E+ + G +D  TG V + 
Sbjct: 7   LTRVESFAACHRLHSYNLSSEENVKTFQKCNNPMGHGHNYKLEITVLGPIDQTTGMVMNM 66

Query: 53  FNIEQYFSPLL-EKLDHHCLN-EIEELE----NPTAENIAIWIWKRLSTSLSI--LSSVR 104
            +++      + + LDH  ++ ++E  +      T EN+A++IW +L   +    L  V+
Sbjct: 67  NDLKSIIQEHVLDLLDHKNIDEDVEYFKKNNIVSTTENLAVFIWSQLVNIIPNNLLYEVK 126

Query: 105 VYETPMSWVEYQG 117
           V+ET  + V Y+G
Sbjct: 127 VWETDKNIVTYRG 139


>gi|322373083|ref|ZP_08047619.1| 6-pyruvoyltetrahydropterin synthase [Streptococcus sp. C150]
 gi|321278125|gb|EFX55194.1| 6-pyruvoyltetrahydropterin synthase [Streptococcus sp. C150]
          Length = 147

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 42/120 (35%), Positives = 65/120 (54%), Gaps = 9/120 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y +++ + G    + G   DF +++  +   
Sbjct: 25  VSKEFTFDAAHHLFHYE--GKCKSLHGHTYHLQIAVSG-YLDERGMTYDFGDLKNIYKNY 81

Query: 63  LEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI-----LSSVRVYETPMSWVEYQ 116
           LE  LDH  LNE     N TAEN+  WI++  S  L       L  VR+YETP ++ E++
Sbjct: 82  LEPHLDHRYLNETLPYMNTTAENMVFWIFQMTSQHLPEERGLRLEYVRLYETPTAFAEFR 141


>gi|255036334|ref|YP_003086955.1| hypothetical protein Dfer_2573 [Dyadobacter fermentans DSM 18053]
 gi|254949090|gb|ACT93790.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Dyadobacter fermentans DSM 18053]
          Length = 139

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 36/137 (26%), Positives = 63/137 (45%), Gaps = 20/137 (14%)

Query: 1   MKITQAFTFEAAHRLPRVPK--------THKC--HRMHGHSYRVELVMEGDVDPKTGFVD 50
           + +T+   F AAHRL                C  +  HGH++ + + ++G  DP+TGFV 
Sbjct: 2   IYVTRKEHFNAAHRLYNPAWSEEKNQEVFGPCANNNWHGHNFELIVTVKGKPDPETGFVI 61

Query: 51  DFFNIEQYFSPLL-EKLDHHCLNEIEELEN---PTAENIAIWIWKRLSTSL------SIL 100
           D   +       + +K+DH  LN   +       + E   + IW  L+ ++      + L
Sbjct: 62  DLKVLGDIMKRQIVDKVDHKNLNLDVDFMQGKMASCEIFVMEIWNILAPAIEQAAPNAKL 121

Query: 101 SSVRVYETPMSWVEYQG 117
             +++ ETP ++VEY G
Sbjct: 122 HYIKLIETPKNFVEYYG 138


>gi|111226648|ref|XP_001134570.1| 6-pyruvoyltetrahydropterin synthase [Dictyostelium discoideum AX4]
 gi|121962486|sp|Q1ZXI0|PTPS_DICDI RecName: Full=6-pyruvoyl tetrahydrobiopterin synthase; Short=PTP
           synthase; Short=PTPS
 gi|90970696|gb|EAS66886.1| 6-pyruvoyltetrahydropterin synthase [Dictyostelium discoideum AX4]
          Length = 135

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 39/128 (30%), Positives = 66/128 (51%), Gaps = 13/128 (10%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFN 54
           +T+   F ++HRL               KC   HGH+Y +E+ ++G V    G   +   
Sbjct: 7   LTRREVFSSSHRLYSDKLSLEENKKIYGKCINSHGHNYVLEVSIKGAVKEDIGMFMNITE 66

Query: 55  IEQYFSPL-LEKLDHHCL-NEIEELEN--PTAENIAIWIWKRLSTSLSI-LSSVRVYETP 109
           +++      ++KLDH  L N++ EL+    T EN++I+IW +L  SL   L  V++ ET 
Sbjct: 67  LKEILKEKVMDKLDHKNLENDVPELKGIVTTTENLSIFIWDQLFPSLKDFLYEVKILETE 126

Query: 110 MSWVEYQG 117
            ++V Y+G
Sbjct: 127 NNFVVYRG 134


>gi|224368257|ref|YP_002602420.1| PtpS [Desulfobacterium autotrophicum HRM2]
 gi|223690973|gb|ACN14256.1| PtpS [Desulfobacterium autotrophicum HRM2]
          Length = 127

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 38/123 (30%), Positives = 64/123 (52%), Gaps = 10/123 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++     F AAH+L  V    KC  +HGH++ VE+ + G+   + G + DF  I+ +  
Sbjct: 2   FELKVKTHFAAAHKLAMV--GEKCENLHGHNWDVEVYVAGEQLNEAGVLVDFGVIKGFVR 59

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLS------ILSSVRVYETPMSW 112
            ++++LDH  LNE++      P++E IAI+I  RL  SL        +S V  +E+  + 
Sbjct: 60  KIMKELDHKYLNELDAFADVQPSSEQIAIYIANRLKPSLKGFHPPVRVSRVSAWESANAC 119

Query: 113 VEY 115
             Y
Sbjct: 120 ATY 122


>gi|256084350|ref|XP_002578393.1| pyruvoyl tetrahydrobiopterin synthase [Schistosoma mansoni]
 gi|238663764|emb|CAZ34631.1| pyruvoyl tetrahydrobiopterin synthase, putative [Schistosoma
           mansoni]
          Length = 145

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 36/133 (27%), Positives = 70/133 (52%), Gaps = 18/133 (13%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+  +F A HRL          +    KC+    HGH+Y++E+ + G +D +TG V + 
Sbjct: 7   LTRVESFSACHRLHSQHLSDEENIKMFQKCNNPMGHGHNYKLEITVSGPIDQRTGMVMNI 66

Query: 53  FNIEQYFSPLL-EKLDHHCLN-EIEELE----NPTAENIAIWIWKRLSTSLSI--LSSVR 104
            +++      + + LDH  ++ ++E  +      T EN+A++IW +L  ++    L  V+
Sbjct: 67  SDLKSVIQKHVLDLLDHKNIDEDVEYFKKNSIVSTTENLAVFIWSQLVNAVPNNLLYEVK 126

Query: 105 VYETPMSWVEYQG 117
           ++ET  + V Y+G
Sbjct: 127 IWETEKNIVTYRG 139


>gi|218781984|ref|YP_002433302.1| queuosine biosynthesis protein QueD [Desulfatibacillum alkenivorans
           AK-01]
 gi|218763368|gb|ACL05834.1| queuosine biosynthesis protein QueD [Desulfatibacillum alkenivorans
           AK-01]
          Length = 126

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 36/121 (29%), Positives = 63/121 (52%), Gaps = 8/121 (6%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +I     F AAH L        C R+HGH++ VE+ ++       G   DF +++    
Sbjct: 5   FEIYVKTHFSAAHALTGYDGD--CSRIHGHNWMVEVSIQCRKLDDVGIGIDFKDVKDAVE 62

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
            + + LDH  LN+    +  NPT+EN+A++++K+L + L+     +S V+V+E P +   
Sbjct: 63  EITQGLDHCMLNDHPAFQSVNPTSENVAMFLYKQLGSHLNNEYTKVSRVKVFEAPGAGAA 122

Query: 115 Y 115
           Y
Sbjct: 123 Y 123


>gi|309379632|emb|CBX21803.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 140

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 41/141 (29%), Positives = 69/141 (48%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVME---GDVDPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +        PK G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSDGIVSGGPKDGMVMDFTDLKA 58

Query: 58  YF-SPLLEKLDHHCL--------NEIEEL------------ENPTAENIAIWIWKRLSTS 96
                + +  DH  +        ++I  L               TAEN+A+ ++ RL  +
Sbjct: 59  IVKQHITDPFDHAFIYHGGNGRESQIAALLEGWNMKTLRLPCRTTAENMAVEMYDRLQNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              +  V+++ETP S  EY+G
Sbjct: 119 GLNVCGVKLWETPTSCAEYEG 139


>gi|241759464|ref|ZP_04757568.1| queuosine biosynthesis protein QueD [Neisseria flavescens SK114]
 gi|241320246|gb|EER56579.1| queuosine biosynthesis protein QueD [Neisseria flavescens SK114]
          Length = 140

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 44/141 (31%), Positives = 72/141 (51%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDV---DPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +   V     K G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSAPVIQGGAKDGMVMDFTDLKA 58

Query: 58  YF-SPLLEKLDHHCL----NEIEE-----LEN-----------PTAENIAIWIWKRLSTS 96
                + +  DH  +    NE E      LE+            TAEN+++ ++ RL  +
Sbjct: 59  IVKQHITDPFDHAFIYHGNNERESQIAALLEDWNMKTLRLPCRTTAENMSVEMYGRLKNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              + SV+++ETP S  EY+G
Sbjct: 119 GVKVCSVKLWETPTSCAEYEG 139


>gi|73663318|ref|YP_302099.1| 6-pyruvoyl tetrahydropterin synthase [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
 gi|72495833|dbj|BAE19154.1| putative 6-pyruvoyl tetrahydropterin synthase [Staphylococcus
           saprophyticus subsp. saprophyticus ATCC 15305]
          Length = 141

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 41/124 (33%), Positives = 64/124 (51%), Gaps = 12/124 (9%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ + F F AAH +P      KC R HGH+Y V L + GD     GF+ +F  ++Q   
Sbjct: 15  FELNKDFNFSAAHYIPS-EDAGKCMRTHGHTYFVNLTIAGDTLDHNGFLVNFSELKQLVH 73

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSL------SILSSVRVYETPMSW 112
               + DH+ LN++ + E  +P+ E +A  I++ + TSL           V V ETP S+
Sbjct: 74  ---GQFDHYLLNDLPQFEGKSPSTEIVAQTIYEMVQTSLNQRDNQPKCLQVYVRETPTSY 130

Query: 113 VEYQ 116
           V Y+
Sbjct: 131 VVYR 134


>gi|290580633|ref|YP_003485025.1| putative 6-pyruvoyl tetrahydropterin synthase [Streptococcus mutans
           NN2025]
 gi|254997532|dbj|BAH88133.1| putative 6-pyruvoyl tetrahydropterin synthase [Streptococcus mutans
           NN2025]
          Length = 148

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 40/120 (33%), Positives = 67/120 (55%), Gaps = 9/120 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y +++ +      + G   DF ++++ +   
Sbjct: 25  VSKEFTFDAAHHLFNYE--GKCKALHGHTYHLQIAVSA-FLDERGMTYDFRDLKRIYQEY 81

Query: 63  LEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSLS-----ILSSVRVYETPMSWVEYQ 116
           LE  LDH  LNE     N TAEN+  WI+K +  +L+      +  VR+YETP ++ E++
Sbjct: 82  LEPKLDHRYLNESLPYMNTTAENMVYWIYKTVEKALTDERGLQMEHVRLYETPSAYAEFR 141


>gi|24379364|ref|NP_721319.1| putative 6-pyruvoyl tetrahydropterin synthase [Streptococcus mutans
           UA159]
 gi|24377291|gb|AAN58625.1|AE014932_8 putative 6-pyruvoyl tetrahydropterin synthase [Streptococcus mutans
           UA159]
          Length = 148

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 40/120 (33%), Positives = 65/120 (54%), Gaps = 9/120 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF AAH L       KC  +HGH+Y +++ +      + G   DF  +++ +   
Sbjct: 25  VSKEFTFNAAHHLFNYE--GKCKALHGHTYHLQVAVSA-FLDERGMTYDFRELKRIYQEY 81

Query: 63  LEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSLS-----ILSSVRVYETPMSWVEYQ 116
           LE  LDH  LNE     N TAEN+  WI+K +  +L+      +  VR+YETP ++ E++
Sbjct: 82  LEPKLDHRYLNESLPYMNTTAENMVYWIYKTVEKALTDERGLQMEHVRLYETPSAYAEFR 141


>gi|304437069|ref|ZP_07397032.1| possible 6-pyruvoyltetrahydropterin synthase [Selenomonas sp. oral
           taxon 149 str. 67H29BP]
 gi|304370020|gb|EFM23682.1| possible 6-pyruvoyltetrahydropterin synthase [Selenomonas sp. oral
           taxon 149 str. 67H29BP]
          Length = 126

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 43/118 (36%), Positives = 64/118 (54%), Gaps = 13/118 (11%)

Query: 9   FEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDH 68
           FEAAHR+   P   KC R+HGH++ VE V  G      G + DF   +     +L++ DH
Sbjct: 10  FEAAHRVVGYP--GKCDRLHGHNWVVEAVFRGTELDDLGMMIDFKTAKAALMAVLDEFDH 67

Query: 69  HCLNEIEELE---NPTAENIAIWIWKRLSTSLSIL-------SSVRVYETPMSWVEYQ 116
             +NEI   +   NPTAEN+A  I++RL+     +       +++ V+ETP S V Y+
Sbjct: 68  RYINEIPPFDAAANPTAENLARIIFERLAVR-PEVTATAAHLAALTVWETPKSSVTYE 124


>gi|91200772|emb|CAJ73825.1| conserved hypothetical protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 121

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 61/121 (50%), Gaps = 7/121 (5%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++     F AAH L       +C  +HGH+++V++V++ +     G V DF   ++   
Sbjct: 2   FELIIDTDFAAAHNLRGYK--GQCENLHGHNWKVQVVLKSEKLDNLGMVIDFREAKKLIG 59

Query: 61  PLLEKLDHHCLNEIEEL--ENPTAENIAIWIWKRLSTSLS---ILSSVRVYETPMSWVEY 115
            + +K DH  LN++E    ENPT ENI+  I++ L++++     +  V  +E+      Y
Sbjct: 60  DVTKKFDHTYLNDMEHFKAENPTTENISRMIYRELTSAMPSGIKVEKVTTWESDRCGATY 119

Query: 116 Q 116
            
Sbjct: 120 F 120


>gi|239636676|ref|ZP_04677678.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus warneri
           L37603]
 gi|239598031|gb|EEQ80526.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus warneri
           L37603]
          Length = 139

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 35/124 (28%), Positives = 65/124 (52%), Gaps = 12/124 (9%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ + F F AAH +P      KC R HGH+Y V + + GD     GF+ +F ++++   
Sbjct: 15  FELNKDFNFSAAHYIPS-EDAGKCMRTHGHTYFVNITIAGDELDHNGFLVNFSDLKKLIH 73

Query: 61  PLLEKLDHHCLNEIEEL--ENPTAENIAIWIWKRLSTSL------SILSSVRVYETPMSW 112
              ++ DH+ LN++ +   ++P+ E +A  I++ + + L           V + ETP S+
Sbjct: 74  ---DQFDHYLLNDLVQFKGKSPSTEIVAQTIYQMVQSYLKDQKNHPKCVQVYLRETPTSY 130

Query: 113 VEYQ 116
           V Y+
Sbjct: 131 VVYR 134


>gi|261401299|ref|ZP_05987424.1| queuosine biosynthesis protein QueD [Neisseria lactamica ATCC
           23970]
 gi|269208678|gb|EEZ75133.1| queuosine biosynthesis protein QueD [Neisseria lactamica ATCC
           23970]
          Length = 140

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 40/141 (28%), Positives = 69/141 (48%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVME---GDVDPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +        PK G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSDGIVSGGPKDGMVMDFTDLKA 58

Query: 58  YF-SPLLEKLDHHCL-----------------NEIEELE---NPTAENIAIWIWKRLSTS 96
                + +  DH  +                  +++ L      TAEN+A+ ++ RL  +
Sbjct: 59  IVKQHITDPFDHAFIYHGGNGRESQIAALLEGWDMKTLRLPCRTTAENMAVEMYGRLQNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              +  V+++ETP S  EY+G
Sbjct: 119 GLNVCGVKLWETPTSCAEYEG 139


>gi|299137839|ref|ZP_07031020.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Acidobacterium sp. MP5ACTX8]
 gi|298600480|gb|EFI56637.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Acidobacterium sp. MP5ACTX8]
          Length = 137

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 46/133 (34%), Positives = 66/133 (49%), Gaps = 16/133 (12%)

Query: 1   MKITQAFTFEAAHRLPRVPK--------THKCHR--MHGHSYRVELVMEGDVDPKTGFVD 50
           + +T+   F AAH                 KC     HGH+Y +E+ +EG+VDP +GFV 
Sbjct: 2   ILLTRKADFSAAHFYWNDSWTEAENFRVFGKCANRQGHGHNYTLEVTVEGEVDPVSGFVV 61

Query: 51  DFFNIEQYF-SPLLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVR 104
           D   ++      ++   DH  LN E+ E +   PT ENIAI IW+RL   +    L  VR
Sbjct: 62  DLKQLKDILEQEVVSVYDHRHLNHEVPEFKTAVPTTENIAIAIWRRLDGKVPNAKLHRVR 121

Query: 105 VYETPMSWVEYQG 117
           VYE P  + ++ G
Sbjct: 122 VYEMPELFADFYG 134


>gi|228475310|ref|ZP_04060034.1| 6-pyruvoyltetrahydropterin synthase [Staphylococcus hominis SK119]
 gi|314936990|ref|ZP_07844337.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus
           hominis subsp. hominis C80]
 gi|228270686|gb|EEK12100.1| 6-pyruvoyltetrahydropterin synthase [Staphylococcus hominis SK119]
 gi|313655609|gb|EFS19354.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus
           hominis subsp. hominis C80]
          Length = 139

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 63/124 (50%), Gaps = 12/124 (9%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ + F F AAH +P      KC R HGH+Y V L + GD     GF+ +F  +++   
Sbjct: 15  FELNKDFNFSAAHFIPS-EDAGKCMRTHGHTYFVNLTIVGDALDHNGFLINFSELKRLVH 73

Query: 61  PLLEKLDHHCLNEIEELEN--PTAENIAIWIWKRLSTSL------SILSSVRVYETPMSW 112
              ++ DH+ LNE+ + ++  P+ E +A  I++ +   L           V + ETP S+
Sbjct: 74  ---DQFDHYLLNELPQFKDKSPSTEIVAQTIFEIVQAHLNEYDNKPKCVQVYLRETPSSY 130

Query: 113 VEYQ 116
           V Y+
Sbjct: 131 VVYR 134


>gi|73749379|ref|YP_308618.1| 6-pyruvoyl tetrahydrobiopterin synthase [Dehalococcoides sp. CBDB1]
 gi|73661095|emb|CAI83702.1| 6-pyruvoyl tetrahydrobiopterin synthase [Dehalococcoides sp. CBDB1]
          Length = 123

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 42/120 (35%), Positives = 63/120 (52%), Gaps = 8/120 (6%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           ++    FEAAH L       KC  +HGH Y V L ++     + G   DF  ++   + +
Sbjct: 4   LSVKKHFEAAHFLRGYK--GKCENLHGHRYEVALKVKTGELDECGMGADFSLLKTRLNEV 61

Query: 63  LEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEYQ 116
           L+  DH CLN++   +  NP+AENIA  I+ +L T ++     L  V V+E+P S V YQ
Sbjct: 62  LQSYDHTCLNDLTPFDNINPSAENIAKDIYDKLKTVINKKGVELWGVEVWESPDSSVLYQ 121


>gi|320353478|ref|YP_004194817.1| preQ(0) biosynthesis protein QueD [Desulfobulbus propionicus DSM
           2032]
 gi|320121980|gb|ADW17526.1| preQ(0) biosynthesis protein QueD [Desulfobulbus propionicus DSM
           2032]
          Length = 122

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 60/123 (48%), Gaps = 8/123 (6%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M +     F   H L   P    C   HGH+++V++ +      + G   DF  ++Q  +
Sbjct: 1   MDVFIKTHFSGGHHLRAYP--GNCENPHGHNWKVKVTVRASQLDQLGMGIDFKQLKQTVN 58

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
            ++++LDH  LNE       NP++E+IA++++  L   L+     L SV V ET  + V 
Sbjct: 59  AVVDELDHRDLNEHPAFREINPSSEHIAMFLFDSLRPRLTTERYRLYSVEVRETDSTGVI 118

Query: 115 YQG 117
           Y G
Sbjct: 119 YYG 121


>gi|260436033|ref|ZP_05790003.1| 6-pyruvoyltetrahydropterin synthase [Synechococcus sp. WH 8109]
 gi|260413907|gb|EEX07203.1| 6-pyruvoyltetrahydropterin synthase [Synechococcus sp. WH 8109]
          Length = 244

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 46/130 (35%), Positives = 67/130 (51%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL R   T         KC R HGH  +Y V++ + G +DP+TG V D 
Sbjct: 94  LTIRTHFAAAHRLARPELTQEENEAIYGKCARPHGHGHNYLVDVTVRGQIDPRTGMVCDL 153

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSL----SILSSVR 104
             +++     ++E  DH  LN ++   E    TAENIA+ I  RLS+ +    + L  VR
Sbjct: 154 SALQRLVDDLVVEPFDHTFLNKDVPFFEECVPTAENIALHIADRLSSPIKAIGASLHKVR 213

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 214 LQESPNNAAE 223



 Score = 53.2 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 10/84 (11%)

Query: 43  DPKTGFVDDFFNIEQYF-SPLLEKLDHHCLNEI-EELEN-------PTAENIAIWIWKRL 93
               G V +   ++    + +  +LD   LNE   E +        PT E +   IW+RL
Sbjct: 5   LDADGMVLNLSEVKHAIRNEVTGQLDFRFLNEAWPEFDVATPQGCLPTTEALVRVIWQRL 64

Query: 94  STSLSILSSVRVYETPMSWVEYQG 117
           S  L  ++++R+YE P  W +Y G
Sbjct: 65  SPHLP-ITALRLYEQPGLWADYLG 87


>gi|254411226|ref|ZP_05025003.1| 6-pyruvoyl tetrahydropterin synthase family [Microcoleus
           chthonoplastes PCC 7420]
 gi|196181727|gb|EDX76714.1| 6-pyruvoyl tetrahydropterin synthase family [Microcoleus
           chthonoplastes PCC 7420]
          Length = 290

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/130 (31%), Positives = 67/130 (51%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRV--------PKTHKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           +T +  F AAHRL               KC     HGH+Y +E+ ++G++DP+TG + D 
Sbjct: 138 LTISTHFSAAHRLAHPQLSYDQNCEIYGKCARPNGHGHNYHLEVTVKGEIDPRTGMIVDL 197

Query: 53  FNIEQYFSPL-LEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSL----SILSSVR 104
             +++      +E  DH  LN +I   +   PTAENIAI+I + L + +    + L  V+
Sbjct: 198 GALQKVIDDYVVEPFDHTFLNKDIPYFDQVVPTAENIAIYIRQLLQSPIQKLGAKLHKVK 257

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 258 LIESPNNSCE 267



 Score = 83.7 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 34/129 (26%), Positives = 61/129 (47%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHR----------MHGHSYRVELVMEGDVDPKTGFVDDF 52
           I +   F A+HR      +   ++           HGH+Y + + +EGD   + G V + 
Sbjct: 5   INRRAQFSASHRYWLPELSEAQNQQQFGRGAQFPGHGHNYVLFVSLEGD-LDEYGMVQNL 63

Query: 53  FNIEQYF-SPLLEKLDHHCLNEI-EELEN--PTAENIAIWIWKRLSTSLSILSSVRVYET 108
             +++     +  +LD+  LN    + +   PT ENIA  IW++L+  L  L  ++++E 
Sbjct: 64  SQVKKVIKQEVTSQLDYAYLNHTWLDFQETLPTTENIARVIWQKLAPYLP-LVKIQLFEH 122

Query: 109 PMSWVEYQG 117
           P  W +Y G
Sbjct: 123 PELWADYLG 131


>gi|238761645|ref|ZP_04622620.1| 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia kristensenii ATCC
           33638]
 gi|238700159|gb|EEP92901.1| 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia kristensenii ATCC
           33638]
          Length = 85

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/84 (44%), Positives = 55/84 (65%)

Query: 34  VELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEELENPTAENIAIWIWKRL 93
           + + + G+VD  +G+V DF  ++  F P+ E+LDHH LN+I  LENPT+E +A WIW++L
Sbjct: 2   IRIEVTGEVDAHSGWVMDFAELKAAFKPIWERLDHHYLNDIPGLENPTSEVLASWIWQQL 61

Query: 94  STSLSILSSVRVYETPMSWVEYQG 117
              L  LS+V V ET  +   Y+G
Sbjct: 62  KPQLPELSAVMVKETCSAGCVYRG 85


>gi|227825174|ref|ZP_03990006.1| queuosine biosynthesis protein queD [Acidaminococcus sp. D21]
 gi|226905673|gb|EEH91591.1| queuosine biosynthesis protein queD [Acidaminococcus sp. D21]
          Length = 120

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 47/122 (38%), Positives = 69/122 (56%), Gaps = 10/122 (8%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M   + F F+AAH LP      KC  +HGH+Y++ + +EG  D + G V DF   +    
Sbjct: 1   MICLKEFDFDAAHFLPNY--NGKCEHLHGHTYKLVVKVEGTPDHE-GMVLDFVRFKNLVK 57

Query: 61  P-LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEY 115
             ++ KLDH  +N+I  L  P+AENIA+W+W++L T L      L  V V+ET  S + Y
Sbjct: 58  ELVVSKLDHAFINDI--LPQPSAENIAVWVWQQLETPLHGPNYHLFEVEVWETKTSGIIY 115

Query: 116 QG 117
           +G
Sbjct: 116 RG 117


>gi|172058909|ref|YP_001815369.1| queuosine biosynthesis protein QueD [Exiguobacterium sibiricum
           255-15]
 gi|171991430|gb|ACB62352.1| queuosine biosynthesis protein QueD [Exiguobacterium sibiricum
           255-15]
          Length = 151

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 43/120 (35%), Positives = 63/120 (52%), Gaps = 9/120 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           I +  TF+AAH L       KC  +HGH+Y V+L + G      G   DF ++++ F   
Sbjct: 28  IVKKLTFDAAHHL--YDYDGKCRALHGHTYHVDLGISG-FLDHRGMTLDFGDLKKIFKEH 84

Query: 63  LEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSLS-----ILSSVRVYETPMSWVEYQ 116
           LE  LDH  LNE     N TAEN++ WI++ L   L       +  V++YETP ++ E +
Sbjct: 85  LEPLLDHRYLNESLPYMNTTAENMSAWIFETLGKHLPDERGLRVEFVKLYETPTAFAEVR 144


>gi|322392673|ref|ZP_08066133.1| 6-pyruvoyltetrahydropterin synthase [Streptococcus peroris ATCC
           700780]
 gi|321144665|gb|EFX40066.1| 6-pyruvoyltetrahydropterin synthase [Streptococcus peroris ATCC
           700780]
          Length = 147

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 44/120 (36%), Positives = 64/120 (53%), Gaps = 9/120 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y +++ + G      G   DF +I+Q +   
Sbjct: 25  VSKEFTFDAAHHLFHYE--GKCKSLHGHTYHLQIAVSG-FLDDRGMTYDFGDIKQIYKNH 81

Query: 63  LEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSLS-----ILSSVRVYETPMSWVEYQ 116
           LE  LDH  LNE     N TAEN+  WI+  +   L       L  VR+YETP S+ E++
Sbjct: 82  LEPHLDHRYLNETLPYMNTTAENMVYWIFNTIQQELPDQRGLRLEYVRLYETPSSFAEFR 141


>gi|261378239|ref|ZP_05982812.1| queuosine biosynthesis protein QueD [Neisseria cinerea ATCC 14685]
 gi|269145317|gb|EEZ71735.1| queuosine biosynthesis protein QueD [Neisseria cinerea ATCC 14685]
          Length = 144

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/141 (29%), Positives = 68/141 (48%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVME---GDVDPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +        PK G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSDGIVRGGPKDGMVMDFTDLKA 58

Query: 58  YFSPL-LEKLDHHCL-----------------NEIEELE---NPTAENIAIWIWKRLSTS 96
                  +  DH  +                   ++ L      TAEN++I ++ RL  +
Sbjct: 59  IVKKYITDPFDHAFIYHGDNGRECQIAALLEGWNMKTLRLPCRTTAENMSIEMYDRLKNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              + SV+++ETP S  EY+G
Sbjct: 119 GLNVCSVKLWETPTSCAEYEG 139


>gi|319639354|ref|ZP_07994105.1| 6-pyruvoyl tetrahydrobiopterin synthase [Neisseria mucosa C102]
 gi|317399538|gb|EFV80208.1| 6-pyruvoyl tetrahydrobiopterin synthase [Neisseria mucosa C102]
          Length = 140

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 44/141 (31%), Positives = 71/141 (50%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDV---DPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +   V     K G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSAPVIQGGAKDGMVMDFTDLKA 58

Query: 58  YF-SPLLEKLDHHCL----NEIEE-----LEN-----------PTAENIAIWIWKRLSTS 96
                + +  DH  +    NE E      LE             TAEN+++ ++ RL  +
Sbjct: 59  IVKQHITDPFDHAFIYHGNNERESQIAALLEGWNMKTLRLPCRTTAENMSVEMYGRLKNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              + SV+++ETP S  EY+G
Sbjct: 119 GVKVCSVKLWETPTSCAEYEG 139


>gi|226940052|ref|YP_002795125.1| 6-pyruvoyltetrahydrobiopterin synthase [Laribacter hongkongensis
           HLHK9]
 gi|226714978|gb|ACO74116.1| Probable 6-pyruvoyltetrahydrobiopterin synthase [Laribacter
           hongkongensis HLHK9]
          Length = 331

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 46/116 (39%), Positives = 63/116 (54%), Gaps = 7/116 (6%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I  +  F+AAH LP VP  H+C R+HGH + V LV +           D   +   + P
Sbjct: 105 RICISGHFDAAHWLPHVPDGHQCGRLHGHGFGVRLVADAGQ-------HDAAALYSAWQP 157

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           L   L H  LN+I  L NPT+E +A WIW++L  SLS L +V V+ET  +   Y G
Sbjct: 158 LHATLHHRLLNDIAGLSNPTSEMLACWIWQQLQPSLSGLQAVEVFETASAGSRYDG 213



 Score = 86.4 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 37/114 (32%), Positives = 54/114 (47%), Gaps = 6/114 (5%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +I +   FEAA     VP  H      GHSY V LV+ G +   TG+V DF  I+  F 
Sbjct: 216 FRIWKEQRFEAA-----VPFDH-AGHYTGHSYLVRLVLTGIMSNHTGWVRDFGEIKARFK 269

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVE 114
           P+  +LDHH L+ +  ++      IA WI +  + S+  L  + + E P     
Sbjct: 270 PVYAQLDHHPLDRLPAIDATDCAGIARWIAREFAESVPELCRIDLLENPDEGAV 323


>gi|159900636|ref|YP_001546883.1| putative 6-pyruvoyl tetrahydropterin synthase [Herpetosiphon
           aurantiacus ATCC 23779]
 gi|159893675|gb|ABX06755.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Herpetosiphon aurantiacus ATCC 23779]
          Length = 133

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 44/122 (36%), Positives = 67/122 (54%), Gaps = 13/122 (10%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDP-----KTGFVDDFFNIEQ 57
           +T+ F FEAAH+LP      KC R+HGHSY +E+ + G + P       G V D   I+Q
Sbjct: 5   LTKQFRFEAAHQLPN--HRGKCARLHGHSYLLEVSVRGLIQPTRGQSDDGMVIDLEQIKQ 62

Query: 58  YFSP-LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSW 112
             +  ++ ++DH+ LN+   +   TAENIA W+W +L          L  +R++ET   +
Sbjct: 63  LVNEIIIARVDHYNLNDFLSVP-STAENIAHWMWDQLEQQAPEFAALLWRIRLWETASGY 121

Query: 113 VE 114
           VE
Sbjct: 122 VE 123


>gi|313674783|ref|YP_004052779.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Marivirga tractuosa DSM 4126]
 gi|312941481|gb|ADR20671.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Marivirga tractuosa DSM 4126]
          Length = 136

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/129 (31%), Positives = 64/129 (49%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           + +   F AAHRL               KC+    HGH+Y + + + G+VDP TG+V D 
Sbjct: 5   VFRKEHFNAAHRLNNPNWSEEKNQKVFGKCNNPNFHGHNYELIVKVTGEVDPDTGYVMDM 64

Query: 53  FNIEQYFSPLL-EKLDHHCLN-EIEEL--ENPTAENIAIWIWKRLSTSL--SILSSVRVY 106
             +       + ++ DH  LN + +E    NPTAENIA+ I+  L   +       +++Y
Sbjct: 65  KVLSDLIKERVLDRFDHKNLNLDTKEFLDLNPTAENIAVVIFNLLREKIDPKKELKIKLY 124

Query: 107 ETPMSWVEY 115
           ET  ++VEY
Sbjct: 125 ETERNYVEY 133


>gi|311067887|ref|YP_003972810.1| 6-pyruvoyl tetrahydrobiopterin synthase-like; queuosine
           biosynthesis [Bacillus atrophaeus 1942]
 gi|310868404|gb|ADP31879.1| 6-pyruvoyl tetrahydrobiopterin synthase-like; queuosine
           biosynthesis [Bacillus atrophaeus 1942]
          Length = 146

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/128 (28%), Positives = 59/128 (46%), Gaps = 16/128 (12%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ +     AAH +PR      C R+HGH+Y V + + GD    +GF+ +F  +++   
Sbjct: 15  FELNKDMHISAAHFIPR-ESAGACSRVHGHTYTVNITVAGDELDDSGFLVNFSVLKKLVH 73

Query: 61  PLLEKLDHHCLNEIEELEN------PTAENIAIWIWKRLSTSL------SILSSVRVYET 108
                 DH  LN+ +E  N      PT E +A  I+ ++ + L           V V ET
Sbjct: 74  ---GSYDHTLLNDHDEFSNDDPYSLPTTEVVAKTIYNKVQSYLETLANKPACVQVFVRET 130

Query: 109 PMSWVEYQ 116
           P S+  Y+
Sbjct: 131 PTSYCVYR 138


>gi|238758187|ref|ZP_04619366.1| 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia aldovae ATCC
           35236]
 gi|238703517|gb|EEP96055.1| 6-pyruvoyl tetrahydrobiopterin synthase [Yersinia aldovae ATCC
           35236]
          Length = 86

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/84 (44%), Positives = 56/84 (66%)

Query: 34  VELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEELENPTAENIAIWIWKRL 93
           + + + G+VD  +G+V DF  ++  F+P+ E+LDHH LN+I  LENPT+E +A WIW++L
Sbjct: 2   IRIEVTGEVDAHSGWVMDFAELKAAFNPIWERLDHHYLNDIPGLENPTSEVLASWIWQQL 61

Query: 94  STSLSILSSVRVYETPMSWVEYQG 117
              L  LS+V V ET  +   Y+G
Sbjct: 62  KPQLPELSAVMVKETCSAGCVYRG 85


>gi|120602760|ref|YP_967160.1| 6-pyruvoyl tetrahydropterin synthase [Desulfovibrio vulgaris DP4]
 gi|120562989|gb|ABM28733.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfovibrio vulgaris DP4]
          Length = 129

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/121 (33%), Positives = 64/121 (52%), Gaps = 9/121 (7%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVD-PKTGFVDDFFNIEQYFS 60
           ++T    F A+H L       KC  +HGH++ VE V+EGD   P T  V DF  ++   +
Sbjct: 7   RLTVRSEFCASHALRHYE--GKCENLHGHNFAVEAVVEGDRLSPGTEIVLDFKVLKGELN 64

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
            +L+ LDHH LNE+   +  NP++EN+A +I+  L+  L+     + +V V E       
Sbjct: 65  TVLDLLDHHNLNEVPPFDTINPSSENLARFIYTALAPRLAPHGVRMHAVTVSEKAAQSAT 124

Query: 115 Y 115
           Y
Sbjct: 125 Y 125


>gi|240114980|ref|ZP_04729042.1| putative 6-pyruvoyl-tetrahydropterin synthase [Neisseria
           gonorrhoeae PID18]
 gi|268600648|ref|ZP_06134815.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268584779|gb|EEZ49455.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
          Length = 140

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/141 (29%), Positives = 69/141 (48%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVME---GDVDPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +        PK G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSDGIVRGGPKDGMVMDFTDLKA 58

Query: 58  YF-SPLLEKLDHHCL--------NEIEEL------------ENPTAENIAIWIWKRLSTS 96
                + +  DH  +        ++I  L               TAEN+A+ ++ RL  +
Sbjct: 59  IVKQHITDPFDHAFIYHGGNGRESQIAALLEGWNMKTLRLPCRTTAENMAVEMYGRLKNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              +  V+++ETP S  EY+G
Sbjct: 119 GLNVCRVKLWETPTSCAEYEG 139


>gi|88803039|ref|ZP_01118566.1| putative 6-pyruvoyl tetrahydropterin synthase [Polaribacter
           irgensii 23-P]
 gi|88781897|gb|EAR13075.1| putative 6-pyruvoyl tetrahydropterin synthase [Polaribacter
           irgensii 23-P]
          Length = 137

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 43/131 (32%), Positives = 67/131 (51%), Gaps = 16/131 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKTH--------KCHRMH--GHSYRVELVMEGDVDPKTGFVDDF 52
           + +   F AAHRL R   +         KC   H  GH+Y + + + G++D +TG+V D 
Sbjct: 6   VHRKAHFNAAHRLYRKDWSDEKNFEVFNKCSNPHFHGHNYELIVSLTGEIDQETGYVFDL 65

Query: 53  FNIEQYFS-PLLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSI--LSSVRVY 106
             ++ +    + +  DH  LN E+ E +  NPTAENI +  +K+L   L       V +Y
Sbjct: 66  GILKNHIKVEIEDAFDHKNLNIEVPEFKDLNPTAENICVVTYKKLRNLLPENLDLEVTLY 125

Query: 107 ETPMSWVEYQG 117
           ETP ++V Y G
Sbjct: 126 ETPRNFVSYSG 136


>gi|325105099|ref|YP_004274753.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Pedobacter saltans DSM 12145]
 gi|324973947|gb|ADY52931.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Pedobacter saltans DSM 12145]
          Length = 138

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 48/129 (37%), Positives = 66/129 (51%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           + +   F AAHRL               KC+    HGH+Y +EL + G  DPKTG+V D 
Sbjct: 7   VFRREQFNAAHRLNNPEWSEAENQRVFGKCNNPNFHGHNYILELKVVGVPDPKTGYVLDM 66

Query: 53  FNIEQYF-SPLLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSI--LSSVRVY 106
             +       +++K DH  LN + EE +  NPTAENIAI IW  +   +       VR+Y
Sbjct: 67  KILSDIIQQEVIKKFDHRNLNLDTEEFKTLNPTAENIAIVIWNLVRPRIDEKLDLFVRLY 126

Query: 107 ETPMSWVEY 115
           ET  ++VEY
Sbjct: 127 ETERNFVEY 135


>gi|121634322|ref|YP_974567.1| hypothetical protein NMC0466 [Neisseria meningitidis FAM18]
 gi|120866028|emb|CAM09766.1| hypothetical protein NMC0466 [Neisseria meningitidis FAM18]
 gi|325127639|gb|EGC50555.1| queuosine biosynthesis protein QueD [Neisseria meningitidis N1568]
 gi|325137689|gb|EGC60266.1| queuosine biosynthesis protein QueD [Neisseria meningitidis
           ES14902]
          Length = 140

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 40/141 (28%), Positives = 68/141 (48%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEG---DVDPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +         K G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSDGIIKGGAKDGMVMDFTDLKA 58

Query: 58  YF-SPLLEKLDHHCL--------NEIEEL------------ENPTAENIAIWIWKRLSTS 96
                + +  DH  +        ++I  L               TAEN+A+ ++ RL  +
Sbjct: 59  IVKQHITDPFDHAFIYHGGNSRESQIAALLEGWNMKTLRLPCRTTAENMAVEMYDRLKNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              +  V+++ETP S  EY+G
Sbjct: 119 GLNVCRVKLWETPTSCAEYEG 139


>gi|261380777|ref|ZP_05985350.1| queuosine biosynthesis protein QueD [Neisseria subflava NJ9703]
 gi|284796239|gb|EFC51586.1| queuosine biosynthesis protein QueD [Neisseria subflava NJ9703]
          Length = 140

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 44/141 (31%), Positives = 72/141 (51%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDV---DPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +   V     K G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSAPVIQGGAKDGMVMDFTDLKS 58

Query: 58  YF-SPLLEKLDHHCL----NEIEE-----LEN-----------PTAENIAIWIWKRLSTS 96
                + +  DH  +    NE E      LE             TAEN+++ ++ RL  +
Sbjct: 59  IVKQHINDPFDHAFIYHGNNERESQIAALLEGWNMKTLRLPCRTTAENMSVEMYGRLKNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              + SV+++ETP S+ EY+G
Sbjct: 119 GVKVCSVKLWETPTSYAEYEG 139


>gi|283850844|ref|ZP_06368130.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfovibrio sp. FW1012B]
 gi|283573767|gb|EFC21741.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfovibrio sp. FW1012B]
          Length = 131

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 39/122 (31%), Positives = 64/122 (52%), Gaps = 9/122 (7%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDP-KTGFVDDFFNIEQYFS 60
           ++T   +F A+H L        C  +HGH++ VE V+EG+    K  ++ DF  +     
Sbjct: 10  QLTVTESFSASHCLRGYE--GPCENLHGHNFGVEAVVEGERLDAKVEYLMDFKKLRGRLR 67

Query: 61  PLLEKLDHHCLNEIEEL--ENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
            +L +LDH  LN++     ENP++EN+A  I++RL  +L+     L +V V E   S   
Sbjct: 68  GILAELDHRHLNDVAPFDGENPSSENLARHIYRRLEAALAGEAVTLVAVSVSEKDTSKAT 127

Query: 115 YQ 116
           Y+
Sbjct: 128 YR 129


>gi|46579763|ref|YP_010571.1| 6-pyruvoyl tetrahydrobiopterin synthase [Desulfovibrio vulgaris
           str. Hildenborough]
 gi|46449178|gb|AAS95830.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|311233554|gb|ADP86408.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfovibrio vulgaris RCH1]
          Length = 129

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 41/121 (33%), Positives = 65/121 (53%), Gaps = 9/121 (7%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVD-PKTGFVDDFFNIEQYFS 60
           ++T    F A+H L       KC  +HGH++ VE V+EGD   P T  V DF  ++   +
Sbjct: 7   RLTVRSEFCASHALRHYE--GKCENLHGHNFAVEAVVEGDRLSPGTEIVLDFKVLKGELN 64

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
            +L+ LDHH LNE+   +  NP++EN+A +I+  L+  L+     + +V V E  +    
Sbjct: 65  TVLDLLDHHNLNEVPPFDTINPSSENLARFIYTALAPRLAPHGVRMHAVTVSEKAVQSAT 124

Query: 115 Y 115
           Y
Sbjct: 125 Y 125


>gi|281203781|gb|EFA77977.1| 6-pyruvoyltetrahydropterin synthase [Polysphondylium pallidum
           PN500]
          Length = 138

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/128 (28%), Positives = 66/128 (51%), Gaps = 13/128 (10%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFN 54
           +T+   F A+HRL     T         KC   HGH+Y +E+ + G ++ KTG   +   
Sbjct: 8   LTRREVFSASHRLYSEHLTEEENKATYGKCINQHGHNYTLEVSVRGKLNEKTGMFINATE 67

Query: 55  IEQYFSPL-LEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI-LSSVRVYETP 109
           ++Q      ++++DH  L  +++E +    T EN+ + I++ L+  L   L  V++ ET 
Sbjct: 68  LKQIIKEEIMDRMDHKNLEVDVKEFQGVVTTTENLCVVIYELLAKRLGELLYEVKILETE 127

Query: 110 MSWVEYQG 117
            ++V Y+G
Sbjct: 128 NNYVIYRG 135


>gi|320536812|ref|ZP_08036808.1| queuosine biosynthesis protein QueD [Treponema phagedenis F0421]
 gi|320146321|gb|EFW37941.1| queuosine biosynthesis protein QueD [Treponema phagedenis F0421]
          Length = 127

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 38/118 (32%), Positives = 57/118 (48%), Gaps = 5/118 (4%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++     F AAH L       KC R+HGH+YRV    +G    + G + DF  +++    
Sbjct: 3   EVRVEADFAAAHFLTDY--HGKCERLHGHNYRVLAHAQGTELDEGGMLFDFGILKKALRE 60

Query: 62  LLEKLDHHCLNEIEEL-ENPTAENIAIWIWKRLSTSLSI--LSSVRVYETPMSWVEYQ 116
           +  +LDH  LN+      NP+AE IA +I+  +        L +V VYETP S   + 
Sbjct: 61  VCAQLDHRNLNDFSFFNGNPSAERIAEFIFTEIKKLSPDCPLVAVDVYETPTSRARFY 118


>gi|289433337|ref|YP_003463210.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Dehalococcoides sp. GT]
 gi|288947057|gb|ADC74754.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Dehalococcoides sp. GT]
          Length = 123

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/120 (35%), Positives = 63/120 (52%), Gaps = 8/120 (6%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           ++    FEAAH L       KC  +HGH Y V L ++     + G   DF  ++   + +
Sbjct: 4   LSVKKHFEAAHFLRGYK--GKCENLHGHRYEVALKVKTGELDECGMGADFSLLKIRLNEV 61

Query: 63  LEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEYQ 116
           L+  DH CLN++   +  NP+AENIA  I+ +L T ++     L  V V+E+P S V YQ
Sbjct: 62  LQSYDHTCLNDLTPFDNINPSAENIAKDIYDKLKTVINKKGVELWGVEVWESPDSSVLYQ 121


>gi|169828573|ref|YP_001698731.1| 6-pyruvoyl tetrahydrobiopterin synthase [Lysinibacillus sphaericus
           C3-41]
 gi|168993061|gb|ACA40601.1| 6-pyruvoyl tetrahydrobiopterin synthase [Lysinibacillus sphaericus
           C3-41]
          Length = 157

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 41/120 (34%), Positives = 61/120 (50%), Gaps = 10/120 (8%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+YRV L + G  D +   +D       +   +
Sbjct: 31  VSKEFTFDAAHHLHHYE--GKCKNLHGHTYRVVLGLSGYTDERGLMIDFGDIKRIWKQKI 88

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSL--------SILSSVRVYETPMSWVE 114
              LDH  LNE     N TAENI +WI+  +  +L        + +  +R+YETP S+ E
Sbjct: 89  EIHLDHRYLNETLPPMNTTAENIVVWIYDTMVVALRDEQRNNGARVEFIRLYETPTSYAE 148


>gi|218962057|ref|YP_001741832.1| 6-pyruvoyl tetrahydrobiopterin synthase family protein [Candidatus
           Cloacamonas acidaminovorans]
 gi|167730714|emb|CAO81626.1| 6-pyruvoyl tetrahydrobiopterin synthase family protein [Candidatus
           Cloacamonas acidaminovorans]
          Length = 126

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 39/122 (31%), Positives = 61/122 (50%), Gaps = 8/122 (6%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             +    TF AAH L        C ++HGH+++V + ++     + G   DF  ++   S
Sbjct: 2   FYLNVIETFSAAHLLRGYE--GACSKLHGHNWKVRVCVKTKEQDEIGMAMDFGVLKTILS 59

Query: 61  PLLEKLDHHCLNEIEEL--ENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVE 114
            +L  LDH  LNEI      NPT+EN+A +I++ +   L      +S V VYE+  S V 
Sbjct: 60  NILNNLDHSYLNEIVPFTERNPTSENLAKYIYECMEKELQDKPVAISEVEVYESEKSSVI 119

Query: 115 YQ 116
           Y+
Sbjct: 120 YK 121


>gi|322516972|ref|ZP_08069862.1| 6-pyruvoyltetrahydropterin synthase [Streptococcus vestibularis
           ATCC 49124]
 gi|322124455|gb|EFX95950.1| 6-pyruvoyltetrahydropterin synthase [Streptococcus vestibularis
           ATCC 49124]
          Length = 147

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/120 (35%), Positives = 65/120 (54%), Gaps = 9/120 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y +++ + G    + G   DF +++  +   
Sbjct: 25  VSKEFTFDAAHHLFHYE--GKCKSLHGHTYHLQIAVSG-YLDERGMTYDFGDLKSIYKDH 81

Query: 63  LEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI-----LSSVRVYETPMSWVEYQ 116
           LE  LDH  LNE     N TAEN+  WI++  S  L       L  VR+YETP ++ E++
Sbjct: 82  LEPHLDHRYLNETLPYMNTTAENMVFWIFQTASEYLPEERGLRLEYVRLYETPTAFAEFR 141


>gi|206895649|ref|YP_002246467.1| 6-pyruvoyl-tetrahydropterin synthase [Coprothermobacter
           proteolyticus DSM 5265]
 gi|206738266|gb|ACI17344.1| 6-pyruvoyl-tetrahydropterin synthase [Coprothermobacter
           proteolyticus DSM 5265]
          Length = 127

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/118 (35%), Positives = 70/118 (59%), Gaps = 10/118 (8%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDP-KTGFVDDFFNIEQYFSP 61
           +T+AFTF+AAH L       KC  +HGH+YR+E+ + G  +  + G + DF +++   + 
Sbjct: 5   VTKAFTFDAAHNLTNYK--GKCEALHGHTYRLEVTVCGTPNELENGLLMDFGDLKDLVNK 62

Query: 62  LL-EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVE 114
            +  KLDH  LN+    E P+ E +A+W+++ L   +      L+SV+++ET  SWVE
Sbjct: 63  EVLSKLDHSYLNDH--FEQPSTELVAMWVFETLKPHVEKLGLVLTSVKLFETATSWVE 118


>gi|51244017|ref|YP_063901.1| 6-pyruvoyl tetrahydropterin synthase [Desulfotalea psychrophila
           LSv54]
 gi|50875054|emb|CAG34894.1| related to 6-pyruvoyl tetrahydropterin synthase [Desulfotalea
           psychrophila LSv54]
          Length = 136

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 44/127 (34%), Positives = 70/127 (55%), Gaps = 16/127 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFN 54
           IT+ F F+AAH+L               KC ++HGH+Y + + + G V P  G V +F +
Sbjct: 6   ITKEFRFDAAHKLFLKDLTDQENREAFGKCSQLHGHTYCLRITITGKVQP-NGMVLNFTD 64

Query: 55  IEQYFSPL-LEKLDHHCLNEIEELEN--PTAENIAIWIWKRLSTSLSI----LSSVRVYE 107
           ++Q      + + DH  LNE+EE  +   TAEN++++I+K L+  L      L+ V++YE
Sbjct: 65  LKQIVEEKIIARYDHSHLNELEEYRDLPTTAENMSLYIFKVLAACLKKQKVTLTEVQLYE 124

Query: 108 TPMSWVE 114
           TP SW  
Sbjct: 125 TPTSWAT 131


>gi|163848191|ref|YP_001636235.1| putative 6-pyruvoyl tetrahydropterin synthase [Chloroflexus
           aurantiacus J-10-fl]
 gi|222526096|ref|YP_002570567.1| hypothetical protein Chy400_2853 [Chloroflexus sp. Y-400-fl]
 gi|163669480|gb|ABY35846.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Chloroflexus aurantiacus J-10-fl]
 gi|222449975|gb|ACM54241.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Chloroflexus sp. Y-400-fl]
          Length = 274

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 38/130 (29%), Positives = 65/130 (50%), Gaps = 16/130 (12%)

Query: 4   TQAFTFEAAHRLPRVPKTHKCH----------RMHGHSYRVELVMEGDVDPKTGFVDDFF 53
           T+ F F AAHR  R   + + +            HGH+Y +++ + G++D +TG V +  
Sbjct: 5   TRRFEFSAAHRYWRDDWSAEENERVFGPYTSPYGHGHNYTLDVSITGELDERTGMVMNMT 64

Query: 54  NIEQYFSPLLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS---ILSSVRVYE 107
            ++   + +LE+ DH  LN +     +  PT EN+   +W+ ++  L     L  +R+YE
Sbjct: 65  ELKAIVNEVLEEFDHKHLNYDTPYFRDQVPTTENLVRVLWRLIAARLPAHARLKHLRLYE 124

Query: 108 TPMSWVEYQG 117
            P  W EY G
Sbjct: 125 QPDLWAEYDG 134



 Score = 91.4 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 38/127 (29%), Positives = 67/127 (52%), Gaps = 14/127 (11%)

Query: 5   QAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDFFN 54
           + +TF AAHRL          +    KC+    HGH+Y +E+ ++G +DP TG + D   
Sbjct: 142 RLYTFAAAHRLHAPALSDEENLAIYGKCNNPNGHGHNYTLEVTVQGPIDPATGMLVDLEW 201

Query: 55  IEQYFSPLLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS-ILSSVRVYETPM 110
           +++    ++++L    L+ EI    +   TAENI +++W  L+  L   L+ +R++ET  
Sbjct: 202 LDRTVHSVIDRLHLRHLDREIPAFADRPSTAENIIVYLWNELAPLLEGRLALLRLWETRK 261

Query: 111 SWVEYQG 117
           +   Y G
Sbjct: 262 NIFSYAG 268


>gi|281338768|gb|EFB14352.1| hypothetical protein PANDA_009971 [Ailuropoda melanoleuca]
          Length = 118

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 63/109 (57%), Gaps = 8/109 (7%)

Query: 17  RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP-LLEKLDHHCLN- 72
            +    KC+    HGH+Y+V + + G++DP TG V +  ++++Y    +++ LDH  L+ 
Sbjct: 9   NLKLFGKCNNPNGHGHNYKVVVTVHGEIDPVTGMVMNLTDLKEYMEEAIMKPLDHKNLDL 68

Query: 73  EIEELEN--PTAENIAIWIWKRLSTSLSI--LSSVRVYETPMSWVEYQG 117
           ++    +   T EN+A++IW+ L   L +  L  V+VYET  + V Y+G
Sbjct: 69  DVPYFADVVSTTENVAVYIWENLQKFLPLGVLYKVKVYETDNNIVVYKG 117


>gi|86133758|ref|ZP_01052340.1| 6-pyruvoyl tetrahydropterin synthase [Polaribacter sp. MED152]
 gi|85820621|gb|EAQ41768.1| 6-pyruvoyl tetrahydropterin synthase [Polaribacter sp. MED152]
          Length = 137

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 41/131 (31%), Positives = 65/131 (49%), Gaps = 16/131 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKTH--------KCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           + +   F AAHRL R   +         KC     HGH+Y + + + G+++ +TG+V D 
Sbjct: 6   VHRKAHFNAAHRLYRKDWSDEKNFDVFNKCSNPNFHGHNYELIVSLTGEINKETGYVYDL 65

Query: 53  FNIEQYFS-PLLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSIL--SSVRVY 106
             ++      + E  DH  LN E+ E +  NPTAENI +  + +L   L       + +Y
Sbjct: 66  GILKNLIKSEIEECFDHKNLNVEVPEFQELNPTAENICVVTYDKLRKHLPTDLELKITLY 125

Query: 107 ETPMSWVEYQG 117
           ETP ++V Y G
Sbjct: 126 ETPRNFVSYSG 136


>gi|325131673|gb|EGC54378.1| queuosine biosynthesis protein QueD [Neisseria meningitidis M6190]
          Length = 140

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/141 (28%), Positives = 68/141 (48%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEG---DVDPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +         K G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSDGIIKGSAKDGMVMDFTDLKA 58

Query: 58  YF-SPLLEKLDHHCL--------NEIEEL------------ENPTAENIAIWIWKRLSTS 96
                + +  DH  +        ++I  L               TAEN+A+ ++ RL  +
Sbjct: 59  IVKQHITDPFDHAFIYHGGNSRESQIAALLEGWNMKTLRLPCRTTAENMAVEMYDRLKNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              +  V+++ETP S  EY+G
Sbjct: 119 GLNVCRVKLWETPTSCAEYEG 139


>gi|312863204|ref|ZP_07723442.1| queuosine biosynthesis protein QueD [Streptococcus vestibularis
           F0396]
 gi|311100740|gb|EFQ58945.1| queuosine biosynthesis protein QueD [Streptococcus vestibularis
           F0396]
          Length = 147

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/120 (35%), Positives = 65/120 (54%), Gaps = 9/120 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y +++ + G    + G   DF +++  +   
Sbjct: 25  VSKEFTFDAAHHLFHYE--GKCKSLHGHTYHLQIAVSG-YLDERGMTYDFGDLKSIYKDH 81

Query: 63  LEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI-----LSSVRVYETPMSWVEYQ 116
           LE  LDH  LNE     N TAEN+  WI++  S  L       L  VR+YETP ++ E++
Sbjct: 82  LEPHLDHRYLNETLPYMNTTAENMVFWIFQTTSEYLPEERGLRLEYVRLYETPTAFAEFR 141


>gi|14905697|gb|AAK59698.1| 6-pyruvoyl tetrahydropterin synthase isoform [Poecilia reticulata]
          Length = 137

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 62/127 (48%), Gaps = 18/127 (14%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+  +F A HRL               KC+    HGH+Y+VE+ + G +DP TG V + 
Sbjct: 16  ITRVQSFSACHRLHSLRLSDEENKEVYGKCNNPYGHGHNYKVEVTVRGKIDPVTGMVMNL 75

Query: 53  FNIEQYFSPLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS--ILSSVRVYETPM 110
            ++++     +       L  +      T EN+A++IW  ++ +L   +   +R++ET  
Sbjct: 76  TDLKKCIE--IRTFHQTFLLSL----TSTTENLAVYIWDNMAKALPASLPYEIRIHETDK 129

Query: 111 SWVEYQG 117
           + V Y+G
Sbjct: 130 NIVVYRG 136


>gi|302038843|ref|YP_003799165.1| 6-pyruvoyl-tetrahydropterin synthase [Candidatus Nitrospira
           defluvii]
 gi|300606907|emb|CBK43240.1| 6-pyruvoyl-tetrahydropterin synthase [Candidatus Nitrospira
           defluvii]
          Length = 149

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/130 (32%), Positives = 60/130 (46%), Gaps = 15/130 (11%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+ + F AAHRL               KC+    HGH+Y V + + GD+DP T  V D 
Sbjct: 6   ITRRYRFCAAHRLHTDQLSAEENWTTFGKCNNPNGHGHNYVVFVSVRGDIDPVTHQVLDV 65

Query: 53  FNIEQYFSPL-LEKLDHHCLNEIEEL--ENPTAENIAIWIWKRLSTSLS--ILSSVRVYE 107
             ++     + +++ DH  LN   E   +  T EN+ + IW  L   L    L  V V E
Sbjct: 66  SRLDAVVERIVVQRFDHQDLNLDPEFATQTTTGENLVLLIWDLLVDQLPAGRLVKVGVIE 125

Query: 108 TPMSWVEYQG 117
           T  ++ EY G
Sbjct: 126 TRDNYFEYSG 135


>gi|323488450|ref|ZP_08093697.1| 6-pyruvoyl tetrahydrobiopterin synthase [Planococcus donghaensis
           MPA1U2]
 gi|323397957|gb|EGA90756.1| 6-pyruvoyl tetrahydrobiopterin synthase [Planococcus donghaensis
           MPA1U2]
          Length = 141

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 59/124 (47%), Gaps = 12/124 (9%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ +   F AAH +P      KC  MHGH+Y + + + G+     GF+ DF  +++   
Sbjct: 15  FELNKDMHFSAAHFIPS-EDAGKCKVMHGHTYHLNITIGGNELDSIGFLIDFKLLKELIH 73

Query: 61  PLLEKLDHHCLNEIEELEN--PTAENIAIWIWKRLSTSL------SILSSVRVYETPMSW 112
               K DH  LN+  E  N  PT E +A  +W+ + T L           V V ETP S+
Sbjct: 74  K---KYDHSVLNDHPEFTNKFPTTELLAQQVWQSIQTMLQATTNRPNCLQVIVRETPTSY 130

Query: 113 VEYQ 116
           V Y+
Sbjct: 131 VVYR 134


>gi|256425906|ref|YP_003126559.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Chitinophaga pinensis DSM 2588]
 gi|256040814|gb|ACU64358.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Chitinophaga pinensis DSM 2588]
          Length = 137

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 43/134 (32%), Positives = 67/134 (50%), Gaps = 17/134 (12%)

Query: 1   MKITQAFTFEAAHRLPRVPK--------THKCHR--MHGHSYRVELVMEGDVDPKTGFVD 50
           + +T+   F AAH+L               KC     HGH+Y + + ++G  DP+TGFV 
Sbjct: 2   IYLTRVENFNAAHKLSNPAWSKEKNEEVFGKCANENWHGHNYELHVTVKGTPDPETGFVF 61

Query: 51  DFFNIEQYFSPLL-EKLDHHCLNEIEEL---ENPTAENIAIWIWKRLSTSLS---ILSSV 103
           +   +       + EK+DH  LN   +    +  +AEN+AI IW +L+  L     L  +
Sbjct: 62  NAKTLGVLIKDFIVEKIDHRNLNMDVDFMVGKFTSAENLAIGIWDQLTPHLPEGVELHCI 121

Query: 104 RVYETPMSWVEYQG 117
           ++YETP  +VEY G
Sbjct: 122 KLYETPRIYVEYFG 135


>gi|226314169|ref|YP_002774065.1| queuosine biosynthesis protein [Brevibacillus brevis NBRC 100599]
 gi|226097119|dbj|BAH45561.1| putative queuosine biosynthesis protein [Brevibacillus brevis NBRC
           100599]
          Length = 162

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 44/124 (35%), Positives = 67/124 (54%), Gaps = 15/124 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y V   + G  D + G V DF +I+Q +   
Sbjct: 34  VSKEFTFDAAHHLHAYE--GKCKNLHGHTYTVVFGISGFPD-EIGLVIDFGDIKQIWKEH 90

Query: 63  LE-KLDHHCLNEIEELENPTAENIAIWIWKRLSTSL-----------SILSSVRVYETPM 110
           +E  LDH  LNE+    N TAEN+ +WI++ +   L           + +  VR++ETP 
Sbjct: 91  IEIYLDHRYLNEMLPPMNTTAENMVVWIFEEMEKQLQSDAYRDRYDGARVEFVRLFETPT 150

Query: 111 SWVE 114
           S+ E
Sbjct: 151 SYAE 154


>gi|59800590|ref|YP_207302.1| putative 6-pyruvoyl-tetrahydropterin synthase [Neisseria
           gonorrhoeae FA 1090]
 gi|293397672|ref|ZP_06641878.1| queuosine biosynthesis protein QueD [Neisseria gonorrhoeae F62]
 gi|59717485|gb|AAW88890.1| putative 6-pyruvoyl-tetrahydropterin synthase [Neisseria
           gonorrhoeae FA 1090]
 gi|291611618|gb|EFF40687.1| queuosine biosynthesis protein QueD [Neisseria gonorrhoeae F62]
          Length = 140

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 41/141 (29%), Positives = 69/141 (48%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVME---GDVDPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +        PK G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSDGIVRGGPKDGMVMDFTDLKA 58

Query: 58  YF-SPLLEKLDHHCL--------NEIEEL------------ENPTAENIAIWIWKRLSTS 96
                + +  DH  +        ++I  L               TAEN+A+ ++ RL  +
Sbjct: 59  IVKQHITDPFDHAFIYHGGNGRESQIAALLEGWNMKTLRLPCRTTAENMAVEMYCRLKNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              +  V+++ETP S  EY+G
Sbjct: 119 GLNVCRVKLWETPTSCAEYEG 139


>gi|218767649|ref|YP_002342161.1| hypothetical protein NMA0704 [Neisseria meningitidis Z2491]
 gi|121051657|emb|CAM07960.1| hypothetical protein NMA0704 [Neisseria meningitidis Z2491]
 gi|319409905|emb|CBY90230.1| putative 6-pyruvoyl tetrahydrobiopterin synthase (PTPS; PTP
           synthase) [Neisseria meningitidis WUE 2594]
          Length = 140

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 39/141 (27%), Positives = 67/141 (47%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEG---DVDPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +         K G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSDGIIKGGAKDGMVMDFTDLKA 58

Query: 58  YF-SPLLEKLDHHCL-----------------NEIEELE---NPTAENIAIWIWKRLSTS 96
                + +  DH  +                   ++ L      TAEN+A+ ++ RL  +
Sbjct: 59  IVKQHITDPFDHAFIYHGGNSRECQIAALLEGWNMKTLRLPCRTTAENMAVEMYDRLKNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              +  V+++ETP S  EY+G
Sbjct: 119 GLNVCRVKLWETPTSCAEYEG 139


>gi|166363952|ref|YP_001656225.1| 6-pyruvoyl-tetrahydropterin synthase-like protein [Microcystis
           aeruginosa NIES-843]
 gi|166086325|dbj|BAG01033.1| 6-pyruvoyl-tetrahydropterin synthase homolog [Microcystis
           aeruginosa NIES-843]
          Length = 155

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 41/130 (31%), Positives = 66/130 (50%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL               KC R+  HGH+Y +E+ + G++DP+TG + D 
Sbjct: 5   LTVKTHFSAAHRLALPQLTLEQNSEIYGKCARVNGHGHNYHLEVSVAGEIDPRTGMIVDL 64

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSL----SILSSVR 104
            ++++     ++E  DH  LN +I       PTAENIA+ I + L   +    + L  V+
Sbjct: 65  GDLQKAIDELVVEPFDHTFLNKDIPYFAEVVPTAENIALHIAQLLGERIRQLGAELDKVK 124

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 125 LIESPNNSAE 134


>gi|332296289|ref|YP_004438212.1| queuosine biosynthesis protein QueD [Thermodesulfobium narugense
           DSM 14796]
 gi|332179392|gb|AEE15081.1| queuosine biosynthesis protein QueD [Thermodesulfobium narugense
           DSM 14796]
          Length = 118

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 41/118 (34%), Positives = 63/118 (53%), Gaps = 9/118 (7%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           +K+ + F+F AAH+L  V     C  +HGH+YR+ + + G +  +   V DF  ++    
Sbjct: 3   IKVYKEFSFSAAHKL--VDYKGDCANLHGHTYRLGVAVSGPI-GENSMVIDFKILKNIVE 59

Query: 61  PL-LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI---LSSVRVYETPMSWVE 114
              + KLDH  LN+I    NPTAE +  WI   L  S+     L  VR++E+  S+VE
Sbjct: 60  ERIISKLDHKYLNDIIY--NPTAEKVCEWILNELKDSVPESVKLEFVRLWESETSYVE 115


>gi|330507494|ref|YP_004383922.1| queuosine biosynthesis protein QueD [Methanosaeta concilii GP-6]
 gi|328928302|gb|AEB68104.1| queuosine biosynthesis protein QueD [Methanosaeta concilii GP-6]
          Length = 115

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 50/117 (42%), Positives = 73/117 (62%), Gaps = 9/117 (7%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MK+     F+AAH LP      KC  MHGH+Y+VE+V+EG+V  + GFV DF+ +++   
Sbjct: 1   MKLGLTTEFDAAHSLPGY--QGKCACMHGHTYQVEMVVEGEV-GEDGFVIDFYQLKKIIG 57

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWV 113
             L++LDH CLN+   L NPTAE+IA+WI +RL   +      L S++++E    WV
Sbjct: 58  ATLQELDHSCLND--TLPNPTAESIALWIAERLKKEMETTSIKLYSLKLWEGKNKWV 112


>gi|255066203|ref|ZP_05318058.1| queuosine biosynthesis protein QueD [Neisseria sicca ATCC 29256]
 gi|255049413|gb|EET44877.1| queuosine biosynthesis protein QueD [Neisseria sicca ATCC 29256]
          Length = 140

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/141 (29%), Positives = 68/141 (48%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDV---DPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +  D     PK G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSDDPVRGGPKDGMVMDFTDLKA 58

Query: 58  YFSPL-LEKLDHHCLNE-----------IEELEN---------PTAENIAIWIWKRLSTS 96
                  +  DH  +             + E  N          TAEN+A+ ++ RL  +
Sbjct: 59  IVKKHITDPFDHAFIYHGGNGRECQIAALLEGWNMKTLCLPCRTTAENMAVEMYDRLKNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              +  V+++ETP S  EY+G
Sbjct: 119 GLKVCIVKLWETPTSSAEYEG 139


>gi|319652977|ref|ZP_08007082.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus sp. 2_A_57_CT2]
 gi|317395326|gb|EFV76059.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus sp. 2_A_57_CT2]
          Length = 158

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 39/121 (32%), Positives = 66/121 (54%), Gaps = 11/121 (9%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF++AH L       KC  +HGH+Y+V   + G VD +   +D     + + + +
Sbjct: 31  VSKEFTFDSAHHLHCYE--GKCKNLHGHTYKVIFGISGFVDDRGLMIDFGDIKKIWKNEI 88

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSL---------SILSSVRVYETPMSWV 113
              LDH  LNE     N TAEN+ +WI+++++ SL         + +  VR++ETP S+ 
Sbjct: 89  EIFLDHKYLNETLPPMNTTAENMVVWIYEKMAQSLQNRKEQYVGARVEFVRLFETPTSYA 148

Query: 114 E 114
           E
Sbjct: 149 E 149


>gi|291287279|ref|YP_003504095.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Denitrovibrio acetiphilus DSM 12809]
 gi|290884439|gb|ADD68139.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Denitrovibrio acetiphilus DSM 12809]
          Length = 122

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 42/118 (35%), Positives = 66/118 (55%), Gaps = 6/118 (5%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           K+    +F  AH L       KC  +HGH+++VE  ++GD   +T  + DF  +++    
Sbjct: 3   KVRVVMSFGGAHNLRNY--NGKCENLHGHNWKVEAYLKGDELNETEMLVDFTIMKKRLKE 60

Query: 62  LLEKLDHHCLNE-IEELE--NPTAENIAIWIWKRLSTSLSILS-SVRVYETPMSWVEY 115
           +LE LDH  LNE +E  +  NPT+ENIA +I++ L  +   L+  V V+ET +   EY
Sbjct: 61  ILETLDHKYLNEQVEFFKVNNPTSENIARYIYQGLKETFGKLTDRVAVWETDIQAAEY 118


>gi|15923701|ref|NP_371235.1| 6-pyruvoyl tetrahydrobiopterin synthase-like protein
           [Staphylococcus aureus subsp. aureus Mu50]
 gi|15926388|ref|NP_373921.1| hypothetical protein SA0666 [Staphylococcus aureus subsp. aureus
           N315]
 gi|21282402|ref|NP_645490.1| hypothetical protein MW0673 [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49482967|ref|YP_040191.1| 6-pyruvoyl tetrahydropterin synthase [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|49485583|ref|YP_042804.1| putative 6-pyruvoyl tetrahydropterin synthase [Staphylococcus
           aureus subsp. aureus MSSA476]
 gi|57651550|ref|YP_185648.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Staphylococcus
           aureus subsp. aureus COL]
 gi|87160568|ref|YP_493399.1| 6-pyruvoyl tetrahydrobiopterin synthase-like protein
           [Staphylococcus aureus subsp. aureus USA300_FPR3757]
 gi|88194485|ref|YP_499279.1| 6-pyruvoyl tetrahydropterin synthase [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|148267171|ref|YP_001246114.1| 6-pyruvoyl tetrahydropterin synthase [Staphylococcus aureus subsp.
           aureus JH9]
 gi|150393219|ref|YP_001315894.1| 6-pyruvoyl tetrahydropterin synthase [Staphylococcus aureus subsp.
           aureus JH1]
 gi|151220892|ref|YP_001331714.1| 6-pyruvoyl tetrahydropterin synthase [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|156979039|ref|YP_001441298.1| 6-pyruvoyl tetrahydrobiopterin synthase homologue [Staphylococcus
           aureus subsp. aureus Mu3]
 gi|161508975|ref|YP_001574634.1| 6-pyruvoyltetrahydropterin synthase [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|221140927|ref|ZP_03565420.1| 6-pyruvoyltetrahydropterin synthase [Staphylococcus aureus subsp.
           aureus str. JKD6009]
 gi|253315350|ref|ZP_04838563.1| 6-pyruvoyl tetrahydrobiopterin synthase-like protein
           [Staphylococcus aureus subsp. aureus str. CF-Marseille]
 gi|255005503|ref|ZP_05144104.2| 6-pyruvoyl tetrahydrobiopterin synthase-like protein
           [Staphylococcus aureus subsp. aureus Mu50-omega]
 gi|257424830|ref|ZP_05601257.1| 6-pyruvoyl tetrahydropterin synthase [Staphylococcus aureus subsp.
           aureus 55/2053]
 gi|257427498|ref|ZP_05603897.1| 6-pyruvoyl tetrahydropterin synthase [Staphylococcus aureus subsp.
           aureus 65-1322]
 gi|257430129|ref|ZP_05606513.1| 6-pyruvoyl tetrahydropterin synthase [Staphylococcus aureus subsp.
           aureus 68-397]
 gi|257432831|ref|ZP_05609191.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           subsp. aureus E1410]
 gi|257435735|ref|ZP_05611783.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M876]
 gi|257794968|ref|ZP_05643947.1| conserved hypothetical protein [Staphylococcus aureus A9781]
 gi|258418285|ref|ZP_05682550.1| conserved hypothetical protein [Staphylococcus aureus A9763]
 gi|258421582|ref|ZP_05684507.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           A9719]
 gi|258423360|ref|ZP_05686251.1| 6-pyruvoyl tetrahydropterin synthase [Staphylococcus aureus A9635]
 gi|258430775|ref|ZP_05688487.1| 6-pyruvoyl tetrahydropterin synthase [Staphylococcus aureus A9299]
 gi|258441732|ref|ZP_05691004.1| conserved hypothetical protein [Staphylococcus aureus A8115]
 gi|258445826|ref|ZP_05694003.1| 6-pyruvoyltetrahydropterin synthase [Staphylococcus aureus A6300]
 gi|258449637|ref|ZP_05697739.1| 6-pyruvoyltetrahydropterin synthase [Staphylococcus aureus A6224]
 gi|258452919|ref|ZP_05700913.1| conserved hypothetical protein [Staphylococcus aureus A5948]
 gi|258454038|ref|ZP_05702010.1| 6-pyruvoyl tetrahydropterin synthase [Staphylococcus aureus A5937]
 gi|262048446|ref|ZP_06021331.1| hypothetical protein SAD30_2173 [Staphylococcus aureus D30]
 gi|262052793|ref|ZP_06024981.1| hypothetical protein SA930_0350 [Staphylococcus aureus 930918-3]
 gi|269202331|ref|YP_003281600.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Staphylococcus
           aureus subsp. aureus ED98]
 gi|282894476|ref|ZP_06302705.1| queuosine biosynthesis QueD, PTPS-I [Staphylococcus aureus A8117]
 gi|282903338|ref|ZP_06311229.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus
           aureus subsp. aureus C160]
 gi|282905118|ref|ZP_06312976.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           subsp. aureus Btn1260]
 gi|282908095|ref|ZP_06315926.1| queuosine biosynthesis protein QueD [Staphylococcus aureus subsp.
           aureus WW2703/97]
 gi|282910355|ref|ZP_06318159.1| queuosine biosynthesis protein QueD [Staphylococcus aureus subsp.
           aureus WBG10049]
 gi|282913548|ref|ZP_06321337.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus
           aureus subsp. aureus M899]
 gi|282916049|ref|ZP_06323812.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           subsp. aureus D139]
 gi|282918501|ref|ZP_06326238.1| queuosine biosynthesis QueD, PTPS-I [Staphylococcus aureus subsp.
           aureus C427]
 gi|282923466|ref|ZP_06331146.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           subsp. aureus C101]
 gi|282926574|ref|ZP_06334204.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           A10102]
 gi|283769873|ref|ZP_06342765.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           subsp. aureus H19]
 gi|283957540|ref|ZP_06374993.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus
           aureus subsp. aureus A017934/97]
 gi|284023733|ref|ZP_06378131.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Staphylococcus
           aureus subsp. aureus 132]
 gi|293500595|ref|ZP_06666446.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           subsp. aureus 58-424]
 gi|293509541|ref|ZP_06668252.1| queuosine biosynthesis QueD, PTPS-I [Staphylococcus aureus subsp.
           aureus M809]
 gi|293524127|ref|ZP_06670814.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus
           aureus subsp. aureus M1015]
 gi|294849380|ref|ZP_06790123.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           A9754]
 gi|295406429|ref|ZP_06816235.1| queuosine biosynthesis QueD [Staphylococcus aureus A8819]
 gi|295427287|ref|ZP_06819922.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           subsp. aureus EMRSA16]
 gi|296274775|ref|ZP_06857282.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Staphylococcus
           aureus subsp. aureus MR1]
 gi|297208565|ref|ZP_06924994.1| possible 6-pyruvoyltetrahydropterin synthase [Staphylococcus aureus
           subsp. aureus ATCC 51811]
 gi|297245156|ref|ZP_06929030.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           A8796]
 gi|297590362|ref|ZP_06949001.1| possible 6-pyruvoyltetrahydropterin synthase [Staphylococcus aureus
           subsp. aureus MN8]
 gi|300912657|ref|ZP_07130100.1| possible 6-pyruvoyltetrahydropterin synthase [Staphylococcus aureus
           subsp. aureus TCH70]
 gi|304381674|ref|ZP_07364323.1| possible 6-pyruvoyltetrahydropterin synthase [Staphylococcus aureus
           subsp. aureus ATCC BAA-39]
 gi|13700602|dbj|BAB41899.1| SA0666 [Staphylococcus aureus subsp. aureus N315]
 gi|14246480|dbj|BAB56873.1| 6-pyruvoyl tetrahydrobiopterin synthase homologue [Staphylococcus
           aureus subsp. aureus Mu50]
 gi|21203839|dbj|BAB94538.1| MW0673 [Staphylococcus aureus subsp. aureus MW2]
 gi|49241096|emb|CAG39774.1| putative 6-pyruvoyl tetrahydropterin synthase [Staphylococcus
           aureus subsp. aureus MRSA252]
 gi|49244026|emb|CAG42452.1| putative 6-pyruvoyl tetrahydropterin synthase [Staphylococcus
           aureus subsp. aureus MSSA476]
 gi|57285736|gb|AAW37830.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Staphylococcus
           aureus subsp. aureus COL]
 gi|87126542|gb|ABD21056.1| 6-pyruvoyl tetrahydrobiopterin synthase-like protein
           [Staphylococcus aureus subsp. aureus USA300_FPR3757]
 gi|87202043|gb|ABD29853.1| 6-pyruvoyl tetrahydropterin synthase superfamily, putative
           [Staphylococcus aureus subsp. aureus NCTC 8325]
 gi|147740240|gb|ABQ48538.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Staphylococcus aureus subsp. aureus JH9]
 gi|149945671|gb|ABR51607.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Staphylococcus aureus subsp. aureus JH1]
 gi|150373692|dbj|BAF66952.1| 6-pyruvoyl tetrahydropterin synthase [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|156721174|dbj|BAF77591.1| 6-pyruvoyl tetrahydrobiopterin synthase homologue [Staphylococcus
           aureus subsp. aureus Mu3]
 gi|160367784|gb|ABX28755.1| possible 6-pyruvoyltetrahydropterin synthase [Staphylococcus aureus
           subsp. aureus USA300_TCH1516]
 gi|257272400|gb|EEV04523.1| 6-pyruvoyl tetrahydropterin synthase [Staphylococcus aureus subsp.
           aureus 55/2053]
 gi|257275691|gb|EEV07164.1| 6-pyruvoyl tetrahydropterin synthase [Staphylococcus aureus subsp.
           aureus 65-1322]
 gi|257279326|gb|EEV09927.1| 6-pyruvoyl tetrahydropterin synthase [Staphylococcus aureus subsp.
           aureus 68-397]
 gi|257282246|gb|EEV12381.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           subsp. aureus E1410]
 gi|257284926|gb|EEV15045.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M876]
 gi|257788940|gb|EEV27280.1| conserved hypothetical protein [Staphylococcus aureus A9781]
 gi|257839078|gb|EEV63557.1| conserved hypothetical protein [Staphylococcus aureus A9763]
 gi|257842508|gb|EEV66932.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           A9719]
 gi|257846421|gb|EEV70444.1| 6-pyruvoyl tetrahydropterin synthase [Staphylococcus aureus A9635]
 gi|257849447|gb|EEV73417.1| 6-pyruvoyl tetrahydropterin synthase [Staphylococcus aureus A9299]
 gi|257852201|gb|EEV76128.1| conserved hypothetical protein [Staphylococcus aureus A8115]
 gi|257855402|gb|EEV78340.1| 6-pyruvoyltetrahydropterin synthase [Staphylococcus aureus A6300]
 gi|257857145|gb|EEV80044.1| 6-pyruvoyltetrahydropterin synthase [Staphylococcus aureus A6224]
 gi|257859430|gb|EEV82284.1| conserved hypothetical protein [Staphylococcus aureus A5948]
 gi|257863903|gb|EEV86659.1| 6-pyruvoyl tetrahydropterin synthase [Staphylococcus aureus A5937]
 gi|259159334|gb|EEW44390.1| hypothetical protein SA930_0350 [Staphylococcus aureus 930918-3]
 gi|259163534|gb|EEW48091.1| hypothetical protein SAD30_2173 [Staphylococcus aureus D30]
 gi|262074621|gb|ACY10594.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Staphylococcus
           aureus subsp. aureus ED98]
 gi|282314334|gb|EFB44724.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           subsp. aureus C101]
 gi|282317635|gb|EFB48007.1| queuosine biosynthesis QueD, PTPS-I [Staphylococcus aureus subsp.
           aureus C427]
 gi|282319997|gb|EFB50344.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           subsp. aureus D139]
 gi|282322580|gb|EFB52902.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus
           aureus subsp. aureus M899]
 gi|282325747|gb|EFB56055.1| queuosine biosynthesis protein QueD [Staphylococcus aureus subsp.
           aureus WBG10049]
 gi|282327760|gb|EFB58042.1| queuosine biosynthesis protein QueD [Staphylococcus aureus subsp.
           aureus WW2703/97]
 gi|282331943|gb|EFB61454.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           subsp. aureus Btn1260]
 gi|282591467|gb|EFB96539.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           A10102]
 gi|282596293|gb|EFC01254.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus
           aureus subsp. aureus C160]
 gi|282763189|gb|EFC03320.1| queuosine biosynthesis QueD, PTPS-I [Staphylococcus aureus A8117]
 gi|283460020|gb|EFC07110.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           subsp. aureus H19]
 gi|283470005|emb|CAQ49216.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           subsp. aureus ST398]
 gi|283790991|gb|EFC29806.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus
           aureus subsp. aureus A017934/97]
 gi|285816412|gb|ADC36899.1| Queuosine biosynthesis QueD, PTPS-I [Staphylococcus aureus
           04-02981]
 gi|290921090|gb|EFD98151.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus
           aureus subsp. aureus M1015]
 gi|291095600|gb|EFE25861.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           subsp. aureus 58-424]
 gi|291467638|gb|EFF10153.1| queuosine biosynthesis QueD, PTPS-I [Staphylococcus aureus subsp.
           aureus M809]
 gi|294823912|gb|EFG40338.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           A9754]
 gi|294968574|gb|EFG44597.1| queuosine biosynthesis QueD [Staphylococcus aureus A8819]
 gi|295128675|gb|EFG58306.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           subsp. aureus EMRSA16]
 gi|296886820|gb|EFH25724.1| possible 6-pyruvoyltetrahydropterin synthase [Staphylococcus aureus
           subsp. aureus ATCC 51811]
 gi|297177827|gb|EFH37076.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           A8796]
 gi|297576661|gb|EFH95376.1| possible 6-pyruvoyltetrahydropterin synthase [Staphylococcus aureus
           subsp. aureus MN8]
 gi|298694040|gb|ADI97262.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           subsp. aureus ED133]
 gi|300886903|gb|EFK82105.1| possible 6-pyruvoyltetrahydropterin synthase [Staphylococcus aureus
           subsp. aureus TCH70]
 gi|302332421|gb|ADL22614.1| 6-pyruvoyl tetrahydropterin synthase [Staphylococcus aureus subsp.
           aureus JKD6159]
 gi|302750609|gb|ADL64786.1| 6-pyruvoyl tetrahydropterin synthase [Staphylococcus aureus subsp.
           aureus str. JKD6008]
 gi|304339777|gb|EFM05722.1| possible 6-pyruvoyltetrahydropterin synthase [Staphylococcus aureus
           subsp. aureus ATCC BAA-39]
 gi|312438867|gb|ADQ77938.1| possible 6-pyruvoyltetrahydropterin synthase [Staphylococcus aureus
           subsp. aureus TCH60]
 gi|312829204|emb|CBX34046.1| queuosine biosynthesis protein QueD [Staphylococcus aureus subsp.
           aureus ECT-R 2]
 gi|315129386|gb|EFT85379.1| possible 6-pyruvoyltetrahydropterin synthase [Staphylococcus aureus
           subsp. aureus CGS03]
 gi|315194327|gb|EFU24719.1| possible 6-pyruvoyltetrahydropterin synthase [Staphylococcus aureus
           subsp. aureus CGS00]
 gi|315197687|gb|EFU28022.1| possible 6-pyruvoyltetrahydropterin synthase [Staphylococcus aureus
           subsp. aureus CGS01]
 gi|320139957|gb|EFW31818.1| queuosine biosynthesis protein QueD [Staphylococcus aureus subsp.
           aureus MRSA131]
 gi|320141953|gb|EFW33781.1| queuosine biosynthesis protein QueD [Staphylococcus aureus subsp.
           aureus MRSA177]
 gi|323438940|gb|EGA96675.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus O11]
 gi|323441589|gb|EGA99238.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus O46]
 gi|329313433|gb|AEB87846.1| 6-pyruvoyl tetrahydropterin synthase [Staphylococcus aureus subsp.
           aureus T0131]
 gi|329724519|gb|EGG61026.1| queuosine biosynthesis protein QueD [Staphylococcus aureus subsp.
           aureus 21172]
 gi|329728523|gb|EGG64956.1| queuosine biosynthesis protein QueD [Staphylococcus aureus subsp.
           aureus 21189]
 gi|329729592|gb|EGG65993.1| queuosine biosynthesis protein QueD [Staphylococcus aureus subsp.
           aureus 21193]
          Length = 139

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 62/124 (50%), Gaps = 12/124 (9%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ + F F AAH +P   +   C  +HGH+Y V L + GD    TGF+ +F ++++   
Sbjct: 15  FELNKDFNFSAAHHIP-CEEAGICQNVHGHTYFVNLTIVGDKLDDTGFLVNFSHLKKMIH 73

Query: 61  PLLEKLDHHCLNEIEELEN--PTAENIAIWIWKRLSTSL------SILSSVRVYETPMSW 112
               K DH  LN +   +N  P+ E +A  I++ +  +L           V V ETP S+
Sbjct: 74  ---GKFDHQLLNNLPAFKNKIPSTEIVAETIYQIVKENLASLEHQPKCIQVFVRETPTSY 130

Query: 113 VEYQ 116
           V ++
Sbjct: 131 VVFR 134


>gi|116620683|ref|YP_822839.1| putative 6-pyruvoyl tetrahydropterin synthase [Candidatus
           Solibacter usitatus Ellin6076]
 gi|116223845|gb|ABJ82554.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Candidatus Solibacter usitatus Ellin6076]
          Length = 141

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 49/135 (36%), Positives = 69/135 (51%), Gaps = 18/135 (13%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHR----------MHGHSYRVELVMEGDVDPKTGFVD 50
           M IT+   F A+H       + + +R           HGH+Y VE+ + G+ DP TG V 
Sbjct: 1   MLITRKVEFSASHICRSPLLSDEENRRIFGLAANPHGHGHNYLVEVSLRGEPDPVTGMVL 60

Query: 51  DFFNIEQYF-SPLLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS----ILSS 102
           D   +++     ++E  DH  LN E++  +   PT ENIA  IW+RL   LS     L S
Sbjct: 61  DLKELKEILTREIVEPYDHRFLNYEVQPFDREIPTTENIARDIWRRLEPRLSDPRHRLFS 120

Query: 103 VRVYETPMSWVEYQG 117
           VRVYET   +V+Y G
Sbjct: 121 VRVYETADLYVDYFG 135


>gi|220934010|ref|YP_002512909.1| putative 6-pyruvoyl tetrahydropterin synthase [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219995320|gb|ACL71922.1| putative 6-pyruvoyl tetrahydropterin synthase [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 126

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 38/113 (33%), Positives = 60/113 (53%), Gaps = 8/113 (7%)

Query: 9   FEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDH 68
           F +AH L   P    C RMHGH+++VE  +        G   DF +I+Q    +  +LDH
Sbjct: 13  FASAHTLRDYP--GACARMHGHNWKVEAEVIATRLDDIGMGMDFRDIKQIAREIAGRLDH 70

Query: 69  HCLNEIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEY 115
             LNE+E     NPTAENIA W ++ ++  ++     + ++ ++ET  + V Y
Sbjct: 71  RYLNELEPFTEVNPTAENIAAWFFREMAAQINGPHRRMHALTLWETERACVRY 123


>gi|218885237|ref|YP_002434558.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218756191|gb|ACL07090.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 130

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 41/121 (33%), Positives = 64/121 (52%), Gaps = 9/121 (7%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVD-PKTGFVDDFFNIEQYFS 60
           ++T    F A+H L       KC  MHGH++ VE+V EGD     T  V DF  +++  +
Sbjct: 7   RLTVRSEFCASHALRHYE--GKCESMHGHNFAVEMVAEGDRLTGDTEIVLDFKVLKRELN 64

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
            +L+ LDH  LN++   +  NP++EN++  IW++L+  L+     L SV V E       
Sbjct: 65  AVLDTLDHKNLNDVTPFDTINPSSENLSRHIWQQLAPRLAPHGVRLHSVTVSEKAAQSAT 124

Query: 115 Y 115
           Y
Sbjct: 125 Y 125


>gi|315645294|ref|ZP_07898419.1| 6-pyruvoyl tetrahydrobiopterin synthase [Paenibacillus vortex V453]
 gi|315279336|gb|EFU42642.1| 6-pyruvoyl tetrahydrobiopterin synthase [Paenibacillus vortex V453]
          Length = 163

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 41/124 (33%), Positives = 65/124 (52%), Gaps = 15/124 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y+V   + G    + G   DF  ++  +   
Sbjct: 35  VSKEFTFDAAHHLHAYE--GKCKNLHGHTYKVVFGISG-YTNEIGLTIDFSMLKTIWREQ 91

Query: 63  LEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSL-----------SILSSVRVYETPM 110
           +E  LDH  LNE   L N TAENI +W+++++  +L           +    VR++ETP 
Sbjct: 92  IEPFLDHRYLNETLPLMNTTAENIVVWLYEQMEAALSTEKYSSKEVDARTEFVRLFETPT 151

Query: 111 SWVE 114
           S+ E
Sbjct: 152 SYAE 155


>gi|303247443|ref|ZP_07333715.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfovibrio fructosovorans JJ]
 gi|302491139|gb|EFL51031.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfovibrio fructosovorans JJ]
          Length = 124

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 46/117 (39%), Positives = 57/117 (48%), Gaps = 7/117 (5%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           IT + +F AAHRLP  P    C  MHGH++ V L +      K G V DF  +       
Sbjct: 7   ITVSGSFSAAHRLPGHP--GPCAAMHGHNFAVTLHLVATSL-KDGMVADFLTVRAALDAA 63

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEY 115
             +LDH CLN+I EL  PTAE IA WI+  +   L      LS V V E+      Y
Sbjct: 64  FARLDHACLNDIPELSPPTAEVIAAWIFGEVRPRLEDGRVRLSRVTVEESKGLVASY 120


>gi|27467404|ref|NP_764041.1| 6-pyruvoyl tetrahydrobiopterin synthase-like protein
           [Staphylococcus epidermidis ATCC 12228]
 gi|57866293|ref|YP_187968.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus epidermidis
           RP62A]
 gi|282875713|ref|ZP_06284584.1| queuosine biosynthesis protein QueD [Staphylococcus epidermidis
           SK135]
 gi|293368167|ref|ZP_06614797.1| conserved hypothetical protein [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|27314947|gb|AAO04083.1|AE016745_182 6-pyruvoyl tetrahydrobiopterin synthase-like protein
           [Staphylococcus epidermidis ATCC 12228]
 gi|57636951|gb|AAW53739.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Staphylococcus
           epidermidis RP62A]
 gi|281295740|gb|EFA88263.1| queuosine biosynthesis protein QueD [Staphylococcus epidermidis
           SK135]
 gi|291317701|gb|EFE58117.1| conserved hypothetical protein [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329723342|gb|EGG59872.1| queuosine biosynthesis protein QueD [Staphylococcus epidermidis
           VCU144]
 gi|329735629|gb|EGG71913.1| queuosine biosynthesis protein QueD [Staphylococcus epidermidis
           VCU045]
 gi|329736743|gb|EGG73008.1| queuosine biosynthesis protein QueD [Staphylococcus epidermidis
           VCU028]
          Length = 139

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 64/124 (51%), Gaps = 12/124 (9%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ + F F AAH +P   +  KC R HGH+Y V L + G+   K GF+ +F ++++   
Sbjct: 14  FELNKDFNFSAAHYIP-FEEAGKCIRTHGHTYYVNLTIAGNTLDKCGFLVNFRDLKKLVH 72

Query: 61  PLLEKLDHHCLNEIEELEN--PTAENIAIWIWKRLSTSL------SILSSVRVYETPMSW 112
              E+ DH+ LN++   ++  P+ E +A  I+  +   L           V + ETP S+
Sbjct: 73  ---EQFDHYLLNDLPAFKDKSPSTEIVAQTIYHIIQKELNQRENQPKCVQVYLRETPSSY 129

Query: 113 VEYQ 116
           V Y+
Sbjct: 130 VVYR 133


>gi|283853628|ref|ZP_06370863.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfovibrio sp. FW1012B]
 gi|283570990|gb|EFC19015.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfovibrio sp. FW1012B]
          Length = 124

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 42/117 (35%), Positives = 57/117 (48%), Gaps = 7/117 (5%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           IT +  F AAHRLP  P    C  MHGH++ V + +        G V DF ++       
Sbjct: 7   ITVSGAFSAAHRLPDHP--GPCAFMHGHNFEVAVALTATAL-VRGMVADFLDVRAALDAA 63

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEY 115
             +LDH CLN+I EL  PTAE +A WI+ +L   L      ++ V V E+      Y
Sbjct: 64  FARLDHACLNDIPELSPPTAEVLAAWIFGQLRERLDDGRVRVARVTVTESAGLAATY 120


>gi|114778001|ref|ZP_01452901.1| hypothetical protein SPV1_05347 [Mariprofundus ferrooxydans PV-1]
 gi|114551607|gb|EAU54160.1| hypothetical protein SPV1_05347 [Mariprofundus ferrooxydans PV-1]
          Length = 124

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 35/121 (28%), Positives = 63/121 (52%), Gaps = 8/121 (6%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +++    F AAH L   P    C R+HGH++ V+L +E     + G   D+  ++    
Sbjct: 4   FELSIETHFSAAHSLRDYPGD--CARLHGHNWHVKLYVECTELDELGLGIDYKVLKSELK 61

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
             LE  DH+ LN++   +  NP++EN+A  ++K++S+ L      +S + + ET  + V 
Sbjct: 62  EALEPWDHYNLNDVPPFDRINPSSENVAAELYKKMSSRLDNERVRVSRIEICETCTAMVT 121

Query: 115 Y 115
           Y
Sbjct: 122 Y 122


>gi|78186630|ref|YP_374673.1| 6-pyruvoyltetrahydropterin synthase [Chlorobium luteolum DSM 273]
 gi|78166532|gb|ABB23630.1| 6-pyruvoyltetrahydropterin synthase [Chlorobium luteolum DSM 273]
          Length = 162

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 42/136 (30%), Positives = 68/136 (50%), Gaps = 21/136 (15%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHR--MHGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+   F AAHRL     +         KC     HGH+Y++E+ + G VDP+TG++ D 
Sbjct: 26  VTRTIEFNAAHRLFNPKFSEEMNTRVYGKCANKYGHGHNYQLEITLGGTVDPETGYLFDL 85

Query: 53  FNIEQYFSPL-LEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI-------LS 101
             +++        + DH  LN ++ ELE   PT E +A+ IW  L   ++        L 
Sbjct: 86  KELKKILEEEVTARFDHRHLNHDVPELEGLVPTTETLAVLIWDILEERIAAIDNREISLQ 145

Query: 102 SVRVYETPMSWVEYQG 117
           +V+++ET  + V Y G
Sbjct: 146 AVKLHETGKNSVSYLG 161


>gi|91084789|ref|XP_972673.1| PREDICTED: similar to 6-pyruvoyltetrahydropterin synthase, putative
           [Tribolium castaneum]
 gi|270008955|gb|EFA05403.1| hypothetical protein TcasGA2_TC015575 [Tribolium castaneum]
          Length = 143

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 39/131 (29%), Positives = 70/131 (53%), Gaps = 17/131 (12%)

Query: 4   TQAFTFEAAHRLPRVPKT--------HKCH--RMHGHSYRVELVMEGDVDPKTGFVDDFF 53
           T+  TF A HRL     +         KC+    HGH+Y V++ + G +DPKTG + +  
Sbjct: 12  TRRITFSACHRLHSPHLSDAENAQIYGKCNHINGHGHNYIVKVTLFGAIDPKTGMILNMT 71

Query: 54  NIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI---LSSVRVY 106
            +++Y    +++ +DH  L+ +++  +    T EN+ ++IW+R+   +     L  V VY
Sbjct: 72  ELKKYMEEAIMQPMDHKNLDKDVDFFKTRPSTTENLTVFIWERMKKVMERPDLLYEVLVY 131

Query: 107 ETPMSWVEYQG 117
           ET  + V+Y+G
Sbjct: 132 ETENNIVKYRG 142


>gi|251810141|ref|ZP_04824614.1| possible 6-pyruvoyltetrahydropterin synthase [Staphylococcus
           epidermidis BCM-HMP0060]
 gi|251806333|gb|EES58990.1| possible 6-pyruvoyltetrahydropterin synthase [Staphylococcus
           epidermidis BCM-HMP0060]
          Length = 148

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 64/124 (51%), Gaps = 12/124 (9%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ + F F AAH +P   +  KC R HGH+Y V L + G+   K GF+ +F ++++   
Sbjct: 23  FELNKDFNFSAAHYIP-FEEAGKCIRTHGHTYYVNLTIAGNTLDKCGFLVNFRDLKKLVH 81

Query: 61  PLLEKLDHHCLNEIEELEN--PTAENIAIWIWKRLSTSL------SILSSVRVYETPMSW 112
              E+ DH+ LN++   ++  P+ E +A  I+  +   L           V + ETP S+
Sbjct: 82  ---EQFDHYLLNDLPAFKDKSPSTEIVAQTIYHIIQKELNQRENQPKCVQVYLRETPSSY 138

Query: 113 VEYQ 116
           V Y+
Sbjct: 139 VVYR 142


>gi|303248699|ref|ZP_07334953.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfovibrio fructosovorans JJ]
 gi|302489955|gb|EFL49881.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfovibrio fructosovorans JJ]
          Length = 129

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 43/121 (35%), Positives = 66/121 (54%), Gaps = 9/121 (7%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDV-DPKTGFVDDFFNIEQYFS 60
           ++T   +F A+H L        C  +HGH++ VE V+EG+  DPK  ++ DF  +     
Sbjct: 8   RLTVTESFSASHCLRGYE--GPCENLHGHNFGVEAVVEGERLDPKVEYLMDFKRLRGALR 65

Query: 61  PLLEKLDHHCLNEIEEL--ENPTAENIAIWIWKRLSTSL----SILSSVRVYETPMSWVE 114
            +L  LDHH LNE+     ENP++EN+A +I+++L  +L    + L SV V E   S   
Sbjct: 66  EILAPLDHHHLNEVPPFDVENPSSENLARYIYRKLEGALEGEAARLVSVSVLEKEASKAT 125

Query: 115 Y 115
           Y
Sbjct: 126 Y 126


>gi|55820875|ref|YP_139317.1| 6-pyruvoyl tetrahydrobiopterin synthase [Streptococcus thermophilus
           LMG 18311]
 gi|55822791|ref|YP_141232.1| 6-pyruvoyl tetrahydrobiopterin synthase [Streptococcus thermophilus
           CNRZ1066]
 gi|116627684|ref|YP_820303.1| 6-pyruvoyl tetrahydrobiopterin synthase [Streptococcus thermophilus
           LMD-9]
 gi|55736860|gb|AAV60502.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Streptococcus
           thermophilus LMG 18311]
 gi|55738776|gb|AAV62417.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Streptococcus
           thermophilus CNRZ1066]
 gi|116100961|gb|ABJ66107.1| 6-pyruvoyl-tetrahydropterin synthase [Streptococcus thermophilus
           LMD-9]
          Length = 147

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 42/120 (35%), Positives = 64/120 (53%), Gaps = 9/120 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y +++ + G      G   DF +++  +   
Sbjct: 25  VSKEFTFDAAHHLFNYE--GKCKSLHGHTYHLQIAVSG-YLDDRGMTYDFGDLKNIYKNH 81

Query: 63  LEKL-DHHCLNEIEELENPTAENIAIWIWKRLSTSLSI-----LSSVRVYETPMSWVEYQ 116
           LE   DH  LNE     N TAEN+  WI++  S  LS      L  VR+YETP ++ E++
Sbjct: 82  LEPYLDHRYLNESLPYMNTTAENMVFWIFQTTSKYLSEERELRLEYVRLYETPTAFAEFR 141


>gi|302341862|ref|YP_003806391.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfarculus baarsii DSM 2075]
 gi|301638475|gb|ADK83797.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfarculus baarsii DSM 2075]
          Length = 122

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 61/120 (50%), Gaps = 7/120 (5%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++     F AAH L       +C  +HGH+++VE+V+ GD   K   + DF  +++  +
Sbjct: 2   FELMVTGRFAAAHSLRNF--NGRCEALHGHNWKVEVVVYGDKLDKADLLMDFGELKKLMN 59

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLSILSSVR---VYETPMSWVEY 115
             L+ LDH  LNE+   +  NP++E IA  I ++++  L     VR    +E+  S   Y
Sbjct: 60  QALDNLDHRHLNEVPPFDRLNPSSEQIARHIAQQVALGLPEHVRVRRVSAWESDDSRASY 119


>gi|312278214|gb|ADQ62871.1| 6-pyruvoyl-tetrahydropterin synthase [Streptococcus thermophilus
           ND03]
          Length = 147

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 42/120 (35%), Positives = 65/120 (54%), Gaps = 9/120 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y +++ + G    + G   DF +++  +   
Sbjct: 25  VSKEFTFDAAHHLFNYE--GKCKSLHGHTYHLQIAVSG-YLDERGMTYDFGDLKNIYKNH 81

Query: 63  LEKL-DHHCLNEIEELENPTAENIAIWIWKRLSTSLSI-----LSSVRVYETPMSWVEYQ 116
           LE   DH  LNE     N TAEN+  WI++  S  LS      L  VR+YETP ++ E++
Sbjct: 82  LEPYLDHRYLNESLPYMNTTAENMVFWIFQTTSEYLSEERELRLEYVRLYETPTAFAEFR 141


>gi|317152328|ref|YP_004120376.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfovibrio aespoeensis Aspo-2]
 gi|316942579|gb|ADU61630.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfovibrio aespoeensis Aspo-2]
          Length = 126

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 45/120 (37%), Positives = 68/120 (56%), Gaps = 8/120 (6%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDV-DPKTGFVDDFFNIEQYFS 60
           ++T    F AAH+L       KC  MHGH++ VE+ +EGD  D K  ++ DF  I++   
Sbjct: 6   RLTITQDFSAAHQLRNY--GGKCENMHGHNFGVEVAVEGDRLDDKVHYLVDFKEIKRLTK 63

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLSI---LSSVRVYETPMSWVEY 115
            +L++LDH  LNE+E     NP++EN+A++I+K L  S+     L+ V V E   S   Y
Sbjct: 64  AVLDRLDHKHLNEVECFTEINPSSENLAMFIYKELKDSMPENVRLAEVSVSEKDSSKATY 123


>gi|320106299|ref|YP_004181889.1| hypothetical protein AciPR4_1064 [Terriglobus saanensis SP1PR4]
 gi|319924820|gb|ADV81895.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Terriglobus saanensis SP1PR4]
          Length = 137

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 44/131 (33%), Positives = 66/131 (50%), Gaps = 16/131 (12%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T+   F ++H                 KC  +HGH  +Y +E+ + G+VDP TGFV D 
Sbjct: 4   LTRKAEFSSSHFYRNPEWSEEENVRRFGKCANVHGHGHNYTLEVTVGGEVDPVTGFVVDL 63

Query: 53  FNIEQYF-SPLLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVRVY 106
             +++     ++   DH  LN E+ E  +  PT ENIA+ IW+RL   +    L  VRVY
Sbjct: 64  KLLKEILEREVVSIYDHRHLNYEVPEFAHVIPTTENIAVAIWRRLDGKIPNAKLERVRVY 123

Query: 107 ETPMSWVEYQG 117
           E P  + +Y G
Sbjct: 124 EMPDLFADYYG 134


>gi|269929213|ref|YP_003321534.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Sphaerobacter thermophilus DSM 20745]
 gi|269788570|gb|ACZ40712.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Sphaerobacter thermophilus DSM 20745]
          Length = 125

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 58/119 (48%), Gaps = 8/119 (6%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             I     FEAAHRL          R+HGH+YRVE+ + G      G + D   ++ +  
Sbjct: 2   FAIGVVAQFEAAHRLRG--DFGPASRLHGHTYRVEVEVAGPQLNDDGTLFDLGLLKAWVD 59

Query: 61  PLLEKLDHHCLNEIEEL--ENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWV 113
             + +L++  L+ +      N TAE +A ++ + L+  L      + +VRV+E+P ++ 
Sbjct: 60  EAVGELNYQNLDVLPAFAQRNSTAEEVARFLRETLAPRLHGKGLRMLTVRVWESPQAYA 118


>gi|260223400|emb|CBA33929.1| hypothetical protein Csp_B21490 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 135

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 40/109 (36%), Positives = 60/109 (55%), Gaps = 4/109 (3%)

Query: 2   KITQAFTFEAAHRLPRVPKTHK----CHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQ 57
           +++Q F F+AAH L R     +      R+HGH+Y  E+ + G  D  TG V D  ++  
Sbjct: 14  EVSQKFFFDAAHTLKRTVDDAEEIAGSRRIHGHTYHAEVTVAGSADADTGMVVDLGHLRN 73

Query: 58  YFSPLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVY 106
               L  +LDHH L+E+E L   T EN+A +IW+ ++     LS VRV+
Sbjct: 74  AIQVLRPQLDHHLLDEVEGLGPGTLENLAAFIWRAMAAEFPGLSQVRVW 122


>gi|167461681|ref|ZP_02326770.1| 6-pyruvoyl tetrahydrobiopterin synthase [Paenibacillus larvae
           subsp. larvae BRL-230010]
 gi|322383447|ref|ZP_08057227.1| 6-pyruvoyl tetrahydropterin synthase-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
 gi|321152248|gb|EFX45074.1| 6-pyruvoyl tetrahydropterin synthase-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
          Length = 161

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 39/121 (32%), Positives = 61/121 (50%), Gaps = 11/121 (9%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+A+H L       KC  +HGH+Y+    + G V+     VD     E +   +
Sbjct: 34  VSKEFTFDASHHLHAYE--GKCKNLHGHTYKAVFGISGRVNDIGLMVDFADIKEIWKQDI 91

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS---------ILSSVRVYETPMSWV 113
              LDH  LNE     N TAEN+ +W+++++  SL           +  VR+YETP S+ 
Sbjct: 92  EPYLDHRYLNETLPAMNTTAENMVVWLFEKMEESLPDRIMEEQGARVEFVRLYETPTSFA 151

Query: 114 E 114
           E
Sbjct: 152 E 152


>gi|242242078|ref|ZP_04796523.1| possible 6-pyruvoyltetrahydropterin synthase [Staphylococcus
           epidermidis W23144]
 gi|242234463|gb|EES36775.1| possible 6-pyruvoyltetrahydropterin synthase [Staphylococcus
           epidermidis W23144]
 gi|319401216|gb|EFV89431.1| queuosine biosynthesis protein QueD [Staphylococcus epidermidis
           FRI909]
          Length = 139

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 64/124 (51%), Gaps = 12/124 (9%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ + F F AAH +P   +  KC R HGH+Y V L + G+   K GF+ +F ++++   
Sbjct: 14  FELNKDFNFSAAHYIP-FEEAGKCIRTHGHTYYVNLTIAGNTLDKCGFLVNFRDLKKLVH 72

Query: 61  PLLEKLDHHCLNEIEELEN--PTAENIAIWIWKRLSTSL------SILSSVRVYETPMSW 112
              E+ DH+ LN++   ++  P+ E +A  I+  +   L           V + ETP S+
Sbjct: 73  ---EQFDHYLLNDLPAFKDKSPSTEIVAQTIYHIVQKELNQRENQPKCVQVYLRETPSSY 129

Query: 113 VEYQ 116
           V Y+
Sbjct: 130 VVYR 133


>gi|241766441|ref|ZP_04764314.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Acidovorax delafieldii 2AN]
 gi|241363363|gb|EER58878.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Acidovorax delafieldii 2AN]
          Length = 124

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 61/107 (57%), Gaps = 1/107 (0%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             I+Q F F+AAH L R  +     R+HGH+Y  E+ + G  DP TG V D   + Q  +
Sbjct: 3   FTISQRFFFDAAHTLRREIEAEGSRRVHGHTYHAEVFLTGPRDPATGMVLDLGLLRQGLA 62

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSL-SILSSVRVY 106
            + E+LDHH L+E+  L  PT EN+ ++I + L   L   +S VRV+
Sbjct: 63  VVREQLDHHMLDEVPGLGTPTLENLCVFIAQALPADLRPRVSRVRVW 109


>gi|317129080|ref|YP_004095362.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Bacillus cellulosilyticus DSM 2522]
 gi|315474028|gb|ADU30631.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Bacillus cellulosilyticus DSM 2522]
          Length = 155

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 45/119 (37%), Positives = 69/119 (57%), Gaps = 10/119 (8%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y+V   + G VD + G V DF +I+Q +   
Sbjct: 31  VSKEFTFDAAHHLHSYE--GKCKNLHGHTYKVIFGISGHVD-EIGLVIDFSDIKQIWKEQ 87

Query: 63  LE-KLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS------ILSSVRVYETPMSWVE 114
           +E  LDH  LNE     N TAEN+ +WI++R+  +L        +  V+++ETP S+ E
Sbjct: 88  IEIYLDHRYLNETLPKMNTTAENMVVWIFERMEHALQAFPNKCRVEFVKLFETPTSYAE 146


>gi|282922003|ref|ZP_06329700.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           A9765]
 gi|282593661|gb|EFB98653.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           A9765]
          Length = 139

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 62/124 (50%), Gaps = 12/124 (9%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ + F F AAH +P   +   C  +HGH+Y V L + GD    TGF+ +F ++++   
Sbjct: 15  FELNKDFNFSAAHHIP-CEEAGICQNVHGHTYFVNLTIVGDKLDDTGFLVNFSHLKKM-- 71

Query: 61  PLLEKLDHHCLNEIEELEN--PTAENIAIWIWKRLSTSL------SILSSVRVYETPMSW 112
               K DH  LN +   +N  P+ E +A  I++ +  +L           V V ETP S+
Sbjct: 72  -THGKFDHQLLNNLPAFKNKIPSTEIVAETIYQIVKENLASLEHQPKCIQVFVRETPTSY 130

Query: 113 VEYQ 116
           V ++
Sbjct: 131 VVFR 134


>gi|289551434|ref|YP_003472338.1| Queuosine biosynthesis QueD, PTPS-I [Staphylococcus lugdunensis
           HKU09-01]
 gi|315658943|ref|ZP_07911810.1| putative 6-pyruvoyltetrahydropterin synthase [Staphylococcus
           lugdunensis M23590]
 gi|289180965|gb|ADC88210.1| Queuosine biosynthesis QueD, PTPS-I [Staphylococcus lugdunensis
           HKU09-01]
 gi|315496067|gb|EFU84395.1| putative 6-pyruvoyltetrahydropterin synthase [Staphylococcus
           lugdunensis M23590]
          Length = 139

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 36/124 (29%), Positives = 60/124 (48%), Gaps = 12/124 (9%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ + F F AAH +P      KC R HGH+Y V L + GD     GF+ +F  ++    
Sbjct: 15  FELNKDFNFSAAHFIP-CKDAGKCVRTHGHTYFVNLTIAGDTLDHNGFLINFQELKALIH 73

Query: 61  PLLEKLDHHCLNEIEELEN--PTAENIAIWIWKRLSTSL------SILSSVRVYETPMSW 112
              ++ DH+ LN++   ++  P+ E +A  I+  +   L           V + ETP S+
Sbjct: 74  ---DQFDHYLLNDLPHFKDQSPSTEIVAQTIYNMIENHLMQYTNRPHCVQVYLRETPTSY 130

Query: 113 VEYQ 116
           V Y+
Sbjct: 131 VVYR 134


>gi|149924128|ref|ZP_01912507.1| hypothetical protein PPSIR1_28706 [Plesiocystis pacifica SIR-1]
 gi|149815025|gb|EDM74583.1| hypothetical protein PPSIR1_28706 [Plesiocystis pacifica SIR-1]
          Length = 129

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 61/123 (49%), Gaps = 11/123 (8%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++     F AAH L        C ++HGH+Y+VE+ +  +   + G   DF  +      
Sbjct: 6   RLKTNVHFAAAHVLRGY--GGDCEQLHGHNYKVEIEVACEQLDELGMGVDFRAVRAAARE 63

Query: 62  LLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLSI-------LSSVRVYETPMSW 112
           ++  +DH  LNEI      NPTAE+IA +I++ L+  L+        L+++ V+ET    
Sbjct: 64  VVGVIDHRFLNEIPPFTEVNPTAEHIAAYIYEGLARRLAELAGERVQLAAITVWETERDS 123

Query: 113 VEY 115
           V Y
Sbjct: 124 VTY 126


>gi|269940288|emb|CBI48665.1| putative 6-pyruvoyl tetrahydropterin synthase [Staphylococcus
           aureus subsp. aureus TW20]
          Length = 139

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 62/124 (50%), Gaps = 12/124 (9%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ + F F AAH +P   +   C  +HGH+Y V L + GD    TGF+ +F ++++   
Sbjct: 15  FELNKDFNFSAAHHIP-CEEAGICQNVHGHTYFVNLTIVGDKLDDTGFLVNFSHLKKMIH 73

Query: 61  PLLEKLDHHCLNEIEELEN--PTAENIAIWIWKRLSTSL------SILSSVRVYETPMSW 112
               K DH  LN +   +N  P+ E +A  I++ +  +L           V V ETP S+
Sbjct: 74  ---GKFDHQPLNNLPAFKNKIPSTEIVAETIYQIVKENLASLEHQPKCIQVFVRETPTSY 130

Query: 113 VEYQ 116
           V ++
Sbjct: 131 VVFR 134


>gi|313677646|ref|YP_004055642.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Marivirga tractuosa DSM 4126]
 gi|312944344|gb|ADR23534.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Marivirga tractuosa DSM 4126]
          Length = 138

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 37/135 (27%), Positives = 61/135 (45%), Gaps = 20/135 (14%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCHR--MHGHSYRVELVMEGDVDPKTGFVDDF 52
           + +   F AAH+L                C     HGH++ + + ++G+ DP TGFV D 
Sbjct: 4   VNRKEHFNAAHKLFNPNWSREKNEEVFGPCANENWHGHNFELIVTVKGEPDPDTGFVVDL 63

Query: 53  FNIEQYFS-PLLEKLDHHCLN-EIEEL--ENPTAENIAIWIWKRLSTSLSI------LSS 102
             +       +++K+DH  LN ++  L  +  + E I    WK L   +        L  
Sbjct: 64  KKLSNLIKSEVIDKVDHKNLNMDVPFLVGKMASCEVIIAEFWKILEPKVKQLQEGSSLHK 123

Query: 103 VRVYETPMSWVEYQG 117
           + +YETP ++VEY G
Sbjct: 124 LTLYETPRNFVEYYG 138


>gi|147669988|ref|YP_001214806.1| putative 6-pyruvoyl tetrahydropterin synthase [Dehalococcoides sp.
           BAV1]
 gi|146270936|gb|ABQ17928.1| preQ(0) biosynthesis protein QueD [Dehalococcoides sp. BAV1]
          Length = 123

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 41/120 (34%), Positives = 63/120 (52%), Gaps = 8/120 (6%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           ++    FEAAH L       KC  +HGH Y V L ++     + G   DF  ++   + +
Sbjct: 4   LSIKKHFEAAHFLRGYK--GKCENLHGHRYEVALKIKTGELDECGMGADFSLLKTRLNEV 61

Query: 63  LEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEYQ 116
           L+  DH CLN++   +  NP+AENIA  I+ +L T ++     L  + V+E+P S V YQ
Sbjct: 62  LQSYDHTCLNDLTPFDNINPSAENIAKDIYDKLKTVINKKGVELWGIEVWESPDSSVLYQ 121


>gi|296329699|ref|ZP_06872184.1| 6-pyruvoyl tetrahydrobiopterin synthase-like; queuosine
           biosynthesis [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305674096|ref|YP_003865768.1| 6-pyruvoyl tetrahydrobiopterin synthase-like; queuosine
           biosynthesis [Bacillus subtilis subsp. spizizenii str.
           W23]
 gi|296153197|gb|EFG94061.1| 6-pyruvoyl tetrahydrobiopterin synthase-like; queuosine
           biosynthesis [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305412340|gb|ADM37459.1| 6-pyruvoyl tetrahydrobiopterin synthase-like; queuosine
           biosynthesis [Bacillus subtilis subsp. spizizenii str.
           W23]
          Length = 146

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 35/128 (27%), Positives = 56/128 (43%), Gaps = 16/128 (12%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ +     AAH +PR      C R+HGH+Y V + + GD    +GF+ +F  +++   
Sbjct: 15  FELNKDMHISAAHFIPR-ESAGACSRVHGHTYTVNITVAGDELDDSGFLVNFSVLKKLVH 73

Query: 61  PLLEKLDHHCLNEIEELEN------PTAENIAIWIWKRLSTSL------SILSSVRVYET 108
                 DH  LN+ E+         PT E +A  I+  +   L           V V ET
Sbjct: 74  ---GNYDHTLLNDHEDFSQDDRYSLPTTEVVAKTIYDNVQAYLDTLENKPNCVQVFVRET 130

Query: 109 PMSWVEYQ 116
           P S+  Y+
Sbjct: 131 PTSYCVYR 138


>gi|193695136|ref|XP_001946793.1| PREDICTED: 6-pyruvoyl tetrahydrobiopterin synthase-like
           [Acyrthosiphon pisum]
          Length = 138

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 41/132 (31%), Positives = 73/132 (55%), Gaps = 17/132 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHR--MHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F + HRL          +    KC+    HGH+Y+VE+ ++G +D  TG V + 
Sbjct: 6   ITRVEKFSSCHRLHSNNLSDEENIKIFGKCNNKNGHGHNYKVEVTVKGLIDENTGMVMNV 65

Query: 53  FNIEQYFS-PLLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSL---SILSSVRV 105
            ++++Y +  ++E LDH  L+ ++   +    T EN+AI+IWK L   +   ++L  V++
Sbjct: 66  SDLKKYINVAVMEPLDHKNLDMDVPYFKHHVSTTENVAIFIWKSLKDVMHNPNLLYKVKL 125

Query: 106 YETPMSWVEYQG 117
           +ET  + V Y+G
Sbjct: 126 FETDKNIVVYKG 137


>gi|159896663|ref|YP_001542910.1| putative 6-pyruvoyl tetrahydropterin synthase [Herpetosiphon
           aurantiacus ATCC 23779]
 gi|159889702|gb|ABX02782.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Herpetosiphon aurantiacus ATCC 23779]
          Length = 273

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 38/130 (29%), Positives = 60/130 (46%), Gaps = 16/130 (12%)

Query: 4   TQAFTFEAAHRLPRVPK--------THKCHR--MHGHSYRVELVMEGDVDPKTGFVDDFF 53
           T+ F F A+HR  R             KC     HGH+Y + + + G VDP TG V +  
Sbjct: 6   TRRFNFSASHRYWREEWSLEQNEAVFGKCTNRYGHGHNYELFVTVAGAVDPITGMVMNMV 65

Query: 54  NIEQYFSPLLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI---LSSVRVYE 107
            +++  + +L++ DH  LN +        PT EN+   +W  +   L     L+ +R+YE
Sbjct: 66  ELKRLVTMVLDQFDHKHLNEDTPYFREVIPTTENLVRVLWGLIEPQLPKGVRLAKLRLYE 125

Query: 108 TPMSWVEYQG 117
               + EY G
Sbjct: 126 NSDLYAEYFG 135



 Score = 94.1 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 38/125 (30%), Positives = 67/125 (53%), Gaps = 14/125 (11%)

Query: 5   QAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDFFN 54
           + + F AAHRL               KC+    HGH+Y++E+ ++G +D +TG V D  +
Sbjct: 144 RRYEFSAAHRLHAQSLTDEANREIYGKCNNPNGHGHNYQLEVTVDGLIDAQTGMVIDLVD 203

Query: 55  IEQYFSPLLEKLDHHCLN-EIEEL--ENPTAENIAIWIWKRLSTSL-SILSSVRVYETPM 110
           +++    +L+  DH  L+ ++ E   +  TAENI + +W+RL     S L  +R++ET  
Sbjct: 204 MDRRVQSVLDNWDHRHLDYQVAEFAEQPSTAENIVVVLWQRLEALFGSQLKHLRLWETAN 263

Query: 111 SWVEY 115
           +  +Y
Sbjct: 264 NVFDY 268


>gi|221309237|ref|ZP_03591084.1| hypothetical protein Bsubs1_07601 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221313565|ref|ZP_03595370.1| hypothetical protein BsubsN3_07542 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221318487|ref|ZP_03599781.1| hypothetical protein BsubsJ_07476 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221322760|ref|ZP_03604054.1| hypothetical protein BsubsS_07582 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|321315128|ref|YP_004207415.1| 6-pyruvoyl tetrahydrobiopterin synthase-like; queuosine
           biosynthesis [Bacillus subtilis BSn5]
 gi|290463414|sp|O31676|QUED_BACSU RecName: Full=6-carboxy-5,6,7,8-tetrahydropterin synthase;
           Short=CPH4 synthase; AltName: Full=Queuosine
           biosynthesis protein queD
 gi|291483908|dbj|BAI84983.1| hypothetical protein BSNT_02307 [Bacillus subtilis subsp. natto
           BEST195]
 gi|320021402|gb|ADV96388.1| 6-pyruvoyl tetrahydrobiopterin synthase-like; queuosine
           biosynthesis [Bacillus subtilis BSn5]
          Length = 146

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 35/128 (27%), Positives = 56/128 (43%), Gaps = 16/128 (12%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ +     AAH +PR      C R+HGH+Y V + + GD    +GF+ +F  +++   
Sbjct: 15  FELNKDMHISAAHFIPR-ESAGACSRVHGHTYTVNITVAGDELDDSGFLVNFSVLKKLVH 73

Query: 61  PLLEKLDHHCLNEIEELEN------PTAENIAIWIWKRLSTSL------SILSSVRVYET 108
                 DH  LN+ E+         PT E +A  I+  +   L           V V ET
Sbjct: 74  ---GNYDHTLLNDHEDFSQDDRYSLPTTEVVAKTIYDNVQAYLDTLENKPTCVQVFVRET 130

Query: 109 PMSWVEYQ 116
           P S+  Y+
Sbjct: 131 PTSYCVYR 138


>gi|312071271|ref|XP_003138531.1| 6-pyruvoyl tetrahydropterin synthase [Loa loa]
 gi|307766300|gb|EFO25534.1| 6-pyruvoyl tetrahydropterin synthase [Loa loa]
          Length = 136

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 37/132 (28%), Positives = 70/132 (53%), Gaps = 16/132 (12%)

Query: 2   KITQAFTFEAAHRL--------PRVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDD 51
           ++T+  TF A+HRL               KC+ +  HGH+Y  E+ + G +DPK+G V +
Sbjct: 5   ELTRRETFSASHRLQNAMLNATENRQLYGKCNNLNGHGHNYIWEVTLRGSIDPKSGMVYN 64

Query: 52  FFNIEQYFSPLLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSL---SILSSVRV 105
             N++     +L+K+DH  L+ ++   ++   T EN+ +++W  L + +    +L  + +
Sbjct: 65  LVNLKNEMKSVLDKVDHKNLDKDVVYFKSNVSTTENLIVYLWNELKSKIGNPDLLYKMIL 124

Query: 106 YETPMSWVEYQG 117
           +ET  + V Y G
Sbjct: 125 HETEKNSVTYHG 136


>gi|299134644|ref|ZP_07027836.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Afipia sp. 1NLS2]
 gi|298590454|gb|EFI50657.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Afipia sp. 1NLS2]
          Length = 122

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 39/117 (33%), Positives = 63/117 (53%), Gaps = 2/117 (1%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++T++F FEAAH L           +HGHS+R E+ + G  DP TG V D   +E+  + 
Sbjct: 3   ELTKSFHFEAAHSLKGTTLGENSEEIHGHSFRAEVTIRGTPDPATGMVMDLGLLERKIAD 62

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYE-TPMSWVEYQG 117
           + + LDH  LN+IE +  PT EN++ +IW  +  +   ++ V V+  +      Y G
Sbjct: 63  VRKALDHKFLNKIEAIGLPTLENLSRYIWDSVQGA-GDVTRVSVHRDSCGESCTYFG 118


>gi|253731334|ref|ZP_04865499.1| possible 6-pyruvoyltetrahydropterin synthase [Staphylococcus aureus
           subsp. aureus USA300_TCH959]
 gi|253732845|ref|ZP_04867010.1| possible 6-pyruvoyltetrahydropterin synthase [Staphylococcus aureus
           subsp. aureus TCH130]
 gi|253725075|gb|EES93804.1| possible 6-pyruvoyltetrahydropterin synthase [Staphylococcus aureus
           subsp. aureus USA300_TCH959]
 gi|253729210|gb|EES97939.1| possible 6-pyruvoyltetrahydropterin synthase [Staphylococcus aureus
           subsp. aureus TCH130]
          Length = 139

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 62/124 (50%), Gaps = 12/124 (9%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ + F F AAH +P   +   C  +HGH+Y V L + GD    TGF+ +F ++++   
Sbjct: 15  FELNKDFNFSAAHHIP-CEEAGICQNVHGHTYFVNLTIVGDKLDNTGFLVNFSHLKKMIH 73

Query: 61  PLLEKLDHHCLNEIEELEN--PTAENIAIWIWKRLSTSL------SILSSVRVYETPMSW 112
               K DH  LN +   +N  P+ E +A  I++ +  +L           V V ETP S+
Sbjct: 74  ---GKFDHQLLNNLPAFKNKIPSTEIVAETIYQIVKENLASLEHQPKCIQVFVRETPTSY 130

Query: 113 VEYQ 116
           V ++
Sbjct: 131 VVFR 134


>gi|254674033|emb|CBA09817.1| conserved hypothetical protein [Neisseria meningitidis alpha275]
 gi|325141741|gb|EGC64194.1| queuosine biosynthesis protein QueD [Neisseria meningitidis
           961-5945]
 gi|325197739|gb|ADY93195.1| queuosine biosynthesis protein QueD [Neisseria meningitidis G2136]
          Length = 140

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 40/141 (28%), Positives = 68/141 (48%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEG---DVDPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +         K G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSDGIIKGGAKDGMVMDFTDLKA 58

Query: 58  YF-SPLLEKLDHHCL--------NEIEEL------------ENPTAENIAIWIWKRLSTS 96
                + +  DH  +        ++I  L               TAEN+A+ ++ RL  +
Sbjct: 59  IVKQHITDPFDHAFIYHGGNSRESQIAALLEGWNMKTLRLPCRTTAENMAVEMYGRLKNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              +  V+++ETP S  EY+G
Sbjct: 119 GLNVCRVKLWETPTSCAEYEG 139


>gi|82750413|ref|YP_416154.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           RF122]
 gi|82655944|emb|CAI80348.1| 6-pyruvoyl tetrahydrobiopterin synthase [Staphylococcus aureus
           RF122]
          Length = 139

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 62/124 (50%), Gaps = 12/124 (9%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ + F F AAH +P   +   C  +HGH+Y V L + GD    TGF+ +F ++++   
Sbjct: 15  FELNKDFNFSAAHHIP-CEEAGICQNVHGHTYFVNLTIVGDKLDDTGFLVNFSHLKKLIH 73

Query: 61  PLLEKLDHHCLNEIEELEN--PTAENIAIWIWKRLSTSL------SILSSVRVYETPMSW 112
               K DH  LN +   +N  P+ E +A  I++ +  +L           V V ETP S+
Sbjct: 74  ---GKFDHQLLNNLPAFKNKIPSTEIVAETIYQIVKENLASLEHQPKCIQVFVRETPTSY 130

Query: 113 VEYQ 116
           V ++
Sbjct: 131 VVFR 134


>gi|89097395|ref|ZP_01170284.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus sp. NRRL B-14911]
 gi|89087691|gb|EAR66803.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus sp. NRRL B-14911]
          Length = 157

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 44/121 (36%), Positives = 70/121 (57%), Gaps = 12/121 (9%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y+V   + G VD + G + DF +I++ +   
Sbjct: 31  VSKEFTFDAAHHLHCYE--GKCKNLHGHTYKVIFGISGYVD-EIGLLIDFGDIKEIWKKQ 87

Query: 63  LE-KLDHHCLNEIEELENPTAENIAIWIWKRLSTSL--------SILSSVRVYETPMSWV 113
           +E  LDH  LNE     N TAEN+ +WI++++S  L        + +  VR++ETP S+ 
Sbjct: 88  IEVHLDHKYLNETLPPMNTTAENMVVWIYEQMSACLKDYSPQQDAKVEFVRLFETPTSYA 147

Query: 114 E 114
           E
Sbjct: 148 E 148


>gi|116071454|ref|ZP_01468722.1| 6-pyruvoyltetrahydropterin synthase [Synechococcus sp. BL107]
 gi|116065077|gb|EAU70835.1| 6-pyruvoyltetrahydropterin synthase [Synechococcus sp. BL107]
          Length = 244

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 44/130 (33%), Positives = 66/130 (50%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL R   +         KC R HGH  +Y V++ + G +DP+TG V D 
Sbjct: 94  LTIRTHFAAAHRLARPELSQEENEQIYGKCARPHGHGHNYLVDITVRGSIDPRTGMVCDL 153

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSL----SILSSVR 104
             +++     ++E  DH  LN ++        TAENIA+ I  RLS+ +    + L  VR
Sbjct: 154 SALQRLVDDLVVEPFDHTFLNKDVPFFAECVPTAENIALHIADRLSSPIKAIGAQLHKVR 213

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 214 LQESPNNAAE 223



 Score = 50.9 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 36/85 (42%), Gaps = 10/85 (11%)

Query: 42  VDPKTGFVDDFFNIEQYFS-PLLEKLDHHCLNEI-EELEN-------PTAENIAIWIWKR 92
                G V +   ++      +  +LD   LNE   E +        PT E +   IW R
Sbjct: 4   DLDADGMVLNLSEVKHAIRSEVTGQLDFRFLNEAWPEFDVSCPEGCLPTTEALVRTIWHR 63

Query: 93  LSTSLSILSSVRVYETPMSWVEYQG 117
           L   L  ++++R+YE P  W +Y G
Sbjct: 64  LRPHLP-ITALRLYEQPGLWADYLG 87


>gi|161615867|ref|YP_001589832.1| hypothetical protein SPAB_03659 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161365231|gb|ABX68999.1| hypothetical protein SPAB_03659 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|321225625|gb|EFX50679.1| Queuosine biosynthesis QueD, PTPS-I [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
          Length = 86

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 35/84 (41%), Positives = 55/84 (65%)

Query: 34  VELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEELENPTAENIAIWIWKRL 93
           V L + G+VDP TG++ DF +++  F P  ++LDH+ LN+I  L NPT+E +A WIW ++
Sbjct: 2   VRLEITGEVDPHTGWIMDFADLKAAFKPTYDRLDHYYLNDIPGLSNPTSEVLAKWIWDQV 61

Query: 94  STSLSILSSVRVYETPMSWVEYQG 117
              + +LS+V V ET  +   Y+G
Sbjct: 62  KPVVPLLSAVMVKETCTAGCVYRG 85


>gi|296315123|ref|ZP_06865064.1| queuosine biosynthesis protein QueD [Neisseria polysaccharea ATCC
           43768]
 gi|296838038|gb|EFH21976.1| queuosine biosynthesis protein QueD [Neisseria polysaccharea ATCC
           43768]
          Length = 140

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 40/141 (28%), Positives = 68/141 (48%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEG---DVDPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +         K G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSDGIIKGGAKDGMVMDFTDLKT 58

Query: 58  YF-SPLLEKLDHHCL--------NEIEEL------------ENPTAENIAIWIWKRLSTS 96
                + +  DH  +        ++I  L               TAEN+A+ ++ RL  +
Sbjct: 59  IVKQHITDPFDHAFIYHGGNGRESQIAALLEGWNMKTLLLPCRTTAENMAVEMYGRLKNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              +  V+++ETP S  EY+G
Sbjct: 119 GLNVCRVKLWETPTSCAEYEG 139


>gi|240080027|ref|ZP_04724570.1| putative 6-pyruvoyl-tetrahydropterin synthase [Neisseria
           gonorrhoeae FA19]
 gi|268596171|ref|ZP_06130338.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268549959|gb|EEZ44978.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
          Length = 140

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 41/141 (29%), Positives = 69/141 (48%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVME---GDVDPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +        PK G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSDGIVRGGPKDGMVMDFTDLKV 58

Query: 58  YF-SPLLEKLDHHCL--------NEIEEL------------ENPTAENIAIWIWKRLSTS 96
                + +  DH  +        ++I  L               TAEN+A+ ++ RL  +
Sbjct: 59  IVKQHITDPFDHAFIYHGGNGRESQIAALLEGWNMKTLRLPCRTTAENMAVEMYCRLKNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              +  V+++ETP S  EY+G
Sbjct: 119 GLNVCRVKLWETPTSCAEYEG 139


>gi|332710012|ref|ZP_08429967.1| queuosine biosynthesis protein QueD [Lyngbya majuscula 3L]
 gi|332351155|gb|EGJ30740.1| queuosine biosynthesis protein QueD [Lyngbya majuscula 3L]
          Length = 291

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 42/134 (31%), Positives = 66/134 (49%), Gaps = 20/134 (14%)

Query: 1   MKITQAF--TFEAAHRLPRVPKT--------HKCH--RMHGHSYRVELVMEGDVDPKTGF 48
           M++       F AAHRL     +         KC     HGH+Y +E+ ++G++DP+TG 
Sbjct: 134 MEVYLTISNHFSAAHRLAHPDLSDEENYQIYGKCARPNGHGHNYHIEVTVKGEMDPRTGM 193

Query: 49  VDDFFNIEQYFSPLL-EKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI----L 100
           + D  +++Q     + E  DH  LN +I       PTAENIAI+I + L   +      L
Sbjct: 194 IVDLGSLQQVMDEYVLEAFDHTFLNKDIPYFARVVPTAENIAIYICQLLQQPIQELDVQL 253

Query: 101 SSVRVYETPMSWVE 114
             V++ E+P +  E
Sbjct: 254 HKVKLSESPNNSCE 267



 Score = 86.0 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 38/130 (29%), Positives = 63/130 (48%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRM-----------HGHSYRVELVMEGDVDPKTGFVDD 51
           I +   F A+HR   +P+  +   +           HGH+Y + + +      K G V +
Sbjct: 5   IKRRAEFSASHRYW-LPELSEAENLQRFGLGSRFPGHGHNYVLFVSLTAQ-LDKYGMVKN 62

Query: 52  FFNIEQYFS-PLLEKLDHHCLNEIE-ELEN--PTAENIAIWIWKRLSTSLSILSSVRVYE 107
              ++      +  +LD+  LNE+  E +   PT ENIA  IW+RL T L +L  ++++E
Sbjct: 63  LSKVKTVIQREVTSQLDYAYLNEVWSEFQQTLPTTENIARVIWQRLVTYLPLL-KIQLFE 121

Query: 108 TPMSWVEYQG 117
            P  W +YQG
Sbjct: 122 HPKLWADYQG 131


>gi|298492270|ref|YP_003722447.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           ['Nostoc azollae' 0708]
 gi|298234188|gb|ADI65324.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           ['Nostoc azollae' 0708]
          Length = 421

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 42/129 (32%), Positives = 65/129 (50%), Gaps = 17/129 (13%)

Query: 3   ITQAFTFEAAHRLPRV--------PKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T    F +AHRL               KC R+  HGH+Y++E+ ++G++D  TG V D 
Sbjct: 270 LTVKSEFSSAHRLAHPGLSLEKNTEIYGKCARVNGHGHNYQLEVTVKGEIDSSTGMVVDL 329

Query: 53  FNIEQYFSPLLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSL----SILSSVRV 105
             + Q  + L E LDH  LN ++       PTAENIA++I   L   +    + L  V++
Sbjct: 330 GALNQVIANLTEPLDHSFLNRDVPYFGEVVPTAENIALYISNMLRLPIQELGAELYKVKL 389

Query: 106 YETPMSWVE 114
            E+P +  E
Sbjct: 390 VESPNNSCE 398



 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 42/121 (34%), Positives = 69/121 (57%), Gaps = 11/121 (9%)

Query: 8   TFEAAHRLPR---VPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYF-SPLL 63
            F AAHRL       K  KC R HGH+Y +E+ +EG++D +TG + D   + +   + ++
Sbjct: 143 HFSAAHRLASNLSSEKYSKCSRTHGHNYHLEVTVEGEMDSRTGMIIDLDALNRVVENDVV 202

Query: 64  EKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSL----SILSSVRVYETPMSWVEYQ 116
           +  DH C+N +I       PT EN+ ++I   L + +    + LS V+++E+P  WV+YQ
Sbjct: 203 KIFDHFCVNKDIPHFSEIVPTTENLVLYISNLLKSPIQKLGAKLSQVKLFESPQLWVDYQ 262

Query: 117 G 117
           G
Sbjct: 263 G 263



 Score = 77.9 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 32/130 (24%), Positives = 59/130 (45%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRM-----------HGHSYRVELVMEGDVDPKTGFVDD 51
           + +   F A+H    +P+  +   +            GH+Y + + + G+   K G V +
Sbjct: 5   VNRRAQFLASHH-YSLPELGETENLEKFGRSSKFPGQGHNYTLFISIAGE-LDKYGMVLN 62

Query: 52  FFNIEQYF-SPLLEKLDHHCLNEI-EELENP--TAENIAIWIWKRLSTSLSILSSVRVYE 107
             +++Q     + ++LD   LN +  E +    + ENIA  IW+RL+  L  L  V++ E
Sbjct: 63  LSDVKQVIKREITDQLDFSYLNNVWPEFQQTLSSNENIARVIWQRLAPHLP-LIRVQLVE 121

Query: 108 TPMSWVEYQG 117
               W +Y G
Sbjct: 122 HTGLWADYMG 131


>gi|288931806|ref|YP_003435866.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Ferroglobus placidus DSM 10642]
 gi|288894054|gb|ADC65591.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Ferroglobus placidus DSM 10642]
          Length = 112

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 43/116 (37%), Positives = 72/116 (62%), Gaps = 6/116 (5%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M+I  +  F AAH +P   +  KC ++HGH+++VE+ +EG+V  + G V DF ++++   
Sbjct: 1   MRIGVSEVFSAAHYIP---EHWKCGKIHGHNFKVEVEIEGEV-KENGMVMDFLDLKKELK 56

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            +L++ DH  +NEI E+  PT+ENI + I++RL      +  VRVYE+   W E +
Sbjct: 57  EVLKEFDHRIINEIIEI--PTSENICLEIFRRLKDRGLSVVRVRVYESEDKWAEIR 110


>gi|159029670|emb|CAO87748.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 288

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 41/130 (31%), Positives = 66/130 (50%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL               KC R+  HGH+Y +E+ + G++DP+TG + D 
Sbjct: 138 LTVKTHFSAAHRLALPQLTLEQNSEIYGKCARVNGHGHNYHLEVSVAGEIDPRTGMIVDL 197

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSL----SILSSVR 104
            ++++     ++E  DH  LN +I       PTAENIA+ I + L   +    + L  V+
Sbjct: 198 GDLQKAIDELVVEPFDHAFLNKDIPYFAEVVPTAENIALHIAQLLEEPIRQLGAELDKVK 257

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 258 LIESPNNSAE 267



 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 36/129 (27%), Positives = 61/129 (47%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHR----------MHGHSYRVELVMEGDVDPKTGFVDDF 52
           I +   F A+HR          ++           HGH+Y + + +  +     G V++ 
Sbjct: 5   INRRARFSASHRYYLPEWDEAENQRLFGLGSRFPGHGHNYELYVSLYKE-LNLYGMVENL 63

Query: 53  FNIEQYF-SPLLEKLDHHCLNEI-EELEN--PTAENIAIWIWKRLSTSLSILSSVRVYET 108
             ++Q     +  +LD+  LN++  E +   PT ENIA  IW+RL+  L  L  ++++E 
Sbjct: 64  STVKQVIKREITSQLDYSYLNQVWPEFQQTLPTTENIARVIWQRLAPYLP-LVKIQLFEH 122

Query: 109 PMSWVEYQG 117
           P  W EYQG
Sbjct: 123 PELWAEYQG 131


>gi|34498963|ref|NP_903178.1| 6-pyruvoyltetrahydrobiopterin synthase [Chromobacterium violaceum
           ATCC 12472]
 gi|34104812|gb|AAQ61169.1| probable 6-pyruvoyltetrahydrobiopterin synthase [Chromobacterium
           violaceum ATCC 12472]
          Length = 239

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 66/110 (60%), Gaps = 7/110 (6%)

Query: 8   TFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLD 67
           +FEAAH LP VP  HKC R+HGH + V +V +     +         + + ++PL  +L+
Sbjct: 15  SFEAAHHLPHVPPGHKCGRLHGHGFGVRIVADAAQCGQ-------RELARAWAPLHRRLN 67

Query: 68  HHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           HH LN+I  L+NPT+E +A W+ ++LS ++  L+ V V ET  +  ++ G
Sbjct: 68  HHYLNDIAGLDNPTSEVLAQWLHQQLSDAVPGLAWVEVRETHSAGSQFDG 117



 Score = 80.6 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 56/114 (49%), Gaps = 6/114 (5%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +I +   FE+A                GHSY V L++ G +D   G++ DF +++  F 
Sbjct: 120 FRIWKEQRFESA------IPFDADGNYTGHSYLVRLMLSGGIDRTMGWLLDFGDVKDRFK 173

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVE 114
           P+  +LDH+ L+++  +    +  +A WI  +LS  +  LS + + E+  + V 
Sbjct: 174 PIYRQLDHNPLDKLAGVRGADSAAVAEWIHAQLSPLVPELSRIDLMESDDAGVS 227


>gi|239817065|ref|YP_002945975.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Variovorax paradoxus S110]
 gi|239803642|gb|ACS20709.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Variovorax paradoxus S110]
          Length = 120

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 58/106 (54%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             I+Q F F+AAH L R  +     R+HGH+Y  E+ + G  DP TG V D   + +   
Sbjct: 3   FTISQRFFFDAAHTLKREIEAEGSRRIHGHTYHAEVWLAGQRDPVTGMVVDLGVLRRRLG 62

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVY 106
            + E+LDHH L+++  L  PT EN+ ++I   L      L+ VRV+
Sbjct: 63  DVREQLDHHLLDDVAGLHPPTLENLCLFIADALPEFRPSLARVRVW 108


>gi|310640609|ref|YP_003945367.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Paenibacillus
           polymyxa SC2]
 gi|309245559|gb|ADO55126.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Paenibacillus
           polymyxa SC2]
          Length = 163

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 42/126 (33%), Positives = 67/126 (53%), Gaps = 15/126 (11%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y V   + G    +TG   DF +I+  +   
Sbjct: 34  VSKQFTFDAAHHLHCYE--GKCKNLHGHTYIVVFGISGIP-GETGLTLDFGDIKTIWKER 90

Query: 63  LEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSL-----------SILSSVRVYETPM 110
           +E  LDH  LNE     N TAEN+ +WI++++ ++L                VR++ETP 
Sbjct: 91  IEPFLDHRYLNETLPPMNTTAENMVVWIFEQMESALTSDAYCNRVEGGRTEFVRLFETPT 150

Query: 111 SWVEYQ 116
           S+ E++
Sbjct: 151 SYAEFR 156


>gi|298243715|ref|ZP_06967522.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Ktedonobacter racemifer DSM 44963]
 gi|297556769|gb|EFH90633.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Ktedonobacter racemifer DSM 44963]
          Length = 136

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 39/130 (30%), Positives = 69/130 (53%), Gaps = 15/130 (11%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T+  TF AAHRL               KC   HGH  +Y +E+ + G+ +P TG V + 
Sbjct: 4   LTRRVTFSAAHRLWSEYLSEDENYNVYDKCANPHGHGHNYILEVTVRGEPEPTTGMVLNL 63

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS-ILSSVRVYE 107
            ++++  +  +++ +DH  LN ++  LE   PTAE + I  W+RL+ +    L  + ++E
Sbjct: 64  TDMKRIINELVVDGVDHKHLNYDVAWLEGVIPTAEMLVIKFWERLAPAFEGRLYEITLHE 123

Query: 108 TPMSWVEYQG 117
           T  ++  Y+G
Sbjct: 124 TENNYASYRG 133


>gi|83858526|ref|ZP_00952048.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Oceanicaulis
           alexandrii HTCC2633]
 gi|83853349|gb|EAP91201.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Oceanicaulis
           alexandrii HTCC2633]
          Length = 132

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 64/105 (60%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I++ FTF+AAH        H   RMHGHS+   + + G    ++G V DF+ IE   + 
Sbjct: 15  EISKDFTFDAAHHFEHKDANHPFSRMHGHSFAGTVTLTGSRAAESGMVKDFWEIEAEINK 74

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVY 106
           + E+LDH  LN++E LE+P+ E IA W+++RL  +L  L++V + 
Sbjct: 75  IREQLDHRLLNDVEGLEHPSLEAIAYWVFERLEKTLPGLTAVEIR 119


>gi|308067860|ref|YP_003869465.1| 6-pyruvoyl-tetrahydropterin synthase [Paenibacillus polymyxa E681]
 gi|305857139|gb|ADM68927.1| 6-pyruvoyl-tetrahydropterin synthase [Paenibacillus polymyxa E681]
          Length = 163

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 42/126 (33%), Positives = 67/126 (53%), Gaps = 15/126 (11%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y V   + G    +TG   DF +I+  +   
Sbjct: 34  VSKQFTFDAAHHLHCYE--GKCKNLHGHTYVVVFGISGIP-GETGLTLDFGDIKTIWKER 90

Query: 63  LEK-LDHHCLNEIEELENPTAENIAIWIWKRLSTSL-----------SILSSVRVYETPM 110
           +E  LDH  LNE     N TAEN+ +WI++++ ++L                VR++ETP 
Sbjct: 91  IEPFLDHRYLNETLPPMNTTAENMVVWIFEQMESALTSDAYCNRVEGGRTEFVRLFETPT 150

Query: 111 SWVEYQ 116
           S+ E++
Sbjct: 151 SYAEFR 156


>gi|307294878|ref|ZP_07574720.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Sphingobium chlorophenolicum L-1]
 gi|306879352|gb|EFN10570.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Sphingobium chlorophenolicum L-1]
          Length = 122

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 60/105 (57%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++T+ F FE+AH L R  +T    R+HGHSYR ++ + G  +P TG + D    EQ  + 
Sbjct: 3   ELTKTFWFESAHTLHRSVETESSLRIHGHSYRAQVTVSGTPNPDTGMLIDLTLFEQSLAV 62

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVY 106
               LDH  L+++  L  PT EN+  WIW+ LS ++  L  V V+
Sbjct: 63  ARSALDHRMLDDVSGLGPPTLENLCAWIWRALSDNVPGLYRVEVF 107


>gi|253576604|ref|ZP_04853932.1| queuosine biosynthesis protein QueD [Paenibacillus sp. oral taxon
           786 str. D14]
 gi|251844018|gb|EES72038.1| queuosine biosynthesis protein QueD [Paenibacillus sp. oral taxon
           786 str. D14]
          Length = 164

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 41/124 (33%), Positives = 68/124 (54%), Gaps = 15/124 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQ-YFSP 61
           +++ FTF+AAH L       KC  +HGH+Y+V   + G  D + G   DF  I++ + + 
Sbjct: 35  VSKEFTFDAAHHLHAYD--GKCKNLHGHTYKVVFGISGRPD-EIGMTVDFGTIKEIWKNE 91

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSL-------SILSS----VRVYETPM 110
           +   LDH  +NE     N TAEN+ +W+++++  +L        +L +    VR+YETP 
Sbjct: 92  IEAYLDHRYINETLPPMNTTAENMVVWLFEKMEEALQSEAYRNPVLEARTEFVRLYETPT 151

Query: 111 SWVE 114
           S+ E
Sbjct: 152 SYAE 155


>gi|332297396|ref|YP_004439318.1| queuosine biosynthesis protein QueD [Treponema brennaborense DSM
           12168]
 gi|332180499|gb|AEE16187.1| queuosine biosynthesis protein QueD [Treponema brennaborense DSM
           12168]
          Length = 132

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 39/129 (30%), Positives = 65/129 (50%), Gaps = 17/129 (13%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++     F AAH L       KC R+HGH+Y+V   + G    + G + DF  +++    
Sbjct: 3   EVRIEADFAAAHFLKEY--HGKCERLHGHNYKVFAHVRGSRLDEGGMLLDFSELKRVVRS 60

Query: 62  LLEKLDHHCLNE-----IEELE-NPTAENIAIWIWKRLSTSLS---------ILSSVRVY 106
           +  +LDH  LN+     ++  + NP+AE+IA WI++R+ + L+          L +V V+
Sbjct: 61  VCAELDHTNLNDMQCDGVDVFDQNPSAEHIAQWIFRRIQSQLAGNAGMQSGTALYAVDVF 120

Query: 107 ETPMSWVEY 115
           ET  S   Y
Sbjct: 121 ETDTSRARY 129


>gi|322514965|ref|ZP_08067978.1| queuosine biosynthesis protein QueD [Actinobacillus ureae ATCC
           25976]
 gi|322119073|gb|EFX91233.1| queuosine biosynthesis protein QueD [Actinobacillus ureae ATCC
           25976]
          Length = 152

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 34/139 (24%), Positives = 67/139 (48%), Gaps = 26/139 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPK---TGFVDDFFNIEQ 57
            KI + F+F+ AH L       KC  +HGH+Y++++ + GD+  +    G V D+ +++ 
Sbjct: 14  FKIAKEFSFDMAHMLDG--HDGKCQNLHGHTYKLQVEVSGDLVAEGAKRGMVMDYSDLKS 71

Query: 58  YF-SPLLEKLDHHCLNEIEELE--------------------NPTAENIAIWIWKRLSTS 96
                +L+ +DH  + ++                          TAE +A +++++L   
Sbjct: 72  VVKREILDPMDHAYIYDLNSNRESQVAKLLIDLNSKVYGIPSRTTAEEMAKYMFEKLEKV 131

Query: 97  LSILSSVRVYETPMSWVEY 115
              +S +R++ETP S+ EY
Sbjct: 132 GLPVSLIRLWETPTSYCEY 150


>gi|262340966|ref|YP_003283821.1| 6-pyruvoyltetrahydropterin synthase [Blattabacterium sp. (Blattella
           germanica) str. Bge]
 gi|262272303|gb|ACY40211.1| 6-pyruvoyltetrahydropterin synthase [Blattabacterium sp. (Blattella
           germanica) str. Bge]
          Length = 134

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 40/129 (31%), Positives = 68/129 (52%), Gaps = 14/129 (10%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFN 54
           I++   F AAHRL               KC   HGH+Y   + + G++D +TGFV +   
Sbjct: 5   ISRRGHFSAAHRLYNNHWNYQKNIEVFGKCAYYHGHNYEYIVSVTGEIDVETGFVLNLQK 64

Query: 55  IEQYFSPLLEK-LDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLS--ILSSVRVYET 108
           +       +EK  DH  +N +++E    NPT EN+ +++WK+++  +S  +   + +YET
Sbjct: 65  LRDILREEIEKFFDHKNINLDLKEFSSVNPTVENLVVFMWKKINKRISSNLDLKITLYET 124

Query: 109 PMSWVEYQG 117
             ++VEY G
Sbjct: 125 ENNFVEYDG 133


>gi|15676434|ref|NP_273572.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Neisseria
           meningitidis MC58]
 gi|254804411|ref|YP_003082632.1| 6-pyruvoyl-tetrahydropterin synthase [Neisseria meningitidis
           alpha14]
 gi|7225752|gb|AAF40957.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Neisseria
           meningitidis MC58]
 gi|254667953|emb|CBA04197.1| 6-pyruvoyl-tetrahydropterin synthase [Neisseria meningitidis
           alpha14]
 gi|316985380|gb|EFV64328.1| queuosine biosynthesis protein QueD [Neisseria meningitidis H44/76]
 gi|325139738|gb|EGC62272.1| queuosine biosynthesis protein QueD [Neisseria meningitidis CU385]
 gi|325200785|gb|ADY96240.1| queuosine biosynthesis protein QueD [Neisseria meningitidis H44/76]
          Length = 140

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 39/141 (27%), Positives = 67/141 (47%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEG---DVDPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +         K G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSDGIIKGGAKDGMVMDFTDLKA 58

Query: 58  YF-SPLLEKLDHHCL-----------------NEIEELE---NPTAENIAIWIWKRLSTS 96
                + +  DH  +                   ++ L      TAEN+A+ ++ RL  +
Sbjct: 59  IVKQHITDPFDHAFIYHGGNSRECQIAALLEGWNMKTLRLPCRTTAENMAVEMYGRLKNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              +  V+++ETP S  EY+G
Sbjct: 119 GLNVCRVKLWETPTSCAEYEG 139


>gi|312130466|ref|YP_003997806.1| hypothetical protein Lbys_1746 [Leadbetterella byssophila DSM
           17132]
 gi|311907012|gb|ADQ17453.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Leadbetterella byssophila DSM 17132]
          Length = 136

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 42/134 (31%), Positives = 64/134 (47%), Gaps = 17/134 (12%)

Query: 1   MKITQAFTFEAAHRLPRVPK--------THKCHRMHGHSYRVELVMEGDVDPKTGFVDDF 52
           ++IT+  TF AAHRL                C ++HGH++ + + + G+V   TGFV D 
Sbjct: 2   IQITRRETFNAAHRLFNPKWSEEKNYEVFGPCSKVHGHNWELFVTVIGEVAEDTGFVVDL 61

Query: 53  FNIEQYFSPL-LEKLDHHCLNEIEEL---ENPTAENIAIWIWKRLSTSLSI-----LSSV 103
             + +      + K+DH  LNE       + PT EN AI IW  L  ++       L  +
Sbjct: 62  KALSRTMREEVISKVDHTYLNEDVAFLAGKLPTTENFAIAIWDILKPAIKQKHGVDLYKI 121

Query: 104 RVYETPMSWVEYQG 117
           ++ ET   +VEY G
Sbjct: 122 KLTETANHYVEYFG 135


>gi|77919242|ref|YP_357057.1| 6-pyruvoyl-tetrahydropterin synthase [Pelobacter carbinolicus DSM
           2380]
 gi|77545325|gb|ABA88887.1| preQ(0) biosynthesis protein QueD [Pelobacter carbinolicus DSM
           2380]
          Length = 122

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 32/113 (28%), Positives = 60/113 (53%), Gaps = 7/113 (6%)

Query: 8   TFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLD 67
            F AAH L        C  +HGH+++VE+ +      K G   DF  +++  + +L+ LD
Sbjct: 9   HFAAAHNLMNYQGD--CENLHGHNWKVEVTVATRELDKAGLGVDFKILKKETNRILDLLD 66

Query: 68  HHCLNEIEELE--NPTAENIAIWIWKRLSTSLSI---LSSVRVYETPMSWVEY 115
           H  LN++   +  +P++ENIA ++++ LS        + +VR++E+  +   Y
Sbjct: 67  HKYLNDLPFFKGISPSSENIARFVFEELSKVFQESVVVENVRIWESDNACASY 119


>gi|313148843|ref|ZP_07811036.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides fragilis 3_1_12]
 gi|313137610|gb|EFR54970.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides fragilis 3_1_12]
          Length = 110

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 57/116 (49%), Gaps = 9/116 (7%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             + +     AAH+L  +P   KC  +HGH++ + +    +     G V DF  I+Q   
Sbjct: 2   FTVIKRMEISAAHKLI-LPYRSKCATLHGHNWIITVYCRSERLNSDGMVVDFTQIKQTVK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
              EKLDH  LNE+    NPTAENIA W+ K++         V V E+  + V Y+
Sbjct: 61  ---EKLDHQNLNEVLPF-NPTAENIARWVCKQI----PQCYKVEVQESEANTVIYE 108


>gi|303253330|ref|ZP_07339479.1| hypothetical protein APP2_0641 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|302648012|gb|EFL78219.1| hypothetical protein APP2_0641 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
          Length = 157

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 33/139 (23%), Positives = 67/139 (48%), Gaps = 26/139 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPK---TGFVDDFFNIEQ 57
            KI + F+F+ AH L       KC  +HGH+Y++++ + GD+  +      V D+ +++ 
Sbjct: 19  FKIAKEFSFDMAHMLDG--HDGKCQNLHGHTYKLQVEVSGDLVAEGAKRSMVMDYADLKS 76

Query: 58  YF-SPLLEKLDHHCLNEIEE--------------------LENPTAENIAIWIWKRLSTS 96
                +L+ +DH  + ++                          TAE +A +++++L  +
Sbjct: 77  VVKREILDPMDHAYIYDLNSERESQVAKLLVDLNSKVYGIPSRTTAEEMAKYMFEKLEKA 136

Query: 97  LSILSSVRVYETPMSWVEY 115
              +S +R++ETP S+ EY
Sbjct: 137 GLPVSLIRLWETPTSYCEY 155


>gi|302039310|ref|YP_003799632.1| putative 6-pyruvoyl-tetrahydropterin synthase [Candidatus
           Nitrospira defluvii]
 gi|300607374|emb|CBK43707.1| putative 6-pyruvoyl-tetrahydropterin synthase (modular protein)
           [Candidatus Nitrospira defluvii]
          Length = 250

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 62/127 (48%), Gaps = 15/127 (11%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHR--MHGHSYRVELVMEGDVDPKTGFVDDF 52
           + +   F A+HR  +              C+    HGH+Y +E+ + G+VD +TG V + 
Sbjct: 6   LNKRIEFCASHRYHKPEWDAAKNRAMFGACNNDPGHGHNYMLEVTVAGEVDQRTGMVVNL 65

Query: 53  FNIEQYFSPLLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRL--STSLSILSSVRVYE 107
           F++++    +LE+ DH  LN ++   E   PT+ENIA  +W +L     +  L  + +YE
Sbjct: 66  FDLKRVLLQVLEEFDHKHLNLDLPYFERQIPTSENIARVLWDKLQAQPDIGTLKRLSLYE 125

Query: 108 TPMSWVE 114
                 +
Sbjct: 126 DEDLCAD 132



 Score = 49.8 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 25/118 (21%), Positives = 52/118 (44%), Gaps = 14/118 (11%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +T+ ++F A H        H+     GH++ + + + G +D  TG V D   ++      
Sbjct: 144 VTRRYSFTAVH------DGHR-----GHTWDLFVSVHGPIDRGTGMVTDIVALDHLLKER 192

Query: 63  L-EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI--LSSVRVYETPMSWVEYQG 117
           +    +   L  +    + T E +A  +W R+ +++    L  V++ +T   + EY G
Sbjct: 193 VLVPFEGRDLRMVLATPSVTGEYLAKAVWDRIVSAIPAGTLQLVKLVQTRDLFYEYAG 250


>gi|53714881|ref|YP_100873.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides fragilis YCH46]
 gi|60682862|ref|YP_213006.1| putative 6-pyruvoyl tetrahydropterin synthase [Bacteroides fragilis
           NCTC 9343]
 gi|253565985|ref|ZP_04843439.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. 3_2_5]
 gi|265766737|ref|ZP_06094566.1| queuosine biosynthesis protein QueD [Bacteroides sp. 2_1_16]
 gi|52217746|dbj|BAD50339.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides fragilis YCH46]
 gi|60494296|emb|CAH09091.1| putative 6-pyruvoyl tetrahydropterin synthase [Bacteroides fragilis
           NCTC 9343]
 gi|251945089|gb|EES85527.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. 3_2_5]
 gi|263253114|gb|EEZ24590.1| queuosine biosynthesis protein QueD [Bacteroides sp. 2_1_16]
          Length = 110

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 57/116 (49%), Gaps = 9/116 (7%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             + +     AAH+L  +P   KC  +HGH++ + +    +     G V DF  I+Q   
Sbjct: 2   FTVIKRMEISAAHKLI-LPYRSKCASLHGHNWIITVYCRSERLNADGMVVDFTQIKQAVK 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
              EKLDH  LNE+    NPTAENIA W+ K++         V V E+  + V Y+
Sbjct: 61  ---EKLDHRNLNEVLPF-NPTAENIARWVCKQI----PQCYKVEVQESEANTVIYE 108


>gi|220904753|ref|YP_002480065.1| queuosine biosynthesis protein QueD [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
 gi|219869052|gb|ACL49387.1| queuosine biosynthesis protein QueD [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
          Length = 135

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 42/127 (33%), Positives = 62/127 (48%), Gaps = 15/127 (11%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVD-PKTGFVDDFFNIEQYFS 60
           ++T    F A H L       KC RMHGH++ VEL +EG+   P+T  + DF  +++   
Sbjct: 7   RLTVRDDFSAGHALRHYE--GKCERMHGHNFAVELTVEGNRLAPQTEMLLDFKILKKALK 64

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLSI----------LSSVRVYET 108
            +L+ LDH  LNE    +  NP++EN+A  IW+ +   L+           L SV V E 
Sbjct: 65  AVLDALDHRLLNETPPFDRINPSSENLARHIWQGMEALLAEHEDPQARLVRLHSVTVSEK 124

Query: 109 PMSWVEY 115
                 Y
Sbjct: 125 GAQSATY 131


>gi|170587254|ref|XP_001898393.1| 6-pyruvoyl tetrahydropterin synthase [Brugia malayi]
 gi|158594219|gb|EDP32805.1| 6-pyruvoyl tetrahydropterin synthase, putative [Brugia malayi]
          Length = 136

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 37/132 (28%), Positives = 70/132 (53%), Gaps = 16/132 (12%)

Query: 2   KITQAFTFEAAHRL--------PRVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDD 51
           ++T+  TF A+HRL               KC+ +  HGH+Y  E+ + G +DPK+G V +
Sbjct: 5   ELTRRETFSASHRLQNSLLSDIENQQLYGKCNNLNGHGHNYVWEVTLRGQIDPKSGMVYN 64

Query: 52  FFNIEQYFSPLLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSL---SILSSVRV 105
             N++     +L+++DH  L+ ++   E+   T EN+ +++W  L + +    +L  + +
Sbjct: 65  LTNLKNEMKSVLDEVDHKNLDKDVVYFESNVSTTENLIVYLWNELKSRITNPELLYKMIL 124

Query: 106 YETPMSWVEYQG 117
           +ET  + V Y G
Sbjct: 125 HETEKNSVAYHG 136


>gi|323700167|ref|ZP_08112079.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfovibrio sp. ND132]
 gi|323460099|gb|EGB15964.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfovibrio desulfuricans ND132]
          Length = 126

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 45/120 (37%), Positives = 70/120 (58%), Gaps = 8/120 (6%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDV-DPKTGFVDDFFNIEQYFS 60
           K+T    F A+H+L       KC  MHGH++ VE+V+EGD  DPK  ++ DF  +++   
Sbjct: 6   KLTITQEFSASHQLRNYC--GKCENMHGHNFGVEVVVEGDTLDPKVQYLVDFKELKRLTR 63

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLSI---LSSVRVYETPMSWVEY 115
            +L+KLDH  LNE+E     NP++EN+A++I++ L +++     L  V V E   S   Y
Sbjct: 64  TVLDKLDHKHLNEVECFTEINPSSENLAMFIYRNLKSNMPENVSLVEVSVSEKNTSKATY 123


>gi|16078437|ref|NP_389256.1| 6-pyruvoyl tetrahydrobiopterin synthase-like; queuosine
           biosynthesis [Bacillus subtilis subsp. subtilis str.
           168]
 gi|2633744|emb|CAB13246.1| 6-pyruvoyl tetrahydrobiopterin synthase-like; queuosine
           biosynthesis [Bacillus subtilis subsp. subtilis str.
           168]
          Length = 149

 Score = 99.9 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 35/128 (27%), Positives = 56/128 (43%), Gaps = 16/128 (12%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ +     AAH +PR      C R+HGH+Y V + + GD    +GF+ +F  +++   
Sbjct: 18  FELNKDMHISAAHFIPR-ESAGACSRVHGHTYTVNITVAGDELDDSGFLVNFSVLKKLVH 76

Query: 61  PLLEKLDHHCLNEIEELEN------PTAENIAIWIWKRLSTSL------SILSSVRVYET 108
                 DH  LN+ E+         PT E +A  I+  +   L           V V ET
Sbjct: 77  ---GNYDHTLLNDHEDFSQDDRYSLPTTEVVAKTIYDNVQAYLDTLENKPTCVQVFVRET 133

Query: 109 PMSWVEYQ 116
           P S+  Y+
Sbjct: 134 PTSYCVYR 141


>gi|265991998|ref|ZP_06104555.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella melitensis bv. 1
           str. Rev.1]
 gi|263003064|gb|EEZ15357.1| 6-pyruvoyl tetrahydrobiopterin synthase [Brucella melitensis bv. 1
           str. Rev.1]
          Length = 103

 Score = 99.9 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 33/99 (33%), Positives = 51/99 (51%)

Query: 18  VPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEEL 77
           +P  H+C R+HGH+Y VE+ +        GFV D+  +      + +  DH  LN++   
Sbjct: 1   MPADHQCARLHGHNYIVEVELSAPDLDTHGFVRDYHELAALKHYIDDTFDHRHLNDVLGH 60

Query: 78  ENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
           E  TAE +A   +         +S+VRV ETP +W EY+
Sbjct: 61  EQTTAERLAKHFFDWCHARWPEISAVRVSETPKTWAEYR 99


>gi|16127388|ref|NP_421952.1| 6-pyruvoyl tetrahydrobiopterin synthase [Caulobacter crescentus
           CB15]
 gi|221236196|ref|YP_002518633.1| queuosine biosynthesis protein queD [Caulobacter crescentus NA1000]
 gi|13424826|gb|AAK25120.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Caulobacter
           crescentus CB15]
 gi|220965369|gb|ACL96725.1| queuosine biosynthesis protein queD [Caulobacter crescentus NA1000]
          Length = 121

 Score = 99.9 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 37/114 (32%), Positives = 62/114 (54%), Gaps = 6/114 (5%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT+A  F+AAH + + P  H+  R+HGHS++VE+ + G++    G+V D   ++    
Sbjct: 5   FEITKAAYFDAAHYIEQGPSDHRYRRLHGHSFKVEVSVRGEMLDA-GWVADLDTLDVALK 63

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVY-----ETP 109
            +  +LDH  LN+   LE PT E + ++  +RL +    LS V +      ET 
Sbjct: 64  AVAVELDHGLLNDKPGLEVPTLERLCLYFAERLRSQFPGLSRVALSRPTIGETC 117


>gi|332975984|gb|EGK12856.1| 6-pyruvoyltetrahydropterin synthase [Desmospora sp. 8437]
          Length = 161

 Score = 99.9 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 45/122 (36%), Positives = 65/122 (53%), Gaps = 13/122 (10%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +T+ FTF+AAH L       KC  +HGH+YR+ + + G VD + G   DF  I++ +   
Sbjct: 30  VTREFTFDAAHHLHLYE--GKCKNLHGHTYRLVITVSGFVD-EVGIAVDFGEIKRMYKEE 86

Query: 63  LE-KLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS---------ILSSVRVYETPMSW 112
           +E +LDH  LNE+    N +AENI +WIW+ L   L           L  + +YETP S 
Sbjct: 87  VEARLDHRYLNEVLPNMNTSAENIIVWIWEVLDDRLERDGWKKRGHRLEELVLYETPTSR 146

Query: 113 VE 114
             
Sbjct: 147 AT 148


>gi|125975584|ref|YP_001039494.1| putative 6-pyruvoyl tetrahydropterin synthase [Clostridium
           thermocellum ATCC 27405]
 gi|256005911|ref|ZP_05430856.1| 6-pyruvoyl tetrahydropterin synthase [Clostridium thermocellum DSM
           2360]
 gi|281416596|ref|ZP_06247616.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Clostridium thermocellum JW20]
 gi|125715809|gb|ABN54301.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Clostridium thermocellum ATCC 27405]
 gi|255990115|gb|EEU00252.1| 6-pyruvoyl tetrahydropterin synthase [Clostridium thermocellum DSM
           2360]
 gi|281407998|gb|EFB38256.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Clostridium thermocellum JW20]
 gi|316939703|gb|ADU73737.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Clostridium thermocellum DSM 1313]
          Length = 127

 Score = 99.9 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 42/115 (36%), Positives = 71/115 (61%), Gaps = 9/115 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYF-SP 61
           IT+ FTF++AH L  +    KC  +HGH+Y++E+ ++G  D + G V DF ++E    + 
Sbjct: 8   ITKLFTFDSAHHL--IDYNGKCRNIHGHTYKLEITLKGLPD-ENGLVMDFHDLEAIIENE 64

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSW 112
           +LEK+DH  LN++ +  NPT E I +W+W+ +S  +      L  + ++ETP S+
Sbjct: 65  VLEKVDHKYLNDVFDF-NPTCEMIGLWLWEEISKQVQNTRCTLEKLVLWETPTSY 118


>gi|189485682|ref|YP_001956623.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [uncultured
           Termite group 1 bacterium phylotype Rs-D17]
 gi|170287641|dbj|BAG14162.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [uncultured
           Termite group 1 bacterium phylotype Rs-D17]
          Length = 122

 Score = 99.9 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/118 (30%), Positives = 60/118 (50%), Gaps = 7/118 (5%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           K++   +F +AH L       +C  +HGH++++     G     TG + DF +I+ + + 
Sbjct: 4   KLSVTRSFSSAHCLREYK--GRCENLHGHNWKIRAAFYGTELDDTGVLIDFMDIKMHLNK 61

Query: 62  LLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLST---SLSILSSVRVYETPMSWVE 114
           ++  LDH  LNEI   +  NPTAENIA +I  RL       + +  V ++E+  S   
Sbjct: 62  VINYLDHKFLNEIVPFDRVNPTAENIAAFILGRLKDIETKNAKVCEVEIWESESSSAV 119


>gi|297621096|ref|YP_003709233.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Waddlia
           chondrophila WSU 86-1044]
 gi|297376398|gb|ADI38228.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Waddlia
           chondrophila WSU 86-1044]
          Length = 176

 Score = 99.9 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/120 (34%), Positives = 60/120 (50%), Gaps = 7/120 (5%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEG----DVDPKTGFVDDFFNIE 56
             I + F FEA H+L        C   HGHSY +E+ ++     D  PK   V DF +I 
Sbjct: 54  FTIIKTFRFEAGHQLAH--HDGACKHPHGHSYVLEIQVKSGTLIDDGPKKNMVIDFHHIS 111

Query: 57  QYFSPLLEKL-DHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEY 115
               P++    DH  LN+  E ++PT+E IA WI++ L   +  L ++ + ET  S V Y
Sbjct: 112 DIVKPMINTYFDHKWLNDTLETDSPTSEFIARWIYRHLDRQIPGLHAIGLSETATSKVIY 171


>gi|282901195|ref|ZP_06309124.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Cylindrospermopsis raciborskii CS-505]
 gi|281193895|gb|EFA68863.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Cylindrospermopsis raciborskii CS-505]
          Length = 420

 Score = 99.9 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 46/128 (35%), Positives = 68/128 (53%), Gaps = 13/128 (10%)

Query: 3   ITQAFTFEAAHRLP---RVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYF 59
           +T    F AAHRL       K  KC R HGH+Y +E+ +EG++D +TG + D   + +  
Sbjct: 136 LTVRSHFSAAHRLAPNLSAEKYGKCTRTHGHNYHLEVTVEGEMDGRTGMIVDLGRLHEIV 195

Query: 60  -SPLLEKLDHHCLN-EIEELEN----PTAENIAIWIWKRLSTSLS----ILSSVRVYETP 109
              +LE  DH C+N +I         PT ENIA ++   L   +S     LS V+++E+ 
Sbjct: 196 EREILELFDHSCINEDIPYFSTSHIVPTTENIARYMSDLLQFPISQLGVKLSRVKLFESD 255

Query: 110 MSWVEYQG 117
             WVEY+G
Sbjct: 256 HLWVEYEG 263



 Score = 87.9 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 41/129 (31%), Positives = 61/129 (47%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           I +   F A+ R           V K   C +   HGH+Y + + M G+   + G V + 
Sbjct: 5   INRRAQFSASRRYWLPELGEAQNVEKFGPCAKFPGHGHNYVLFISMSGE-LDEYGMVLNL 63

Query: 53  FNIEQYFS-PLLEKLDHHCLNEIEELEN---PTAENIAIWIWKRLSTSLSILSSVRVYET 108
            +++Q     +  +LD   LNE+ E      PT ENIA  IW RL+  L  L  V+++E 
Sbjct: 64  SDVKQVIKSEVTSELDFSYLNEVWEEFQATLPTTENIARVIWNRLAPHLP-LVRVQLFEH 122

Query: 109 PMSWVEYQG 117
           P  W EY+G
Sbjct: 123 PQLWTEYEG 131



 Score = 86.4 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 38/124 (30%), Positives = 62/124 (50%), Gaps = 18/124 (14%)

Query: 9   FEAAHRLPRVPKT--------HKCHRM--HGHSYRVELVMEGDVDPKTGFVDDFFNIEQY 58
           F AAHRL     +         KC R+  HGH+Y +E+ ++G++D  TG   D   + Q 
Sbjct: 276 FSAAHRLADPTLSLEKNQTIYGKCSRINGHGHNYYLEVTVQGEIDSVTGMSVDLVGLNQI 335

Query: 59  FSPL-LEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSL----SILSSVRVYETPM 110
                +E +DH  LN ++       PTAENIA++I   + + +    + L  V++ E+P 
Sbjct: 336 IQHYVIEPMDHSFLNQDLPYFTEVVPTAENIAVYITNVVRSPIEELGAKLHKVKLIESPN 395

Query: 111 SWVE 114
           +  E
Sbjct: 396 NSCE 399


>gi|124024891|ref|YP_001014007.1| 6-pyruvoyl tetrahydropterin synthase [Prochlorococcus marinus str.
           NATL1A]
 gi|123959959|gb|ABM74742.1| 6-pyruvoyl tetrahydropterin synthase [Prochlorococcus marinus str.
           NATL1A]
          Length = 308

 Score = 99.9 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/130 (29%), Positives = 63/130 (48%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRL--------PRVPKTHKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL               KC     HGH+Y V++ ++G ++P+TG + D 
Sbjct: 156 LTVQTHFSAAHRLAREDLPQTENEKIFGKCARPNGHGHNYLVDITVKGKINPRTGMICDL 215

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSL----SILSSVR 104
             +    +  ++E  DH  LN +I    N   TAENIA+ I  +L+  +    + L  ++
Sbjct: 216 SALNSLINDLVVEPFDHTFLNKDIPYFANCVPTAENIALHISDKLTNPINAIGANLYKIK 275

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 276 LQESPNNAAE 285



 Score = 93.7 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 43/134 (32%), Positives = 65/134 (48%), Gaps = 21/134 (15%)

Query: 3   ITQAFTFEAAH--RLPRVPKT------HKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F A+H  RLP +           C     HGH+Y + + MEGD   K G V + 
Sbjct: 18  ITRRACFSASHLYRLPELSDDDNSALFGPCSIAPGHGHNYELIVTMEGD-LNKYGMVLNL 76

Query: 53  FNIE-QYFSPLLEKLDHHCLNEI-EELE-------NPTAENIAIWIWKRLSTSLSILSSV 103
            +++    + +  +LD   LN+   E +        PT E++   IW+RL + L  L S+
Sbjct: 77  SDVKYAIKNEVTSQLDFRFLNDTWPEFDLSKPEGCLPTTESLVRIIWERLKSHLP-LKSL 135

Query: 104 RVYETPMSWVEYQG 117
           R+YE P  W +YQG
Sbjct: 136 RLYENPKLWADYQG 149


>gi|15614806|ref|NP_243109.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus halodurans C-125]
 gi|10174862|dbj|BAB05962.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus halodurans C-125]
          Length = 140

 Score = 99.9 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/124 (30%), Positives = 61/124 (49%), Gaps = 12/124 (9%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ +     AAH +P      KC  +HGH+Y + + + GD   KTGF+ DF  ++    
Sbjct: 15  FELNKDMHLAAAHFIP-AKDAGKCQDVHGHTYFINVTIAGDELDKTGFLVDFKQLKTIVH 73

Query: 61  PLLEKLDHHCLNEIEELEN--PTAENIAIWIWKRLSTSL------SILSSVRVYETPMSW 112
               + DH  LN+ +E +   PT E +A  I++R+   L       +   V V ETP S+
Sbjct: 74  K---RYDHTLLNDHDEFKGTFPTTEMVAKTIYERIQAYLDNRPNKPVCVQVVVRETPTSY 130

Query: 113 VEYQ 116
           V Y+
Sbjct: 131 VVYR 134


>gi|294669282|ref|ZP_06734361.1| queuosine biosynthesis protein QueD [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291308692|gb|EFE49935.1| queuosine biosynthesis protein QueD [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 140

 Score = 99.9 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/140 (29%), Positives = 72/140 (51%), Gaps = 26/140 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEG---DVDPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ + G   +   K G V DF ++++
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSGSLIEGGAKDGMVMDFSDLKR 58

Query: 58  YF-SPLLEKLDHHCL-----------------NEIEELE---NPTAENIAIWIWKRLSTS 96
                ++E  DH  +                   ++ L      TAEN+A+ ++ RL  +
Sbjct: 59  TVKQHIIEPFDHAFIYHGGNGRECQIAALLEGWNMKTLRLPFRTTAENMAVEMYGRLKNA 118

Query: 97  LSILSSVRVYETPMSWVEYQ 116
              +S+V+++ETP S  EY+
Sbjct: 119 GLNVSNVKLWETPTSCAEYE 138


>gi|224824584|ref|ZP_03697691.1| 6-pyruvoyl tetrahydropterin synthase [Lutiella nitroferrum 2002]
 gi|224603077|gb|EEG09253.1| 6-pyruvoyl tetrahydropterin synthase [Lutiella nitroferrum 2002]
          Length = 341

 Score = 99.9 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 62/109 (56%), Gaps = 7/109 (6%)

Query: 9   FEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDH 68
           FEAAH+LP VP  HKC R+HGH + V LV +           +  ++   +  L  +L+H
Sbjct: 118 FEAAHQLPHVPAGHKCGRLHGHGFGVRLVADAAS-------ANHVDLAAAWGRLFLRLNH 170

Query: 69  HCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
             LN+I  L NPT+E +A WI++ LS  L+ L+ V V ET  +  ++ G
Sbjct: 171 RYLNDIPGLANPTSEVLAQWIYRELSADLAGLAWVEVRETHTAGSQFDG 219



 Score = 77.5 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 28/107 (26%), Positives = 54/107 (50%), Gaps = 6/107 (5%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +I +   FE+A                GHSY + L+++G++D   G++ DF +++  F 
Sbjct: 222 FRIWKEQHFESA------VPFDADGNYTGHSYLIRLMLQGELDGAMGWLLDFGDVKDRFK 275

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYE 107
           P+  +LDH+ L+ +  + N    ++A W+   LS  +  L+ V + E
Sbjct: 276 PVYRQLDHNPLDRLAGIRNGHPASVAEWVHAELSPLVPELARVDLME 322



 Score = 35.5 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 41/99 (41%), Gaps = 13/99 (13%)

Query: 7   FTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKL 66
             FEAA +L       +   +HGHS+RV+L +E     + G       + +     ++ L
Sbjct: 10  ARFEAARQLSADWFEPQFASLHGHSFRVQLRVENIHTNQAG-------LAETLQRAVQPL 62

Query: 67  DHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRV 105
           ++  LN         A    + I + LS  LS   S+ +
Sbjct: 63  NYASLN------QRMAAVDDLAIAEHLSEQLSFPHSLTL 95


>gi|329119483|ref|ZP_08248168.1| 6-pyruvoyltetrahydropterin synthase [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327464416|gb|EGF10716.1| 6-pyruvoyltetrahydropterin synthase [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 140

 Score = 99.9 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 42/141 (29%), Positives = 66/141 (46%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGD---VDPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+YR+E+ +  D      K G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHLLDG--HDGKCKNLHGHTYRLEITVSDDLICGGAKDGMVMDFADLKT 58

Query: 58  YF-SPLLEKLDHHCLNEIEELENP--------------------TAENIAIWIWKRLSTS 96
                ++   DH  L   +                         TAEN+A  I+ RL  +
Sbjct: 59  IAEREIIAPFDHAFLYHADNARECQIAALLEGWQMKTLRLPCRTTAENMAAEIYGRLKAA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              + SV+++ETP S  E++G
Sbjct: 119 GVNVCSVKLWETPTSCAEFEG 139


>gi|298384119|ref|ZP_06993680.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. 1_1_14]
 gi|298263723|gb|EFI06586.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. 1_1_14]
          Length = 124

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 57/116 (49%), Gaps = 9/116 (7%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             + +     A+H+L  +P   KC  +HGH++ + +          G V DF  I++  +
Sbjct: 2   FTVIKRMEISASHKLV-LPYRSKCASLHGHNWIITVYCRSSRLNSEGMVVDFTRIKEVVT 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
              EKLDH  LNE+    NPTAENIA W+ K++         V V E+  + V Y+
Sbjct: 61  ---EKLDHQNLNEVLPF-NPTAENIARWVCKQI----PQCYKVEVQESEGNIVIYE 108


>gi|95929553|ref|ZP_01312295.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfuromonas acetoxidans DSM 684]
 gi|95134250|gb|EAT15907.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfuromonas acetoxidans DSM 684]
          Length = 123

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/114 (27%), Positives = 57/114 (50%), Gaps = 8/114 (7%)

Query: 8   TFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLD 67
            F AAH L        C  +HGH+++VE+ +      ++G   DF  ++     LL  LD
Sbjct: 9   HFAAAHNLINYDGD--CENLHGHNWKVEVTVRAKELDESGLGIDFKILKARTKELLATLD 66

Query: 68  HHCLNEIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEY 115
           H  LN++   +  +P++ENI  ++++ L  +L+     +  V V+E+  +   Y
Sbjct: 67  HKYLNDLPPFKETSPSSENIGRYLFEALEETLNTDNVQVECVNVWESDNACASY 120


>gi|160897279|ref|YP_001562861.1| 6-pyruvoyl tetrahydropterin synthase/hypothetical protein [Delftia
           acidovorans SPH-1]
 gi|160362863|gb|ABX34476.1| 6-pyruvoyl tetrahydropterin synthase/hypothetical protein [Delftia
           acidovorans SPH-1]
          Length = 121

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 37/106 (34%), Positives = 54/106 (50%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             + Q F F+AAH L R  +T    R+HGH+Y  E+ + G  +P  G V D   +     
Sbjct: 3   FTVHQRFFFDAAHTLERAIETESSRRIHGHTYYAEVSVTGPRNPDNGMVIDLGYLRSRLK 62

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVY 106
            L + LDH  L+EI  L  PT EN+ ++I   L+      S +RV+
Sbjct: 63  TLGDALDHRFLDEIPGLGKPTLENLCLFIADSLADLQPAPSRIRVW 108


>gi|240015887|ref|ZP_04722427.1| putative 6-pyruvoyl-tetrahydropterin synthase [Neisseria
           gonorrhoeae FA6140]
 gi|240117264|ref|ZP_04731326.1| putative 6-pyruvoyl-tetrahydropterin synthase [Neisseria
           gonorrhoeae PID1]
 gi|240122818|ref|ZP_04735774.1| putative 6-pyruvoyl-tetrahydropterin synthase [Neisseria
           gonorrhoeae PID332]
 gi|268602960|ref|ZP_06137127.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268681432|ref|ZP_06148294.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|268587091|gb|EEZ51767.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268621716|gb|EEZ54116.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
          Length = 140

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 40/141 (28%), Positives = 68/141 (48%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEG---DVDPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +         K G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSDGTIKGGAKDGMVMDFTDLKA 58

Query: 58  YF-SPLLEKLDHHCL--------NEIEEL------------ENPTAENIAIWIWKRLSTS 96
                + +  DH  +        ++I  L               TAEN+A+ ++ RL  +
Sbjct: 59  IVKQHITDHFDHAFIYHGGNGRESQIAALLEGWNMKTLRLPCRTTAENMAVEMYGRLKNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              +  V+++ETP S  EY+G
Sbjct: 119 GLNVCRVKLWETPTSCAEYEG 139


>gi|240949105|ref|ZP_04753453.1| 6-pyruvoyltetrahydrobiopterin synthase [Actinobacillus minor NM305]
 gi|240296500|gb|EER47132.1| 6-pyruvoyltetrahydrobiopterin synthase [Actinobacillus minor NM305]
          Length = 140

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/139 (24%), Positives = 68/139 (48%), Gaps = 26/139 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGD---VDPKTGFVDDFFNIEQ 57
            KI + F+F+ AH L       KC  +HGH+Y++++ + G+      K G V D+ +++ 
Sbjct: 2   FKIAKEFSFDMAHMLDG--HDGKCQNLHGHTYKLQVEVTGNLHLEGAKRGMVMDYSDLKA 59

Query: 58  YFSPLL-EKLDHHCLNEIEELE--------------------NPTAENIAIWIWKRLSTS 96
                + + +DH  + +++  +                      TAE +A +I+++L+  
Sbjct: 60  LVKQHILDPMDHAFIYDLQSDKETKVAQLLMDLDSKVYGIPSRTTAEEMAKYIFEKLANV 119

Query: 97  LSILSSVRVYETPMSWVEY 115
              +S +R++ETP S+ EY
Sbjct: 120 GLPVSLIRLWETPTSYCEY 138


>gi|110637794|ref|YP_678001.1| 6-pyruvoyltetrahydropterin synthase [Cytophaga hutchinsonii ATCC
           33406]
 gi|110280475|gb|ABG58661.1| probable 6-pyruvoyltetrahydropterin synthase (6-pyruvoyl
           tetrahydrobiopterin) synthase [Cytophaga hutchinsonii
           ATCC 33406]
          Length = 141

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/138 (26%), Positives = 61/138 (44%), Gaps = 21/138 (15%)

Query: 1   MKITQAFTFEAAHRLPRVPK--------THKC--HRMHGHSYRVELVMEGDVDPKTGFVD 50
           + +++   F AAH+L                C     HGH++ + + ++G+  P TGFV 
Sbjct: 3   IYVSRQEHFNAAHKLYNPAWSEEKNAEMFGPCANSNWHGHNFDLIVTVKGEPSPDTGFVI 62

Query: 51  DFFNIEQYFSPL-LEKLDHHCLNEIEEL---ENPTAENIAIWIWKRLSTSL-------SI 99
           D   +         +K+DH  LN   +    +  + E +A   WK L   +         
Sbjct: 63  DLKKLSTLIREKVTDKVDHKNLNLDVDFMIGKMASTEILAYEFWKILEPHITTLSDGRGK 122

Query: 100 LSSVRVYETPMSWVEYQG 117
           L S+++YETP ++VEY G
Sbjct: 123 LHSIKLYETPRNYVEYFG 140


>gi|303233211|ref|ZP_07319884.1| putative queuosine biosynthesis protein QueD [Atopobium vaginae
           PB189-T1-4]
 gi|302480796|gb|EFL43883.1| putative queuosine biosynthesis protein QueD [Atopobium vaginae
           PB189-T1-4]
          Length = 177

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 37/140 (26%), Positives = 53/140 (37%), Gaps = 25/140 (17%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDP----KTGFVDDFFNIE 56
             +     F AAH L       KC  +HGH +RV + +  D           + DF   +
Sbjct: 23  FGLKTEAHFNAAHFLT--DFQGKCENIHGHRWRVVVYLYADTLDTSGENRDMLIDFGVFK 80

Query: 57  QYFSPLLEKLDHHCLNEIEELEN-------------------PTAENIAIWIWKRLSTSL 97
           +     + K DH  + E   L N                    TAEN A + + RL++  
Sbjct: 81  KAVREEVAKFDHQFIVERGSLANDTIACLERETFSLLMVDFRTTAENFARYFYTRLTSRG 140

Query: 98  SILSSVRVYETPMSWVEYQG 117
             +S V VYETP +   Y G
Sbjct: 141 FGVSRVDVYETPNNCAIYYG 160


>gi|298376474|ref|ZP_06986429.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. 3_1_19]
 gi|298266352|gb|EFI08010.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. 3_1_19]
          Length = 111

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/114 (31%), Positives = 54/114 (47%), Gaps = 9/114 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + +     A+HRL  +    KC  +HGH++ V +          G V DF ++++     
Sbjct: 4   VRKRLEISASHRL-SLSYASKCENLHGHNWIVIVWCRSKQLNPDGMVVDFAHVKRMIQ-- 60

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            EKLDH  LNE+    NPTAENIA WI  ++         V V E+  +   Y+
Sbjct: 61  -EKLDHKNLNEVLSF-NPTAENIAKWICDQI----PQCFKVMVQESENNIAWYE 108


>gi|332288622|ref|YP_004419474.1| 6-pyruvoyl tetrahydropterin synthase [Gallibacterium anatis UMN179]
 gi|330431518|gb|AEC16577.1| 6-pyruvoyl tetrahydropterin synthase [Gallibacterium anatis UMN179]
          Length = 141

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/140 (29%), Positives = 75/140 (53%), Gaps = 27/140 (19%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDP---KTGFVDDFFNIEQ 57
           MK+ + F+F+ AH L       KC  +HGH+Y++++++ G+ +    K G V DF ++++
Sbjct: 1   MKVAKEFSFDMAHLLDG--HDGKCQNLHGHTYKLQVIVSGETEDNGAKKGMVIDFADLKR 58

Query: 58  YFSP-LLEKLDHHCLNE--------IEEL------------ENPTAENIAIWIWKRLSTS 96
             +  ++  +DH  + +        I +L               TAEN+A +I++RL  +
Sbjct: 59  AVNELIISPMDHAFIYDQSSERETKIAQLLQQLNSKTFALPMRSTAENLAQFIFQRLQEN 118

Query: 97  LS-ILSSVRVYETPMSWVEY 115
           +   L SVR++ETP S+ EY
Sbjct: 119 VGFHLHSVRLWETPTSFAEY 138


>gi|75676804|ref|YP_319225.1| 6-pyruvoyl tetrahydropterin synthase [Nitrobacter winogradskyi
           Nb-255]
 gi|74421674|gb|ABA05873.1| 6-pyruvoyl tetrahydropterin synthase [Nitrobacter winogradskyi
           Nb-255]
          Length = 123

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/117 (35%), Positives = 64/117 (54%), Gaps = 2/117 (1%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++T++F FEAAH LP          +HGHS+R E+ + G  DP +G V D   +E+    
Sbjct: 3   ELTKSFRFEAAHALPGTTLGAASMEIHGHSFRAEVSLRGTPDPASGMVLDLGLLERGMGE 62

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYE-TPMSWVEYQG 117
           +  KLDH  LN++E L  PT EN+A +IW  +  + + ++ V V+  +      Y G
Sbjct: 63  VRNKLDHKLLNDVEGLGPPTLENLARFIWDHVQHAGA-VTRVSVHRDSCGESCAYFG 118


>gi|313891456|ref|ZP_07825072.1| putative queuosine biosynthesis protein QueD [Dialister
           microaerophilus UPII 345-E]
 gi|329121408|ref|ZP_08250033.1| 6-pyruvoyl-tetrahydropterin synthase [Dialister micraerophilus DSM
           19965]
 gi|313120231|gb|EFR43407.1| putative queuosine biosynthesis protein QueD [Dialister
           microaerophilus UPII 345-E]
 gi|327469698|gb|EGF15165.1| 6-pyruvoyl-tetrahydropterin synthase [Dialister micraerophilus DSM
           19965]
          Length = 109

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/114 (29%), Positives = 59/114 (51%), Gaps = 9/114 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +T+      AH L ++    KC ++HGH++ V + ++ +   + G V DF +I++     
Sbjct: 4   VTKRMEISGAHFL-KLDYESKCKKLHGHNWIVTITVQSETLNEHGMVVDFTDIKKVV--- 59

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
             +LDH+ +NE+    NPTAENIA W+  ++         V V ET  +   Y+
Sbjct: 60  -NRLDHNVVNEVIGSMNPTAENIAKWLCDQI----PNCIKVSVQETEGNIATYE 108


>gi|260171439|ref|ZP_05757851.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. D2]
          Length = 118

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/116 (32%), Positives = 56/116 (48%), Gaps = 9/116 (7%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             + +     A+H+L  +P   KC  +HGH++ + +          G V DF  I++   
Sbjct: 2   FTVIKRMEISASHKLV-LPYRSKCASLHGHNWIITVYCRSMRLNSEGMVVDFTRIKEVVM 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
              EKLDH  LNE+    NPTAENIA W+ K+L         V V E+  + V Y+
Sbjct: 61  ---EKLDHQNLNEVLPF-NPTAENIARWVCKQL----PQCYKVEVQESEGNIVIYE 108


>gi|148241391|ref|YP_001226548.1| 6-pyruvoyl-tetrahydropterin synthase [Synechococcus sp. RCC307]
 gi|147849701|emb|CAK27195.1| 6-pyruvoyl-tetrahydropterin synthase [Synechococcus sp. RCC307]
          Length = 301

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/130 (31%), Positives = 65/130 (50%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL R   +         KC R HGH  +Y +++ + G +DP++G V D 
Sbjct: 164 LTIRGHFAAAHRLAREELSQSENETIYGKCARPHGHGHNYLLDVTVRGQIDPRSGMVCDL 223

Query: 53  FNIEQYF-SPLLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSLSI----LSSVR 104
             +++     +LE  DH  LN ++    +   TAENIA+ I  RL   ++     L  +R
Sbjct: 224 AALQKLLDDEVLEPFDHTFLNKDVPFFASCVPTAENIALHIADRLKAPIADLGASLHKIR 283

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 284 LQESPNNAAE 293



 Score = 79.8 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 41/136 (30%), Positives = 65/136 (47%), Gaps = 24/136 (17%)

Query: 3   ITQAFTFEAAHRLPRVPK---------THKCHR--MHGHSYRVELVMEGDVDPKTGFVDD 51
           IT+  TF ++H L  +P+            C +   HGH+Y + + MEG      G V +
Sbjct: 25  ITRRATFSSSH-LYSLPELSAAENQQRFGPCSQAPGHGHNYELIVAMEG-GLDANGMVLN 82

Query: 52  FFNIEQYFS-PLLEKLDHHCLN------EIEELEN---PTAENIAIWIWKRLSTSLSILS 101
             +++      + E+LD  CLN      ++E  +    PT E +   IW+RLST L  L 
Sbjct: 83  LSDVKHAIRSQVTEQLDFRCLNTTWPEFDVEGSQQAALPTTEWLLYAIWQRLSTHLP-LR 141

Query: 102 SVRVYETPMSWVEYQG 117
           S+R++E    W +Y G
Sbjct: 142 SLRLFEQSTLWADYFG 157


>gi|78183928|ref|YP_376363.1| 6-pyruvoyltetrahydropterin synthase [Synechococcus sp. CC9902]
 gi|78168222|gb|ABB25319.1| 6-pyruvoyltetrahydropterin synthase [Synechococcus sp. CC9902]
          Length = 306

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 44/130 (33%), Positives = 66/130 (50%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL R   +         KC R HGH  +Y V++ + G +DP+TG V D 
Sbjct: 156 LTIRTHFAAAHRLARPELSQEENEQIYGKCARPHGHGHNYLVDITVRGAIDPRTGMVCDL 215

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSL----SILSSVR 104
             +++     ++E  DH  LN ++        TAENIA+ I  RLS+ +    + L  VR
Sbjct: 216 SALQRLVDDLVVEPFDHTFLNKDVPFFAECVPTAENIALHIADRLSSPIKAIGAQLHKVR 275

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 276 LQESPNNAAE 285



 Score = 85.2 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 56/134 (41%), Gaps = 21/134 (15%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCHR--MHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F A+HR                 C     HGH+Y + + M GD     G V + 
Sbjct: 18  ITRRACFSASHRYWLPELSADDNAARFGPCSFAPGHGHNYELIVSMAGD-LDADGMVLNL 76

Query: 53  FNIEQYFS-PLLEKLDHHCLNEI-EELEN-------PTAENIAIWIWKRLSTSLSILSSV 103
             ++      +  +LD   LNE   E +        PT E +   IW RL + L  ++++
Sbjct: 77  SEVKHAIRSEVTGQLDFRFLNEAWPEFDVSSSEGCLPTTEALVRTIWHRLRSHLP-ITAL 135

Query: 104 RVYETPMSWVEYQG 117
           R+YE P  W +Y G
Sbjct: 136 RLYEQPGLWADYLG 149


>gi|237721522|ref|ZP_04552003.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. 2_2_4]
 gi|229449318|gb|EEO55109.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. 2_2_4]
          Length = 118

 Score = 99.5 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 56/116 (48%), Gaps = 9/116 (7%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             + +     A+H+L  +P   KC  +HGH++ + +          G V DF  I++   
Sbjct: 2   FTVIKRMEISASHKLV-LPYRSKCASLHGHNWIITVYCRSARLNSEGMVVDFTRIKEVVM 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
              EKLDH  LNE+    NPTAENIA W+ K++         V V E+  + V Y+
Sbjct: 61  ---EKLDHQNLNEVLPF-NPTAENIARWVCKQI----PQCYKVEVQESEGNIVIYE 108


>gi|116073892|ref|ZP_01471154.1| 6-pyruvoyltetrahydropterin synthase [Synechococcus sp. RS9916]
 gi|116069197|gb|EAU74949.1| 6-pyruvoyltetrahydropterin synthase [Synechococcus sp. RS9916]
          Length = 307

 Score = 99.5 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 42/130 (32%), Positives = 65/130 (50%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL R   +         KC R HGH  +Y V++ + G +D +TG V D 
Sbjct: 157 LTIRTHFAAAHRLARPELSQEENEAIYGKCARPHGHGHNYLVDVTVRGAIDARTGMVCDL 216

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSL----SILSSVR 104
             +++     ++E  DH  LN ++    +   TAENIA+ I  +LS  +    + L  VR
Sbjct: 217 AALQRLVDDLVVEPFDHTFLNKDVPHFVDCVPTAENIALHIADQLSAPIRAIGAQLHKVR 276

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 277 LQESPNNAAE 286



 Score = 86.0 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/134 (26%), Positives = 56/134 (41%), Gaps = 21/134 (15%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F ++HR                 C     HGH+Y + + M G      G V + 
Sbjct: 19  ITRRACFSSSHRYWLPELSADDNAARFGPCAIAPGHGHNYELIVSMAG-ALDADGMVLNL 77

Query: 53  FNIEQYFS-PLLEKLDHHCLNEI-EELE-------NPTAENIAIWIWKRLSTSLSILSSV 103
            +++      +  +LD   LNE   E +        PT E +   IW+RLS  L  L ++
Sbjct: 78  SDVKHAIRSEVTGQLDFRFLNEAWPEFDLSQPQGCLPTTEALVRVIWQRLSPHLP-LVAL 136

Query: 104 RVYETPMSWVEYQG 117
           R++E+   W +Y G
Sbjct: 137 RLHESQTLWADYLG 150


>gi|329925194|ref|ZP_08280137.1| queuosine biosynthesis protein QueD [Paenibacillus sp. HGF5]
 gi|328940027|gb|EGG36360.1| queuosine biosynthesis protein QueD [Paenibacillus sp. HGF5]
          Length = 163

 Score = 99.5 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 65/125 (52%), Gaps = 14/125 (11%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y+V   + G    + G   DF +I+  +   
Sbjct: 35  VSKEFTFDAAHHLHCYE--GKCKNLHGHTYKVVFGISGTP-NEVGITVDFGDIKDCWKTS 91

Query: 63  LEKL-DHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSS----------VRVYETPMS 111
           +E   DH  LNE     N TAEN+ +W+++++  +L    S          VR++ETP S
Sbjct: 92  IEPYLDHRYLNETLPPMNTTAENMVVWLFEKMEEALRSRESYEQQGMRTEFVRLFETPTS 151

Query: 112 WVEYQ 116
           + E +
Sbjct: 152 YAEVR 156


>gi|198437505|ref|XP_002131927.1| PREDICTED: similar to 6-pyruvoyl-tetrahydropterin synthase isoform
           1 [Ciona intestinalis]
 gi|198437507|ref|XP_002131931.1| PREDICTED: similar to 6-pyruvoyl-tetrahydropterin synthase isoform
           2 [Ciona intestinalis]
          Length = 140

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 43/133 (32%), Positives = 73/133 (54%), Gaps = 18/133 (13%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+  T  A+HRL          +    KC+    HGH+Y V++ + G+VDP TG V + 
Sbjct: 5   LTRRLTLCASHRLHAPQLSDEDNLRIYGKCNPPNGHGHNYEVKVTVYGEVDPVTGMVINA 64

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI----LSSVR 104
            ++++Y    ++E +DH C++ +I+  ++   TAENIAI+IW++L   +      L  V+
Sbjct: 65  VDLKEYMQKAIMEPMDHKCVDKDIDYFKDKPSTAENIAIYIWQQLEPYMKNEKCSLYKVQ 124

Query: 105 VYETPMSWVEYQG 117
           + ET     EY G
Sbjct: 125 LCETENIVTEYMG 137


>gi|29349861|ref|NP_813364.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|253569770|ref|ZP_04847179.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. 1_1_6]
 gi|29341772|gb|AAO79558.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|251840151|gb|EES68233.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. 1_1_6]
          Length = 124

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/116 (31%), Positives = 57/116 (49%), Gaps = 9/116 (7%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             + +     A+H+L  +P   KC  +HGH++ + +          G V DF  I++  +
Sbjct: 2   FTVIKRMEISASHKLV-LPYRSKCASLHGHNWIITVYCRSSRLNSEGMVVDFTRIKEVVT 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
              EKLDH  LNE+    NPTAENIA W+ +++         V V E+  + V Y+
Sbjct: 61  ---EKLDHQNLNEVLPF-NPTAENIARWVCRQI----PQCYKVEVQESEGNIVIYE 108


>gi|313668993|ref|YP_004049277.1| 6-pyruvoyl tetrahydrobiopterin synthase [Neisseria lactamica
           ST-640]
 gi|313006455|emb|CBN87918.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Neisseria
           lactamica 020-06]
          Length = 140

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/141 (28%), Positives = 68/141 (48%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEG---DVDPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +         K G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSDGIIKGGAKDGMVMDFTDLKT 58

Query: 58  YF-SPLLEKLDHHCL--------NEIEEL------------ENPTAENIAIWIWKRLSTS 96
                + +  DH  +        ++I  L               TAEN+A+ ++ RL  +
Sbjct: 59  IVKQHITDPFDHAFIYHGGNGRESQIAALLEGWNMKTLRLPCRTTAENMAVEMYGRLKNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              +  V+++ETP S  EY+G
Sbjct: 119 GLNVCGVKLWETPTSCAEYEG 139


>gi|329961993|ref|ZP_08300004.1| putative queuosine biosynthesis protein QueD [Bacteroides fluxus
           YIT 12057]
 gi|328530641|gb|EGF57499.1| putative queuosine biosynthesis protein QueD [Bacteroides fluxus
           YIT 12057]
          Length = 110

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/114 (31%), Positives = 53/114 (46%), Gaps = 9/114 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + +     AAH L ++    KC  +HGH++ + +          G V DF  I+Q     
Sbjct: 4   VIKRMEVSAAHSL-QLSYRSKCENLHGHNWIITVYCRSKELNADGMVIDFSRIKQVVK-- 60

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            E+LDH  LNE+    NPTAENIA WI  ++         V V E+  +   Y+
Sbjct: 61  -EQLDHRNLNEVLPF-NPTAENIARWICDQI----PACFKVEVQESESNIAVYE 108


>gi|312129466|ref|YP_003996806.1| hypothetical protein Lbys_0691 [Leadbetterella byssophila DSM
           17132]
 gi|311906012|gb|ADQ16453.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Leadbetterella byssophila DSM 17132]
          Length = 145

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/129 (31%), Positives = 63/129 (48%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHR--MHGHSYRVELVMEGDVDPKTGFVDDF 52
           + +   F AAHRL               KC+    HGH+Y + + + G+VDPK+GFV D 
Sbjct: 14  VFRKEHFNAAHRLHCEEWDQETNARIFGKCNNPNYHGHNYELHVKVTGEVDPKSGFVFDL 73

Query: 53  FNIEQYFSPLL-EKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSILS--SVRVY 106
             +       + E  DH  LN ++   +  NPTAENI + I+  L   +       +R++
Sbjct: 74  KILSDLIREHVLEVFDHKNLNLDLPYFKDINPTAENICVVIYDILRPKIEEKYDIKIRLF 133

Query: 107 ETPMSWVEY 115
           ET  ++VEY
Sbjct: 134 ETERNYVEY 142


>gi|237715730|ref|ZP_04546211.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. D1]
 gi|262408738|ref|ZP_06085284.1| queuosine biosynthesis protein QueD [Bacteroides sp. 2_1_22]
 gi|293369178|ref|ZP_06615772.1| putative queuosine biosynthesis protein QueD [Bacteroides ovatus SD
           CMC 3f]
 gi|298481566|ref|ZP_06999758.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. D22]
 gi|229444439|gb|EEO50230.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. D1]
 gi|262353603|gb|EEZ02697.1| queuosine biosynthesis protein QueD [Bacteroides sp. 2_1_22]
 gi|292635761|gb|EFF54259.1| putative queuosine biosynthesis protein QueD [Bacteroides ovatus SD
           CMC 3f]
 gi|298272430|gb|EFI13999.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. D22]
          Length = 118

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 57/116 (49%), Gaps = 9/116 (7%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             + +     A+H+L  +P   KC  +HGH++ + +          G V DF  I++  +
Sbjct: 2   FTVIKRMEISASHKLV-LPYRSKCASLHGHNWIITVYCRSARLNSEGMVVDFTRIKEVVT 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
              EKLDH  LNE+    NPTAENIA W+ K++         V V E+  + V Y+
Sbjct: 61  ---EKLDHQNLNEVLPF-NPTAENIARWVCKQI----PQCYKVEVQESEGNIVIYE 108


>gi|123967660|ref|YP_001008518.1| 6-pyruvoyl tetrahydropterin synthase [Prochlorococcus marinus str.
           AS9601]
 gi|123197770|gb|ABM69411.1| 6-pyruvoyl tetrahydropterin synthase [Prochlorococcus marinus str.
           AS9601]
          Length = 308

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 45/130 (34%), Positives = 69/130 (53%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRL--------PRVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL               KC R+  HGH+Y VE+ ++GD+D +TG V D 
Sbjct: 156 LTVQTHFAAAHRLAKEEVSFDENKKIYGKCARVNGHGHNYLVEITVKGDIDKRTGMVCDL 215

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSL----SILSSVR 104
             +++  +  ++E+LDH  LN +IE   N   TAENIA++I   L   +    + L  +R
Sbjct: 216 SALQEIINDLVVEQLDHTFLNKDIEFFHNCVPTAENIALYISDILKKPIYNLGATLHKIR 275

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 276 LQESPNNAAE 285



 Score = 93.7 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 38/134 (28%), Positives = 59/134 (44%), Gaps = 21/134 (15%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F ++HR           +    KC     HGH+Y + + M G+     G V + 
Sbjct: 18  ITRRACFSSSHRYWLPEKSPEENLSLFGKCSIAPGHGHNYELIVSMGGE-LDSNGMVLNL 76

Query: 53  FNIEQYF-SPLLEKLDHHCLNEIEELEN--------PTAENIAIWIWKRLSTSLSILSSV 103
            +++      +  +LD H LN++    N        PT E +   IW RL   L  L+S+
Sbjct: 77  SDVKHSIKDKVTGQLDFHFLNDVWPEFNVNNQEGILPTTEALVKVIWSRLKDDLP-LTSL 135

Query: 104 RVYETPMSWVEYQG 117
           R+YE P  W +Y G
Sbjct: 136 RLYENPNLWADYFG 149


>gi|326405233|ref|YP_004285315.1| putative 6-pyruvoyltetrahydropterin synthase [Acidiphilium
           multivorum AIU301]
 gi|325052095|dbj|BAJ82433.1| putative 6-pyruvoyltetrahydropterin synthase [Acidiphilium
           multivorum AIU301]
          Length = 118

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/115 (38%), Positives = 63/115 (54%), Gaps = 2/115 (1%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +IT+ F FEAAH L R        R+HGHSYR  + + G  D  +G + DF  + Q+ + 
Sbjct: 3   EITKEFRFEAAHTLQRQIAAEASRRIHGHSYRATVTLRGAPDA-SGMLMDFGRLGQHLAA 61

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYE-TPMSWVEY 115
           + E LDH  L+E+E L   T EN+A +IW RL+ S   L+ V V+  +      Y
Sbjct: 62  IREALDHRFLDEVEGLGPATLENLARFIWTRLAPSCPGLARVAVFRDSEGESCAY 116


>gi|219846974|ref|YP_002461407.1| hypothetical protein Cagg_0018 [Chloroflexus aggregans DSM 9485]
 gi|219541233|gb|ACL22971.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Chloroflexus aggregans DSM 9485]
          Length = 274

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/130 (28%), Positives = 65/130 (50%), Gaps = 16/130 (12%)

Query: 4   TQAFTFEAAHRLPRVPKTHKCH----------RMHGHSYRVELVMEGDVDPKTGFVDDFF 53
           T+ F F AAHR  R   +   +            HGH+Y +++ + G++D +TG V +  
Sbjct: 5   TRRFEFSAAHRYWRDDWSAAENERVFGPYTSPYGHGHNYTLDVSITGELDERTGMVMNMT 64

Query: 54  NIEQYFSPLLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS---ILSSVRVYE 107
            ++   + +LE+ DH  LN +     +  PT EN    +W+ ++  +     L+ +R+YE
Sbjct: 65  ELKAIVNEVLEEFDHKHLNLDTPYFRDQIPTTENFVRVLWRLIAARIPAHARLAHLRLYE 124

Query: 108 TPMSWVEYQG 117
            P  WV+Y G
Sbjct: 125 QPDLWVDYDG 134



 Score = 91.0 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 67/127 (52%), Gaps = 14/127 (11%)

Query: 5   QAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDFFN 54
           + +TF AAHRL          +    KC+    HGH+Y +E+ ++G++DP TG + D   
Sbjct: 142 RLYTFAAAHRLHAPALSDEENLAIYGKCNNPNGHGHNYTLEVTVQGEIDPATGMLVDLAW 201

Query: 55  IEQYFSPLLEKLDHHCLN-EIEEL--ENPTAENIAIWIWKRLSTSLS-ILSSVRVYETPM 110
           ++Q    +++ L  H L+ EI        TAENI +++W  L+  L   L+ +R++ET  
Sbjct: 202 LDQTVHSVIDLLHLHHLDREIPAFAERPSTAENIIVYLWNELAPKLKGRLALLRLWETRK 261

Query: 111 SWVEYQG 117
           +   Y G
Sbjct: 262 NIFSYAG 268


>gi|318042492|ref|ZP_07974448.1| 6-pyruvoyl tetrahydropterin synthase [Synechococcus sp. CB0101]
          Length = 290

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/130 (33%), Positives = 66/130 (50%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL R   +         KC R HGH  +Y +E+ + G +DP+TG V D 
Sbjct: 140 LTIKTHFAAAHRLARPELSPEENDAIYGKCARPHGHGHNYMLEVTVRGSIDPRTGMVCDL 199

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSL----SILSSVR 104
             +++     ++E  DH  LN ++    +  PTAENIA+ I   LS  +    + L  VR
Sbjct: 200 AALQRLVDELVVEPFDHTFLNKDVAHFASTVPTAENIALHIADLLSAPIAGLGASLHKVR 259

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 260 LQESPNNAAE 269



 Score = 81.0 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 36/134 (26%), Positives = 53/134 (39%), Gaps = 21/134 (15%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F A+HR                 C     HGH+Y + + M G      G V + 
Sbjct: 2   ITRRACFSASHRYWLPELSAADNEARFGACSLAPGHGHNYELIVAMGGP-LDADGMVLNL 60

Query: 53  FNIEQYFSPL-LEKLDHHCLNEI-EELE-------NPTAENIAIWIWKRLSTSLSILSSV 103
            +++         +LD   LNE   E +        PT E + + IW+RL   L  L  +
Sbjct: 61  SDVKHAIREQVTAQLDFRFLNEAWPEFDLQQPSGMLPTTEALTLAIWRRLQPHLP-LMGL 119

Query: 104 RVYETPMSWVEYQG 117
           R+YET   W +  G
Sbjct: 120 RLYETDKLWADVLG 133


>gi|72383311|ref|YP_292666.1| 6-pyruvoyl tetrahydropterin synthase [Prochlorococcus marinus str.
           NATL2A]
 gi|72003161|gb|AAZ58963.1| 6-pyruvoyl-tetrahydropterin synthase-like protein [Prochlorococcus
           marinus str. NATL2A]
          Length = 308

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/130 (30%), Positives = 64/130 (49%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL R             KC     HGH+Y V++ ++G ++P+TG + D 
Sbjct: 156 LTVQTHFSAAHRLAREDLPQTENEKIFGKCARPNGHGHNYLVDITVKGKINPRTGMICDL 215

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSL----SILSSVR 104
             +    +  ++E  DH  LN +I    N   TAENIA+ I  +L+  +    + L  ++
Sbjct: 216 SALNSLINDLVVEPFDHTFLNKDIPYFANCVPTAENIALHISDKLTNPINAIGANLYKIK 275

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 276 LQESPNNAAE 285



 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 43/134 (32%), Positives = 65/134 (48%), Gaps = 21/134 (15%)

Query: 3   ITQAFTFEAAH--RLPRVPKT------HKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F A+H  RLP +           C     HGH+Y + + MEGD   K G V + 
Sbjct: 18  ITRRACFSASHLYRLPELSDDDNSALFGPCSIAPGHGHNYELIVTMEGD-LNKYGMVLNL 76

Query: 53  FNIEQYF-SPLLEKLDHHCLNEI-EELE-------NPTAENIAIWIWKRLSTSLSILSSV 103
            +++    + +  +LD   LN+   E +        PT E++   IW+RL + L  L S+
Sbjct: 77  SDVKHAIKNEVTSQLDFRFLNDTWPEFDLSKPEGCLPTTESLVRIIWERLKSHLP-LKSL 135

Query: 104 RVYETPMSWVEYQG 117
           R+YE P  W +YQG
Sbjct: 136 RLYENPKLWADYQG 149


>gi|320166292|gb|EFW43191.1| 6-pyruvoyl tetrahydropterin synthase [Capsaspora owczarzaki ATCC
           30864]
          Length = 154

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/120 (30%), Positives = 66/120 (55%), Gaps = 17/120 (14%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +++  +F AAHRL               KC+    HGH+Y VE+V+ G++DP+TG V + 
Sbjct: 6   LSRRESFSAAHRLHSPELSDADNVAIFGKCNNPNGHGHNYEVEVVIRGEIDPRTGMVMNL 65

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSILSSVRVYET 108
            ++++     ++E LDH  L+ ++        T EN+A++IW++L   L    + R+YE+
Sbjct: 66  TDLKEIMRQAIMEPLDHKHLDKDVPYFATVPSTTENLAVYIWRQLVPLLP---AGRLYES 122


>gi|254430279|ref|ZP_05043982.1| 6-pyruvoyltetrahydropterin synthase [Cyanobium sp. PCC 7001]
 gi|197624732|gb|EDY37291.1| 6-pyruvoyltetrahydropterin synthase [Cyanobium sp. PCC 7001]
          Length = 339

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/130 (31%), Positives = 66/130 (50%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           ++    F AAHRL R   +         KC R HGH  +Y +++ + G +DP+TG V D 
Sbjct: 189 LSIRTHFAAAHRLARPELSQAQNEAIYGKCARPHGHGHNYLLDVTVRGAIDPRTGMVCDL 248

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSL----SILSSVR 104
             +++     ++E  DH  LN ++E   +   TAENIA+ I   L+  +    + L  VR
Sbjct: 249 AQLQRLVEDLVVEPFDHTFLNKDVEHFAHCVPTAENIALHIADLLAAPIAASGARLHKVR 308

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 309 LQESPNNAAE 318



 Score = 81.4 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 36/131 (27%), Positives = 54/131 (41%), Gaps = 21/131 (16%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+  TF A+HR                 C     HGH+Y + + M G      G V + 
Sbjct: 36  ITRRATFSASHRYWLPELSPEENAARFGPCSIAPGHGHNYELIVAMAGP-LDADGMVLNL 94

Query: 53  FNIEQYFS-PLLEKLDHHCLNEI-EELE-------NPTAENIAIWIWKRLSTSLSILSSV 103
             ++      +  +LD   LNE+  E +        PT E +   IW RL+  L  L+ +
Sbjct: 95  SEVKHAIRSAVTAQLDFRFLNEVWPEFDLSRPEGCLPTTEALGRAIWGRLAPLLP-LAGI 153

Query: 104 RVYETPMSWVE 114
           R+YE    WV+
Sbjct: 154 RLYEQADLWVD 164


>gi|218438484|ref|YP_002376813.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Cyanothece sp. PCC 7424]
 gi|218171212|gb|ACK69945.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Cyanothece sp. PCC 7424]
          Length = 287

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 42/130 (32%), Positives = 65/130 (50%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRL--------PRVPKTHKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL               KC R+HGH  +Y +E+ + G++DP+TG + D 
Sbjct: 138 LTVKTHFSAAHRLALPDLSLEENTEIYGKCARVHGHGHNYHLEVSVTGEIDPRTGMLVDL 197

Query: 53  FNIEQYFSPL-LEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSL----SILSSVR 104
             +E+      +E  DH  LN +I       PTAENIA++I + L   +    + L  V+
Sbjct: 198 GALEKIIDDYVVEPFDHSFLNKDIPYFAQVVPTAENIALYIAQLLQQPVRELGAELDKVK 257

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 258 LIESPNNSCE 267



 Score = 93.7 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 37/129 (28%), Positives = 63/129 (48%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           I +   F A+HR                 C R   HGH+Y + + + G+   + G V++ 
Sbjct: 5   INRRAQFSASHRYWLPELDEVENQRRFGACSRFPGHGHNYVLYVSLYGE-LDQYGMVENL 63

Query: 53  FNIEQYFSPL-LEKLDHHCLNEI-EELEN--PTAENIAIWIWKRLSTSLSILSSVRVYET 108
             +++        +LD+  LNE+  E +   PT EN+A  IW+RL+  L  L +++++E 
Sbjct: 64  SYVKKVIKEEITTQLDYGYLNEVWPEFKQTLPTTENLARVIWQRLAPHLP-LVNIQLFEH 122

Query: 109 PMSWVEYQG 117
           P  W +YQG
Sbjct: 123 PELWADYQG 131


>gi|315919754|ref|ZP_07915994.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. D2]
 gi|313693629|gb|EFS30464.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. D2]
          Length = 128

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/116 (32%), Positives = 56/116 (48%), Gaps = 9/116 (7%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             + +     A+H+L  +P   KC  +HGH++ + +          G V DF  I++   
Sbjct: 12  FTVIKRMEISASHKLV-LPYRSKCASLHGHNWIITVYCRSMRLNSEGMVVDFTRIKEVVM 70

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
              EKLDH  LNE+    NPTAENIA W+ K+L         V V E+  + V Y+
Sbjct: 71  ---EKLDHQNLNEVLPF-NPTAENIARWVCKQL----PQCYKVEVQESEGNIVIYE 118


>gi|308271023|emb|CBX27633.1| hypothetical protein N47_H24550 [uncultured Desulfobacterium sp.]
          Length = 123

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/121 (31%), Positives = 65/121 (53%), Gaps = 8/121 (6%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++     F AAH+L  V    KC  +HGH++++E  + GD     G V DF N++   S
Sbjct: 2   FELKIITNFAAAHQLKLV--AEKCENLHGHNWKIEACVTGDKLNDAGVVIDFGNLKIILS 59

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
            ++ +LDH  LN++E  +  NP++E IA+ I + L   +      +SSV  +E+  +  +
Sbjct: 60  EIIAELDHKFLNDLEWFKGLNPSSETIAVRIAQELENRIDDPAVKVSSVTAWESDDACAK 119

Query: 115 Y 115
           Y
Sbjct: 120 Y 120


>gi|126659751|ref|ZP_01730879.1| hypothetical protein CY0110_23336 [Cyanothece sp. CCY0110]
 gi|126618999|gb|EAZ89740.1| hypothetical protein CY0110_23336 [Cyanothece sp. CCY0110]
          Length = 291

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 43/134 (32%), Positives = 66/134 (49%), Gaps = 19/134 (14%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHR--MHGHSYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL R   +         KC R   HGH+Y +E+ + G++DP TG + D 
Sbjct: 138 LTIQTHFSAAHRLARPDLSLEENTKIYGKCARTHGHGHNYHLEVSVSGEIDPHTGMIVDL 197

Query: 53  FNIEQYFSPL-LEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSI----LSSVR 104
             ++       +E  DH+ LN ++       PTAENIA++I + L   +      L  V+
Sbjct: 198 GELQTIVDDYVVEPFDHNFLNKDVPYFAEVVPTAENIALYIAQLLEQPIQKLGAQLEKVK 257

Query: 105 VYETPMSWVE-YQG 117
           + E+P +  E Y G
Sbjct: 258 LIESPNNSCEIYCG 271



 Score = 94.5 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 40/129 (31%), Positives = 65/129 (50%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           I +   F A+HR                 C R   HGH+Y + + + G++D + G V++ 
Sbjct: 5   INRRAQFSASHRYWLPEWDEAKNKQVFGACSRFPGHGHNYVLFVSLWGEID-QYGMVENL 63

Query: 53  FNIEQYF-SPLLEKLDHHCLNEIEELEN---PTAENIAIWIWKRLSTSLSILSSVRVYET 108
             ++Q     +  +LD+  LN+I E      PT EN+A  IW+RL+  L I+  ++++E 
Sbjct: 64  STVKQVIKQEVTSQLDYSYLNDIWEDFQTTLPTTENLARVIWQRLAPHLPIV-KIQLFEH 122

Query: 109 PMSWVEYQG 117
           P  W EYQG
Sbjct: 123 PQLWAEYQG 131


>gi|240013448|ref|ZP_04720361.1| putative 6-pyruvoyl-tetrahydropterin synthase [Neisseria
           gonorrhoeae DGI18]
 gi|240112237|ref|ZP_04726727.1| putative 6-pyruvoyl-tetrahydropterin synthase [Neisseria
           gonorrhoeae MS11]
 gi|240120519|ref|ZP_04733481.1| putative 6-pyruvoyl-tetrahydropterin synthase [Neisseria
           gonorrhoeae PID24-1]
 gi|240125013|ref|ZP_04737899.1| putative 6-pyruvoyl-tetrahydropterin synthase [Neisseria
           gonorrhoeae SK-92-679]
 gi|260441205|ref|ZP_05795021.1| putative 6-pyruvoyl-tetrahydropterin synthase [Neisseria
           gonorrhoeae DGI2]
 gi|268598295|ref|ZP_06132462.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268683599|ref|ZP_06150461.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|291044539|ref|ZP_06570248.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|268582426|gb|EEZ47102.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268623883|gb|EEZ56283.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|291011433|gb|EFE03429.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
          Length = 140

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/141 (28%), Positives = 68/141 (48%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEG---DVDPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +         K G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSDGTIKGGAKDGMVMDFTDLKA 58

Query: 58  YF-SPLLEKLDHHCL--------NEIEEL------------ENPTAENIAIWIWKRLSTS 96
                + +  DH  +        ++I  L               TAEN+A+ ++ RL  +
Sbjct: 59  IVKQHITDHFDHAFIYHGGNGRESQIAALLEGWNMKTLRLPCRTTAENMAVEMYGRLKNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              +  V+++ETP S  EY+G
Sbjct: 119 GLNVCRVKLWETPTSCAEYEG 139


>gi|222055916|ref|YP_002538278.1| queuosine biosynthesis protein QueD [Geobacter sp. FRC-32]
 gi|221565205|gb|ACM21177.1| queuosine biosynthesis protein QueD [Geobacter sp. FRC-32]
          Length = 122

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/121 (28%), Positives = 62/121 (51%), Gaps = 8/121 (6%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           K+    +F AAH L        C  +HGH+++VE+ +      K+G   DF  ++   + 
Sbjct: 3   KLRIETSFAAAHCLIHYQGD--CENLHGHNWKVEVTVTARELDKSGLGIDFKVLKSETNA 60

Query: 62  LLEKLDHHCLNEIEEL--ENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
           LL+ LDH  LNE+      +P++ENIA ++++ L+   +     L+ V V+E+  +   Y
Sbjct: 61  LLKTLDHKYLNELPPFIESSPSSENIARYLFQELAKKFNSDNIGLTEVTVWESDFASASY 120

Query: 116 Q 116
            
Sbjct: 121 Y 121


>gi|165976519|ref|YP_001652112.1| 6-pyruvoyltetrahydrobiopterin synthase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|307248118|ref|ZP_07530146.1| 6-pyruvoyl tetrahydrobiopterin synthase [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|165876620|gb|ABY69668.1| conserved possible 6-pyruvoyltetrahydrobiopterin synthase
           [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
 gi|306855295|gb|EFM87470.1| 6-pyruvoyl tetrahydrobiopterin synthase [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
          Length = 140

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/139 (23%), Positives = 67/139 (48%), Gaps = 26/139 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPK---TGFVDDFFNIEQ 57
            KI + F+F+ AH L       KC  +HGH+Y++++ + GD+  +      V D+ +++ 
Sbjct: 2   FKIAKEFSFDMAHMLDG--HDGKCQNLHGHTYKLQVEVSGDLVAEGAKRSMVMDYADLKS 59

Query: 58  YF-SPLLEKLDHHCLNEIEE--------------------LENPTAENIAIWIWKRLSTS 96
                +L+ +DH  + ++                          TAE +A +++++L  +
Sbjct: 60  VVKREILDPMDHAYIYDLNSERESQVAKLLVDLNSKVYGIPSRTTAEEMAKYMFEKLEKA 119

Query: 97  LSILSSVRVYETPMSWVEY 115
              +S +R++ETP S+ EY
Sbjct: 120 GLPVSLIRLWETPTSYCEY 138


>gi|167628566|ref|YP_001679065.1| 6-pyruvoyl-tetrahydropterin synthase, putative [Heliobacterium
           modesticaldum Ice1]
 gi|167591306|gb|ABZ83054.1| 6-pyruvoyl-tetrahydropterin synthase, putative [Heliobacterium
           modesticaldum Ice1]
          Length = 130

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 66/123 (53%), Gaps = 10/123 (8%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++     F+AAH L   P    C R+HGH+++VE+ + G      G + DF  +++    
Sbjct: 3   ELIVQTHFDAAHYLRDYPGD--CARVHGHTWQVEVTLVGRQLDDLGMLIDFKEVKKAVKA 60

Query: 62  LLEKLDHHCLNEIEEL--ENPTAENIAIWIWKRLSTSLSI------LSSVRVYETPMSWV 113
           + ++LDH  +NE +     NPTAEN++ + +  L+  L        + +VR++E+P + +
Sbjct: 61  ICDQLDHRMINEHDYFLQRNPTAENLSCYFFHELAGWLKENHPHVRVGTVRIWESPRASI 120

Query: 114 EYQ 116
            Y+
Sbjct: 121 CYR 123


>gi|307153988|ref|YP_003889372.1| 6-pyruvoyl tetrahydropterin synthase/hypothetical protein
           [Cyanothece sp. PCC 7822]
 gi|306984216|gb|ADN16097.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Cyanothece sp. PCC 7822]
          Length = 288

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/130 (31%), Positives = 64/130 (49%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRL--------PRVPKTHKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL               KC R+HGH  +Y +E+ + G++DP+TG + D 
Sbjct: 138 LTVKTHFSAAHRLALPELSLEENSEIYGKCARIHGHGHNYHLEVSVTGEIDPRTGMLVDL 197

Query: 53  FNIEQYFSPL-LEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSL----SILSSVR 104
             +++      +E  DH  LN +I       PTAENIA +I + L   +    + L  V+
Sbjct: 198 GALQKIIDEYVVEPFDHSFLNKDIPYFAQVVPTAENIAFYIAQLLQQPILELGAELDKVK 257

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 258 LIESPNNSCE 267



 Score = 94.5 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 39/129 (30%), Positives = 63/129 (48%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           I +   F A+HR                 C R   HGH+Y + + + G+     G V++ 
Sbjct: 5   INRRAQFSASHRYWLPELTEAENQKLFGLCSRFPGHGHNYVLYVSLYGE-LDHYGMVENL 63

Query: 53  FNIEQYF-SPLLEKLDHHCLNEI-EELEN--PTAENIAIWIWKRLSTSLSILSSVRVYET 108
             +++     +  +LD+  LNE+  E E   PT ENIA  IW+RL+  L  L +++++E 
Sbjct: 64  SYVKRVIKDEITSQLDYAYLNEVWPEFEQTLPTTENIARVIWQRLAPHLP-LVNIQLFEH 122

Query: 109 PMSWVEYQG 117
           P  W +YQG
Sbjct: 123 PELWADYQG 131


>gi|167645048|ref|YP_001682711.1| queuosine biosynthesis protein QueD [Caulobacter sp. K31]
 gi|167347478|gb|ABZ70213.1| queuosine biosynthesis protein QueD [Caulobacter sp. K31]
          Length = 121

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 61/106 (57%), Gaps = 1/106 (0%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT+A TF+AAH + + P  H+  ++HGHS++VE  + G    + G+V D  +++    
Sbjct: 5   FEITKAATFDAAHYIEQGPPDHRYRKLHGHSFKVEASVRG-ALQEAGWVADLDSLDGALK 63

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVY 106
            +  +LDH  LN+   LE+PT E + ++  +RL+     LS V + 
Sbjct: 64  AVAAELDHGLLNDRPGLESPTLERLCLYFAERLTPRFPGLSRVVIS 109


>gi|258405518|ref|YP_003198260.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfohalobium retbaense DSM 5692]
 gi|257797745|gb|ACV68682.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfohalobium retbaense DSM 5692]
          Length = 130

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/122 (36%), Positives = 69/122 (56%), Gaps = 9/122 (7%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEG-DVDPKTGFVDDFFNIEQYFS 60
           ++     F A+H+L       KC R+HGH++RVE  +EG +VDP TG + DF  +++  +
Sbjct: 9   RLRVRGGFSASHQLLHYE--GKCERLHGHNFRVEAEVEGREVDPDTGMLLDFKVLKKRLN 66

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVE 114
            +L+ LDH  LNE+   E  +P++ENIA +I+  L  S++     L  V V E   S   
Sbjct: 67  AVLDYLDHRHLNELTPFEGLSPSSENIARYIFTTLQKSMAEPGVRLREVSVAENEGSVAV 126

Query: 115 YQ 116
           Y+
Sbjct: 127 YR 128


>gi|304405268|ref|ZP_07386928.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Paenibacillus curdlanolyticus YK9]
 gi|304346147|gb|EFM11981.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Paenibacillus curdlanolyticus YK9]
          Length = 122

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/119 (34%), Positives = 63/119 (52%), Gaps = 8/119 (6%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M + + F FEAAH LP V    +C RMHGH Y + + +EG V+   G++ DF  ++    
Sbjct: 3   MVLGRHFEFEAAHFLPDVGTFGRCSRMHGHRYELTVEIEGPVNSD-GWICDFKELKGVVQ 61

Query: 61  PLL-EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVE 114
             + ++ DH  LN+    E  T ENIA  I+  L+ +L      L  +++YET   + E
Sbjct: 62  EQVLDRYDHSNLNDH--FEVSTVENIASQIFSALTHALDGKPYWLKKIKLYETRNCYAE 118


>gi|240127526|ref|ZP_04740187.1| putative 6-pyruvoyl-tetrahydropterin synthase [Neisseria
           gonorrhoeae SK-93-1035]
 gi|268685902|ref|ZP_06152764.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|268626186|gb|EEZ58586.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
          Length = 140

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/141 (28%), Positives = 68/141 (48%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEG---DVDPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +         K G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSDGTIKGGAKDGMVMDFTDLKA 58

Query: 58  YF-SPLLEKLDHHCL--------NEIEEL------------ENPTAENIAIWIWKRLSTS 96
                + +  DH  +        ++I  L               TAEN+A+ ++ RL  +
Sbjct: 59  IVKQHITDHFDHAFIYHGGNGRESQIAALLEGWNMKTLRLPCRTTAENMAVEMYCRLKNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              +  V+++ETP S  EY+G
Sbjct: 119 GLNVCRVKLWETPTSCAEYEG 139


>gi|269798254|ref|YP_003312154.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Veillonella parvula DSM 2008]
 gi|269094883|gb|ACZ24874.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Veillonella parvula DSM 2008]
          Length = 112

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/116 (27%), Positives = 54/116 (46%), Gaps = 7/116 (6%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             +T+     A+H+L ++    KC  +HGH++ + +    +     G V DF  I++   
Sbjct: 2   FTVTKRLEVSASHQL-QLDYPSKCQNLHGHNWIITVHARSEELDHNGMVIDFTIIKEKIH 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
               +LDH  +N++    NPTAEN+A WI   L         V V E+  +   Y+
Sbjct: 61  ---GRLDHRHINDVLGDINPTAENMAKWIADELG---PKCFKVEVQESEGNTAIYE 110


>gi|194097761|ref|YP_002000802.1| putative 6-pyruvoyl-tetrahydropterin synthase [Neisseria
           gonorrhoeae NCCP11945]
 gi|239998264|ref|ZP_04718188.1| putative 6-pyruvoyl-tetrahydropterin synthase [Neisseria
           gonorrhoeae 35/02]
 gi|268594119|ref|ZP_06128286.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|193933051|gb|ACF28875.1| putative 6-pyruvoyl-tetrahydropterin synthase [Neisseria
           gonorrhoeae NCCP11945]
 gi|268547508|gb|EEZ42926.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|317163545|gb|ADV07086.1| putative 6-pyruvoyl-tetrahydropterin synthase [Neisseria
           gonorrhoeae TCDC-NG08107]
          Length = 144

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/141 (28%), Positives = 68/141 (48%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEG---DVDPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +         K G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSDGTIKGGAKDGMVMDFTDLKA 58

Query: 58  YF-SPLLEKLDHHCL--------NEIEEL------------ENPTAENIAIWIWKRLSTS 96
                + +  DH  +        ++I  L               TAEN+A+ ++ RL  +
Sbjct: 59  IVKQHITDHFDHAFIYHGGNGRESQIAALLEGWNMKTLRLPCRTTAENMAVEMYCRLKNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              +  V+++ETP S  EY+G
Sbjct: 119 GLNVCRVKLWETPTSCAEYEG 139


>gi|154490136|ref|ZP_02030397.1| hypothetical protein PARMER_00366 [Parabacteroides merdae ATCC
           43184]
 gi|218259963|ref|ZP_03475459.1| hypothetical protein PRABACTJOHN_01120 [Parabacteroides johnsonii
           DSM 18315]
 gi|154089028|gb|EDN88072.1| hypothetical protein PARMER_00366 [Parabacteroides merdae ATCC
           43184]
 gi|218224824|gb|EEC97474.1| hypothetical protein PRABACTJOHN_01120 [Parabacteroides johnsonii
           DSM 18315]
          Length = 110

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 36/114 (31%), Positives = 53/114 (46%), Gaps = 9/114 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + +     AAH L  +    KC  +HGH++ + +          G V DF +I+Q     
Sbjct: 4   VIKRMEISAAHSL-SLSYPSKCEYLHGHNWIITVHCRSKELNTDGMVIDFTHIKQVVK-- 60

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            ++LDH  LNE+    NPTAENIA WI  +L         V V E+  +   Y+
Sbjct: 61  -DQLDHRNLNEVLPF-NPTAENIARWICDQL----PTCYKVEVQESEGNTAIYE 108


>gi|56750375|ref|YP_171076.1| 6-pyruvoyl-tetrahydropterin synthase-like protein [Synechococcus
           elongatus PCC 6301]
 gi|81299993|ref|YP_400201.1| 6-pyruvoyl-tetrahydropterin synthase-like protein [Synechococcus
           elongatus PCC 7942]
 gi|22002569|gb|AAM82720.1| 6-pyruvoyl-tetrahydropterin synthase-like protein [Synechococcus
           elongatus PCC 7942]
 gi|56685334|dbj|BAD78556.1| 6-pyruvoyl-tetrahydropterin synthase-like protein [Synechococcus
           elongatus PCC 6301]
 gi|81168874|gb|ABB57214.1| 6-pyruvoyl-tetrahydropterin synthase-like protein [Synechococcus
           elongatus PCC 7942]
          Length = 300

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 42/130 (32%), Positives = 64/130 (49%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRL--------PRVPKTHKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL               KC R HGH  +Y +E+ + G++DP+TG + D 
Sbjct: 151 LTIQTHFSAAHRLAKESLSFEENCEIYGKCARPHGHGHNYHLEVTVAGEIDPRTGMLADL 210

Query: 53  FNIEQYFS-PLLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSL----SILSSVR 104
             ++Q     ++E  DH  LN +I       PTAENIA+ I   L+  +    + L  V+
Sbjct: 211 AALQQVVQDKVVEPFDHSFLNKDIPYFAEVVPTAENIAVHIRDLLAEPIRELGARLYKVK 270

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 271 LIESPNNSAE 280



 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 36/129 (27%), Positives = 64/129 (49%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           I +   F A+HR                 C R   HGH+Y + + M G+   + G V + 
Sbjct: 18  INRRALFSASHRYWLPELSDAENQKLFGACARFPGHGHNYVLYVSMLGE-LDEYGMVLNL 76

Query: 53  FNIEQYFS-PLLEKLDHHCLNEI-EELEN--PTAENIAIWIWKRLSTSLSILSSVRVYET 108
            ++++     +  +LD+  LN++  E +   PT EN+A  IW+RL+  L I+  ++++E+
Sbjct: 77  SDVKRVIKSEVTSQLDYAYLNDVWPEFQQGLPTTENLARVIWQRLAPHLPIV-RIQLFES 135

Query: 109 PMSWVEYQG 117
           P  W +Y G
Sbjct: 136 PSLWADYLG 144


>gi|126695460|ref|YP_001090346.1| 6-pyruvoyl tetrahydropterin synthase [Prochlorococcus marinus str.
           MIT 9301]
 gi|126542503|gb|ABO16745.1| 6-pyruvoyl tetrahydropterin synthase [Prochlorococcus marinus str.
           MIT 9301]
          Length = 308

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 44/130 (33%), Positives = 68/130 (52%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRL--------PRVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL               KC R+  HGH+Y V++ ++GD+D +TG V D 
Sbjct: 156 LTVQTHFAAAHRLAKEEISFDENKKIYGKCARVNGHGHNYLVDITVKGDIDKRTGMVCDL 215

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSL----SILSSVR 104
             ++   +  ++E+LDH  LN +IE   N   TAENIA++I   L   +    + L  +R
Sbjct: 216 SALQDTINDLIVEQLDHTFLNKDIEFFHNCVPTAENIALYISDILKKPIHQLGATLHKIR 275

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 276 LQESPNNAAE 285



 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 38/134 (28%), Positives = 60/134 (44%), Gaps = 21/134 (15%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F ++HR           +    KC     HGH+Y + + M G++D   G V + 
Sbjct: 18  ITRRACFSSSHRYWLPEKSPEENLSLFGKCSIAPGHGHNYELIVSMGGELDSD-GMVLNL 76

Query: 53  FNIEQYF-SPLLEKLDHHCLNEIEELEN--------PTAENIAIWIWKRLSTSLSILSSV 103
            +++      +  +LD   LN++    N        PT E +   IW RL   L  L+S+
Sbjct: 77  SDVKHSIKDKVTGQLDFRFLNDVWPEFNVDNQEGILPTTEALVQVIWHRLKDDLP-LTSL 135

Query: 104 RVYETPMSWVEYQG 117
           R+YE P  W +Y G
Sbjct: 136 RLYENPNLWADYFG 149


>gi|93279885|pdb|2G64|A Chain A, Structure Of Caenorhabditis Elegans 6-Pyruvoyl
           Tetrahydropterin Synthase
          Length = 140

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/129 (30%), Positives = 70/129 (54%), Gaps = 16/129 (12%)

Query: 5   QAFTFEAAHRLP--------RVPKTHKCHR--MHGHSYRVELVMEGDVDPKTGFVDDFFN 54
           +  +F AAHRL               KC+    HGH+Y  ++ + G+VDP +G V D   
Sbjct: 11  RVDSFSAAHRLHSEKLSDAENKETFGKCNNSNGHGHNYVWKVKLRGEVDPTSGMVYDLAK 70

Query: 55  IEQYFSPLLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSLSI---LSSVRVYET 108
           +++  S +L+ +DH  L+ ++E  +    T+EN+AI+++++L + +S    L  V + ET
Sbjct: 71  LKKEMSLVLDTVDHRNLDKDVEFFKTTVSTSENVAIYMFEKLKSVMSNPSVLYKVTIEET 130

Query: 109 PMSWVEYQG 117
           P +   Y+G
Sbjct: 131 PKNIFTYKG 139


>gi|218247223|ref|YP_002372594.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Cyanothece sp. PCC 8801]
 gi|257061442|ref|YP_003139330.1| 6-pyruvoyltetrahydropterin synthase [Cyanothece sp. PCC 8802]
 gi|218167701|gb|ACK66438.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Cyanothece sp. PCC 8801]
 gi|256591608|gb|ACV02495.1| 6-pyruvoyltetrahydropterin synthase [Cyanothece sp. PCC 8802]
          Length = 291

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 43/130 (33%), Positives = 66/130 (50%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL               KC R+HGH  +Y +E+ + G++DP+TG + D 
Sbjct: 138 LTIQTHFSAAHRLALPELTLEQNSEIYGKCARIHGHGHNYHLEVSVTGEIDPRTGMLVDL 197

Query: 53  FNIEQYFSPL-LEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSL----SILSSVR 104
             ++Q      +E  DH  LN +I       PTAENIA++I + L T +    + L  V+
Sbjct: 198 GILQQVVKDYVVEPFDHTFLNKDIPYFAQVVPTAENIALYIAQLLQTPIQQLGAELDKVK 257

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 258 LIESPNNSCE 267



 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 37/129 (28%), Positives = 68/129 (52%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRM----------HGHSYRVELVMEGDVDPKTGFVDDF 52
           I +   F A+HR        + +R+          HGH+Y + + + G++D   G V++ 
Sbjct: 5   INRRAQFSASHRYWLSELDEQENRLKFGDCTRFPGHGHNYVLYVSLLGEIDS-YGMVENL 63

Query: 53  FNIEQYFSPL-LEKLDHHCLNEI-EELEN--PTAENIAIWIWKRLSTSLSILSSVRVYET 108
             +++        +LD+  LN++ EE ++  PT EN+A  IW+RL+  L  L +++++E 
Sbjct: 64  STVKRVIKEEITSQLDYCYLNDVWEEFQDSLPTTENLARVIWQRLAPHLP-LVNIQLFEH 122

Query: 109 PMSWVEYQG 117
           P  W +YQG
Sbjct: 123 PQLWADYQG 131


>gi|303250157|ref|ZP_07336359.1| hypothetical protein APP6_1573 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|302651220|gb|EFL81374.1| hypothetical protein APP6_1573 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
          Length = 157

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 33/139 (23%), Positives = 66/139 (47%), Gaps = 26/139 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPK---TGFVDDFFNIEQ 57
            KI + F+F+ AH L       KC  +HGH+Y++++ + GD+  +      V D+ +++ 
Sbjct: 19  FKIAKEFSFDMAHMLDG--HDGKCQNLHGHTYKLQVEVSGDLVAEGAKRSMVMDYADLKS 76

Query: 58  YF-SPLLEKLDHHCLNEIEE--------------------LENPTAENIAIWIWKRLSTS 96
                +L+ +DH  + ++                          TAE +A +++++L   
Sbjct: 77  VVKHEILDPMDHAYIYDLNSERESQVAKLLVDLNSKVYGIPSRTTAEEMAKYMFEKLEKV 136

Query: 97  LSILSSVRVYETPMSWVEY 115
              +S +R++ETP S+ EY
Sbjct: 137 GLPVSLIRLWETPTSYCEY 155


>gi|88807137|ref|ZP_01122649.1| 6-pyruvoyltetrahydropterin synthase [Synechococcus sp. WH 7805]
 gi|88788351|gb|EAR19506.1| 6-pyruvoyltetrahydropterin synthase [Synechococcus sp. WH 7805]
          Length = 306

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 44/130 (33%), Positives = 65/130 (50%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL R   +         KC R HGH  +Y V++ + G +DP+TG V D 
Sbjct: 156 LTIRTHFAAAHRLARPELSQEENERIYGKCARPHGHGHNYLVDVTVRGAIDPRTGMVCDL 215

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSL----SILSSVR 104
             +++     ++E  DH  LN ++        TAENIA+ I  RLS  +    + L  VR
Sbjct: 216 SALQRLVDDLVVEPFDHTFLNKDVPFFAECVPTAENIALHIADRLSGPVGAIGAQLHKVR 275

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 276 LQESPNNAAE 285



 Score = 81.4 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 34/134 (25%), Positives = 57/134 (42%), Gaps = 21/134 (15%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F A+HR                 C     HGH+Y + + M GD     G V + 
Sbjct: 18  ITRRACFSASHRYWLPELSADDNAARFGACALAPGHGHNYELIVSMAGD-LDADGMVLNL 76

Query: 53  FNIEQYFS-PLLEKLDHHCLNEIEELEN--------PTAENIAIWIWKRLSTSLSILSSV 103
             ++      + ++L+   LN+     +        PT E +   IW+RL+  L  ++++
Sbjct: 77  SEVKHAIRKEVTDQLNFRFLNDAWSDFDVSRPEGCLPTTEALVHRIWQRLAPHLP-ITAL 135

Query: 104 RVYETPMSWVEYQG 117
           R+YE P  W +Y G
Sbjct: 136 RLYEQPGLWADYLG 149


>gi|327480921|gb|AEA84231.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Pseudomonas
           stutzeri DSM 4166]
          Length = 77

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/76 (51%), Positives = 52/76 (68%)

Query: 42  VDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILS 101
           +DP TG++ DF  ++  F PL E+LDH+ LN+I  LENPT+EN+A WIW  L   L  LS
Sbjct: 1   MDPHTGWIRDFGELKSIFKPLYERLDHNYLNDIPGLENPTSENLAKWIWNELKPLLPELS 60

Query: 102 SVRVYETPMSWVEYQG 117
            VR++ET  S  EY+G
Sbjct: 61  RVRIHETCTSGCEYRG 76


>gi|294647053|ref|ZP_06724665.1| conserved hypothetical protein [Bacteroides ovatus SD CC 2a]
 gi|294807239|ref|ZP_06766053.1| conserved hypothetical protein [Bacteroides xylanisolvens SD CC 1b]
 gi|292637599|gb|EFF56005.1| conserved hypothetical protein [Bacteroides ovatus SD CC 2a]
 gi|294445537|gb|EFG14190.1| conserved hypothetical protein [Bacteroides xylanisolvens SD CC 1b]
          Length = 128

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 57/116 (49%), Gaps = 9/116 (7%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             + +     A+H+L  +P   KC  +HGH++ + +          G V DF  I++  +
Sbjct: 12  FTVIKRMEISASHKLV-LPYRSKCASLHGHNWIITVYCRSARLNSEGMVVDFTRIKEVVT 70

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
              EKLDH  LNE+    NPTAENIA W+ K++         V V E+  + V Y+
Sbjct: 71  ---EKLDHQNLNEVLPF-NPTAENIARWVCKQI----PQCYKVEVQESEGNIVIYE 118


>gi|39996819|ref|NP_952770.1| 6-pyruvoyl tetrahydrobiopterin synthase family protein [Geobacter
           sulfurreducens PCA]
 gi|39983707|gb|AAR35097.1| 6-pyruvoyl tetrahydrobiopterin synthase family protein [Geobacter
           sulfurreducens PCA]
 gi|298505828|gb|ADI84551.1| 6-carboxy-5,6,7,8-tetrahydropterin synthase [Geobacter
           sulfurreducens KN400]
          Length = 122

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 38/121 (31%), Positives = 64/121 (52%), Gaps = 8/121 (6%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++T   +F AAH L        C  +HGH++RVE+ +      K G   DF  ++Q  + 
Sbjct: 3   RLTIHTSFAAAHCLINYQGD--CENLHGHNWRVEVSVTARELDKAGLGIDFKVLKQETNG 60

Query: 62  LLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
           LL  LDH  LNE+E  +  +P++ENI+ +++  LS  L+     + S+ V+E+  +   Y
Sbjct: 61  LLRTLDHKYLNELEPFKEISPSSENISRYLYHELSRRLNDGNVTVESITVWESDNAAATY 120

Query: 116 Q 116
            
Sbjct: 121 Y 121


>gi|115532226|ref|NP_001040627.1| Pyruvoyl TetrahydrobioPterin Synthase family member (ptps-1)
           [Caenorhabditis elegans]
 gi|85662596|gb|ABC71844.1| Pyruvoyl tetrahydrobiopterin synthase protein 1, isoform b,
           confirmed by transcript evidence [Caenorhabditis
           elegans]
          Length = 137

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/129 (30%), Positives = 70/129 (54%), Gaps = 16/129 (12%)

Query: 5   QAFTFEAAHRLP--------RVPKTHKCHR--MHGHSYRVELVMEGDVDPKTGFVDDFFN 54
           +  +F AAHRL               KC+    HGH+Y  ++ + G+VDP +G V D   
Sbjct: 8   RVDSFSAAHRLHSEKLSDAENKETFGKCNNSNGHGHNYVWKVKLRGEVDPTSGMVYDLAK 67

Query: 55  IEQYFSPLLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSLSI---LSSVRVYET 108
           +++  S +L+ +DH  L+ ++E  +    T+EN+AI+++++L + +S    L  V + ET
Sbjct: 68  LKKEMSLVLDTVDHRNLDKDVEFFKTTVSTSENVAIYMFEKLKSVMSNPSVLYKVTIEET 127

Query: 109 PMSWVEYQG 117
           P +   Y+G
Sbjct: 128 PKNIFTYKG 136


>gi|307261577|ref|ZP_07543245.1| 6-pyruvoyl tetrahydrobiopterin synthase [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306868700|gb|EFN00509.1| 6-pyruvoyl tetrahydrobiopterin synthase [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 140

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 33/139 (23%), Positives = 67/139 (48%), Gaps = 26/139 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPK---TGFVDDFFNIEQ 57
            KI + F+F+ AH L       KC  +HGH+Y++++ + GD+  +      V D+ +++ 
Sbjct: 2   FKIAKEFSFDMAHMLDG--HDGKCQNLHGHTYKLQVEVRGDLVAEGAKRSMVMDYADLKS 59

Query: 58  YF-SPLLEKLDHHCLNEIEE--------------------LENPTAENIAIWIWKRLSTS 96
                +L+ +DH  + ++                          TAE +A +++++L  +
Sbjct: 60  VVKREILDPMDHAYIYDLNSERESQVAKLLVDLNSKVYGIPSRTTAEEMAKYMFEKLEKA 119

Query: 97  LSILSSVRVYETPMSWVEY 115
              +S +R++ETP S+ EY
Sbjct: 120 GLPVSLIRLWETPTSYCEY 138


>gi|289523464|ref|ZP_06440318.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
 gi|289503156|gb|EFD24320.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
          Length = 132

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 43/117 (36%), Positives = 68/117 (58%), Gaps = 10/117 (8%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + + F+F+AAH LP      KC R+HGH+Y+  + +EG  D + G V DF  ++      
Sbjct: 4   LKREFSFDAAHYLPDY--HGKCERLHGHTYKAAIFVEGSPDEE-GMVMDFVELKGLVEER 60

Query: 63  L-EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
           +  KLDH CLN++  ++ P+AE IA+WIW  +   ++     L  V+V+E+P S V 
Sbjct: 61  ILSKLDHSCLNDV--IKRPSAEYIALWIWGEMEPHINAGKRRLKYVQVWESPGSSVI 115


>gi|225849889|ref|YP_002730123.1| 6-pyruvoyl tetrahydrobiopterin synthase [Persephonella marina
           EX-H1]
 gi|225645559|gb|ACO03745.1| 6-pyruvoyl tetrahydrobiopterin synthase [Persephonella marina
           EX-H1]
          Length = 114

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 36/116 (31%), Positives = 59/116 (50%), Gaps = 5/116 (4%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             I     F+AAH L       K   +HGH++ VE+ +  D   K G   DF  I+++  
Sbjct: 3   FIIRVKREFQAAHFLTDY--HGKPEPLHGHTWLVEIFIRADKLDKGGMGYDFIEIQRFLD 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            ++   D+ CLN+I +  +P+AEN+A W+++++      L  V V+ET     EY 
Sbjct: 61  QIIP--DYKCLNDIFDF-SPSAENLAKWLYEKIKERYPTLQKVVVWETKEGGAEYF 113


>gi|224475852|ref|YP_002633458.1| putative 6-pyruvoyltetrahydropterin synthase [Staphylococcus
           carnosus subsp. carnosus TM300]
 gi|222420459|emb|CAL27273.1| putative 6-pyruvoyltetrahydropterin synthase [Staphylococcus
           carnosus subsp. carnosus TM300]
          Length = 141

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 38/125 (30%), Positives = 65/125 (52%), Gaps = 12/125 (9%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ + F F AAH +P      KC R HGH+Y V L + G+    +GF+ +F  +++   
Sbjct: 15  FELNKDFHFAAAHYIP-CEDAGKCVRTHGHTYFVNLTIVGNELDHSGFLINFAYLKKQIH 73

Query: 61  PLLEKLDHHCLNEIEELEN--PTAENIAIWIWKRLSTSL------SILSSVRVYETPMSW 112
              E+ DH+ LN++ + ++  P+ E +A  I+K     L         + V + ETP S+
Sbjct: 74  ---EQFDHYLLNDLPQFKDKMPSTEIVAQTIYKMTEEILEKQPNHPKCAQVYLRETPSSY 130

Query: 113 VEYQG 117
           V Y+G
Sbjct: 131 VVYKG 135


>gi|33151751|ref|NP_873104.1| 6-pyruvoyl tetrahydrobiopterin synthase [Haemophilus ducreyi
           35000HP]
 gi|33147972|gb|AAP95493.1| conserved possible 6-pyruvoyl tetrahydrobiopterin synthase
           [Haemophilus ducreyi 35000HP]
          Length = 140

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 37/139 (26%), Positives = 71/139 (51%), Gaps = 26/139 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGD---VDPKTGFVDDFFNIEQ 57
            KI + F+F+ AH L       KC  +HGH+Y++++ + G+      K G V D+ +++ 
Sbjct: 2   FKIAKEFSFDMAHMLDG--HDGKCQNLHGHTYKLQVEVSGELVSNGAKRGMVMDYSDLKS 59

Query: 58  YF-SPLLEKLDHHCLNEIE------------ELEN--------PTAENIAIWIWKRLSTS 96
                +L+ +DH  + ++             EL++         TAE IA +++++L+  
Sbjct: 60  IVKREILDLMDHAYIYDLNNERESQVAQLLLELDSKVYGIPSRTTAEQIAKYMFEKLAQV 119

Query: 97  LSILSSVRVYETPMSWVEY 115
              +S +R++ETP S+ EY
Sbjct: 120 GLPVSLIRLWETPTSYCEY 138


>gi|295087025|emb|CBK68548.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides xylanisolvens
           XB1A]
          Length = 128

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 57/116 (49%), Gaps = 9/116 (7%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             + +     A+H+L  +P   KC  +HGH++ + +          G V DF  I++  +
Sbjct: 12  FTVIKRMEISASHKLV-LPYRSKCASLHGHNWIITVYCRSARLNSEGMVVDFTRIKEVVT 70

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
              EKLDH  LNE+    NPTAENIA W+ K++         V V E+  + V Y+
Sbjct: 71  ---EKLDHQNLNEVLPF-NPTAENIARWVCKQI----PQCYKVEVQESEGNIVIYE 118


>gi|238018972|ref|ZP_04599398.1| hypothetical protein VEIDISOL_00832 [Veillonella dispar ATCC 17748]
 gi|282850492|ref|ZP_06259871.1| queuosine biosynthesis protein QueD [Veillonella parvula ATCC
           17745]
 gi|294792115|ref|ZP_06757263.1| queuosine biosynthesis protein QueD [Veillonella sp. 6_1_27]
 gi|237864456|gb|EEP65746.1| hypothetical protein VEIDISOL_00832 [Veillonella dispar ATCC 17748]
 gi|282579985|gb|EFB85389.1| queuosine biosynthesis protein QueD [Veillonella parvula ATCC
           17745]
 gi|294457345|gb|EFG25707.1| queuosine biosynthesis protein QueD [Veillonella sp. 6_1_27]
          Length = 112

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/116 (27%), Positives = 54/116 (46%), Gaps = 7/116 (6%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             +T+     A+H+L ++    KC  +HGH++ + +    +     G V DF  I++   
Sbjct: 2   FTVTKRLEVSASHQL-KLDYPSKCQNLHGHNWIITVHARSEELDHNGMVIDFTIIKEKIH 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
               +LDH  +N++    NPTAEN+A WI   L         V V E+  +   Y+
Sbjct: 61  ---GRLDHRHINDVLGDINPTAENMAKWIADELG---PKCFKVEVQESEGNTAIYE 110


>gi|114797313|ref|YP_759263.1| putative 6-pyruvoyl tetrahydropterin synthase [Hyphomonas neptunium
           ATCC 15444]
 gi|114737487|gb|ABI75612.1| putative 6-pyruvoyl tetrahydropterin synthase [Hyphomonas neptunium
           ATCC 15444]
          Length = 146

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 57/105 (54%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +I++A  FEAAH +   P+ H    +HGHS+R+E  + G V P   +V+DF ++     
Sbjct: 26  FEISKAVFFEAAHFMGGKPEGHPYRSVHGHSFRLEATVAGIVKPGEQWVEDFSHLTATLE 85

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRV 105
               KLDH  LN+IE LE PT E I +W    L   L  L+ V V
Sbjct: 86  ATAAKLDHRLLNDIEGLEVPTLERICLWAAADLGQPLPGLARVAV 130


>gi|307728084|ref|YP_003905308.1| hypothetical protein BC1003_0008 [Burkholderia sp. CCGE1003]
 gi|307582619|gb|ADN56017.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Burkholderia sp. CCGE1003]
          Length = 121

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 56/107 (52%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +++Q F FEAAH L R        R+HGH+Y  ++ + G  DP T  V D   + +    
Sbjct: 4   ELSQKFYFEAAHTLHREIDAEGSRRIHGHTYHAQVFVRGTPDPMTKMVIDLGFLCREIER 63

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYET 108
           + E LDH  L+EI  L   T E++  +I   LS S+  +S VRV  T
Sbjct: 64  VRELLDHRFLDEISTLGPATLESLCTFILDELSKSIPAISRVRVERT 110


>gi|33860666|ref|NP_892227.1| 6-pyruvoyl tetrahydropterin synthase [Prochlorococcus marinus
           subsp. pastoris str. CCMP1986]
 gi|33633608|emb|CAE18565.1| 6-pyruvoyl tetrahydropterin synthase [Prochlorococcus marinus
           subsp. pastoris str. CCMP1986]
          Length = 308

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/130 (30%), Positives = 64/130 (49%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRL--------PRVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL               KC R+  HGH+Y +++ + G +DP+TG + D 
Sbjct: 156 LTIQSHFNAAHRLAKDEISLDENKKIYGKCARVNGHGHNYFLDVTVRGKIDPRTGMICDL 215

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSLSI----LSSVR 104
            +++      ++E  DH  LN +IE  +    T ENIA+ I   LS+ +      L  V+
Sbjct: 216 PSLQAIIDDLIVEPFDHTFLNKDIEYFKTCVPTCENIALHIADILSSPIKKIGANLHKVK 275

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 276 LQESPNNAAE 285



 Score = 94.5 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 38/134 (28%), Positives = 59/134 (44%), Gaps = 21/134 (15%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F ++HR                KC     HGH+Y + + M G +D   G V + 
Sbjct: 18  ITRRACFSSSHRYWLPEKSSEDNFSLFGKCSIAPGHGHNYELIVSMGGKLDSD-GMVLNL 76

Query: 53  FNIEQYFS-PLLEKLDHHCLNEIEELEN--------PTAENIAIWIWKRLSTSLSILSSV 103
            +++      +  +LD   LN++    N        PT E +   IW RL   L  L+S+
Sbjct: 77  SDVKHSIKSKVTGQLDFRFLNDVWPEFNIHSQEGILPTTEALVKVIWNRLKDELP-LTSL 135

Query: 104 RVYETPMSWVEYQG 117
           R+YE+P  W +Y G
Sbjct: 136 RIYESPTLWADYYG 149


>gi|308173344|ref|YP_003920049.1| 6-pyruvoyltetrahydropterin synthase [Bacillus amyloliquefaciens DSM
           7]
 gi|307606208|emb|CBI42579.1| 6-pyruvoyltetrahydropterin synthase [Bacillus amyloliquefaciens DSM
           7]
 gi|328553729|gb|AEB24221.1| 6-pyruvoyltetrahydropterin synthase [Bacillus amyloliquefaciens
           TA208]
 gi|328911422|gb|AEB63018.1| 6-pyruvoyltetrahydropterin synthase [Bacillus amyloliquefaciens
           LL3]
          Length = 146

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 34/128 (26%), Positives = 60/128 (46%), Gaps = 16/128 (12%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ +     AAH +PR      C R+HGH+Y V + + GD    +GF+ +F  +++   
Sbjct: 15  FELNKDMHISAAHFIPR-ESAGACSRVHGHTYTVNITVAGDELDDSGFLVNFSVLKKLVH 73

Query: 61  PLLEKLDHHCLNEIEELEN------PTAENIAIWIWKRLSTSLSILS------SVRVYET 108
                 DH  +N+ +E  +      PT E +A  I+ ++ + L  L        + V ET
Sbjct: 74  ---GAYDHTLMNDHDEFSDDDRYSLPTTEVVAKTIYDKVQSYLETLENQPVCVQIFVRET 130

Query: 109 PMSWVEYQ 116
           P S+  Y+
Sbjct: 131 PTSYCVYR 138


>gi|299148831|ref|ZP_07041893.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. 3_1_23]
 gi|298513592|gb|EFI37479.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. 3_1_23]
          Length = 128

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 57/116 (49%), Gaps = 9/116 (7%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             + +     A+H+L  +P   KC  +HGH++ + +          G V DF  I++  +
Sbjct: 12  FTVIKRMEISASHKLV-LPYRSKCASLHGHNWIITVYCRSARLNSEGMVVDFTRIKEVVT 70

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
              EKLDH  LNE+    NPTAENIA W+ K++         V V E+  + V Y+
Sbjct: 71  ---EKLDHQNLNEVLPF-NPTAENIARWVCKQI----PQCYKVEVQESEGNIVIYE 118


>gi|115532224|ref|NP_001040626.1| Pyruvoyl TetrahydrobioPterin Synthase family member (ptps-1)
           [Caenorhabditis elegans]
 gi|52001088|sp|O02058|PTPS_CAEEL RecName: Full=Putative 6-pyruvoyl tetrahydrobiopterin synthase;
           Short=PTP synthase; Short=PTPS
 gi|31746695|gb|AAC24255.2| Pyruvoyl tetrahydrobiopterin synthase protein 1, isoform a,
           confirmed by transcript evidence [Caenorhabditis
           elegans]
          Length = 140

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/129 (30%), Positives = 70/129 (54%), Gaps = 16/129 (12%)

Query: 5   QAFTFEAAHRLP--------RVPKTHKCHR--MHGHSYRVELVMEGDVDPKTGFVDDFFN 54
           +  +F AAHRL               KC+    HGH+Y  ++ + G+VDP +G V D   
Sbjct: 11  RVDSFSAAHRLHSEKLSDAENKETFGKCNNSNGHGHNYVWKVKLRGEVDPTSGMVYDLAK 70

Query: 55  IEQYFSPLLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSLSI---LSSVRVYET 108
           +++  S +L+ +DH  L+ ++E  +    T+EN+AI+++++L + +S    L  V + ET
Sbjct: 71  LKKEMSLVLDTVDHRNLDKDVEFFKTTVSTSENVAIYMFEKLKSVMSNPSVLYKVTIEET 130

Query: 109 PMSWVEYQG 117
           P +   Y+G
Sbjct: 131 PKNIFTYKG 139


>gi|157412462|ref|YP_001483328.1| 6-pyruvoyl tetrahydropterin synthase [Prochlorococcus marinus str.
           MIT 9215]
 gi|157387037|gb|ABV49742.1| 6-pyruvoyl tetrahydropterin synthase [Prochlorococcus marinus str.
           MIT 9215]
          Length = 308

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/130 (30%), Positives = 66/130 (50%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRL--------PRVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL               KC R+  HGH+Y +++ + G ++P+TG + D 
Sbjct: 156 LTVQSHFNAAHRLAKDEISLSENKKIYGKCARINGHGHNYFLDVTVRGQINPRTGMICDL 215

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSL----SILSSVR 104
            +++      ++E+ DH  LN +IE  +    T ENIA+ I   LS+ +    + L  +R
Sbjct: 216 PSLQSIIDDLIVEQFDHTFLNKDIEYFKTCVPTCENIALHISDILSSPIKNIGANLHKIR 275

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 276 LQESPNNAAE 285



 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 38/134 (28%), Positives = 62/134 (46%), Gaps = 21/134 (15%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHR--MHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F ++HR           +    KC     HGH+Y + + M G++D   G V + 
Sbjct: 18  ITRRACFSSSHRYWLPEKSPEENLSLFGKCSFAPGHGHNYELIVSMGGELDSD-GMVLNL 76

Query: 53  FNIEQYF-SPLLEKLDHHCLNEIEELEN--------PTAENIAIWIWKRLSTSLSILSSV 103
            +++    + +  +LD   LN++    N        PT E +   IW RL   L  L+S+
Sbjct: 77  SDVKHSIKNEVTGQLDFRFLNDVWPEFNIYSQDGILPTTEALVKVIWNRLKDDLP-LTSL 135

Query: 104 RVYETPMSWVEYQG 117
           R+YE+P  W +Y G
Sbjct: 136 RLYESPTLWADYFG 149


>gi|260174976|ref|ZP_05761388.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. D2]
 gi|315923211|ref|ZP_07919451.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|313697086|gb|EFS33921.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 110

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 34/114 (29%), Positives = 54/114 (47%), Gaps = 9/114 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + +     A+H L ++    KC  +HGH++ + +        + G V DF +I+Q     
Sbjct: 4   VKKRIEISASHSL-KLSYESKCQNLHGHNWIIIVWCRAKTLNQDGMVVDFTHIKQKIQ-- 60

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            +KLDH  LNEI    N TAEN+A WI  ++         V V E+  +   Y+
Sbjct: 61  -DKLDHKNLNEILPF-NTTAENMAKWICDQI----PGCFKVMVQESENNIAWYE 108


>gi|295688232|ref|YP_003591925.1| fused 6-pyruvoyl tetrahydropterin synthase/hypothetical protein
           [Caulobacter segnis ATCC 21756]
 gi|295430135|gb|ADG09307.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Caulobacter segnis ATCC 21756]
          Length = 121

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 61/106 (57%), Gaps = 1/106 (0%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +IT+A  F+AAH + + P  H+  ++HGHS++VE  ++G++ P  G+V D  +++    
Sbjct: 5   FEITKAAYFDAAHYIEQGPADHRYRKLHGHSFKVEASVKGEMAPA-GWVADLDSLDAALK 63

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVY 106
            +  +LDH  LN+   LE PT E + ++  +RL      LS V + 
Sbjct: 64  AVAAELDHGLLNDKPGLETPTLERLCLYFAERLKVQFPGLSRVELS 109


>gi|296445572|ref|ZP_06887528.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Methylosinus trichosporium OB3b]
 gi|296256977|gb|EFH04048.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Methylosinus trichosporium OB3b]
          Length = 125

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 38/119 (31%), Positives = 58/119 (48%), Gaps = 3/119 (2%)

Query: 1   MKITQAFTFEAAHRL--PRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQY 58
            ++ + F FEAAH L  P  P       +HGHS+RV + + G       +V D   + + 
Sbjct: 5   FEVYREFCFEAAHALCDPEHPTGGIYRNLHGHSFRVRVTLRGPRVEGEDWVMDLGKLGRR 64

Query: 59  FSPLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYE-TPMSWVEYQ 116
            + L E LDH  LNE++ L  PT EN+ ++IW+ L   L  +  V V+  T       +
Sbjct: 65  LALLRETLDHSFLNELDGLGKPTLENLCVFIWRDLEADLPAIFEVGVFRDTCNEGCVLR 123


>gi|254493042|ref|ZP_05106213.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|226512082|gb|EEH61427.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
          Length = 140

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 40/141 (28%), Positives = 68/141 (48%), Gaps = 26/141 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEG---DVDPKTGFVDDFFNIEQ 57
           MKIT+ FTF+++H L       KC  +HGH+Y++E+ +         K G V DF +++ 
Sbjct: 1   MKITKIFTFDSSHMLDG--HDGKCQNLHGHTYKLEITVSDGTIKGGAKDGMVMDFTDLKA 58

Query: 58  YF-SPLLEKLDHHCL--------NEIEEL------------ENPTAENIAIWIWKRLSTS 96
                + +  DH  +        ++I  L               TAEN+A+ ++ RL  +
Sbjct: 59  IVKQHITDHFDHAFIYHGGNGRESQIAALLEGWNMKTLRLPCRTTAENMAVEMYCRLKNA 118

Query: 97  LSILSSVRVYETPMSWVEYQG 117
              +  V+++ETP S  EY+G
Sbjct: 119 GLNVCRVKLWETPTSCAEYEG 139


>gi|42780533|ref|NP_977780.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Bacillus cereus
           ATCC 10987]
 gi|42736453|gb|AAS40388.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Bacillus cereus
           ATCC 10987]
          Length = 163

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 40/126 (31%), Positives = 69/126 (54%), Gaps = 15/126 (11%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQ-YFSP 61
           +++ FTF+AAH L       KC  +HGH+Y+V   + G    + G   DF +I++ + + 
Sbjct: 34  VSKEFTFDAAHHLHCYE--GKCKNLHGHTYKVVFGISG-YVNEIGLAIDFGDIKEIWKNE 90

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSS-----------VRVYETPM 110
           +   LDH  LNE     N TAEN+ +WI+++++ +L+  +            VR++ETP 
Sbjct: 91  IEIYLDHRYLNETLPAMNTTAENMVVWIYEKMAEALTKDNRANEYKGARVEFVRLFETPT 150

Query: 111 SWVEYQ 116
           S+ E +
Sbjct: 151 SYAEVR 156


>gi|284038327|ref|YP_003388257.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Spirosoma linguale DSM 74]
 gi|283817620|gb|ADB39458.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Spirosoma linguale DSM 74]
          Length = 138

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 40/134 (29%), Positives = 63/134 (47%), Gaps = 19/134 (14%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           I +   F AAHRL                C  +  HGH++ + + ++G+ DP TGFV D 
Sbjct: 4   INRIEHFNAAHRLYNPAWSEERNKEVFGPCANINWHGHNFELIVTVKGEPDPNTGFVIDL 63

Query: 53  FNIEQYF-SPLLEKLDHHCLNEIEELEN---PTAENIAIWIWKRLSTSL-----SILSSV 103
             +       ++EK+DH  LN   +       + E   + IWK L  +L     + L  +
Sbjct: 64  KVLGDIIRREVIEKVDHKNLNLDVDFMQGKMASCEIFIMEIWKILERALEPVTDAHLHQL 123

Query: 104 RVYETPMSWVEYQG 117
           R+YETP ++V+Y G
Sbjct: 124 RLYETPKNFVDYFG 137


>gi|239906004|ref|YP_002952743.1| 6-pyruvoyl tetrahydropterin synthase family protein [Desulfovibrio
           magneticus RS-1]
 gi|239795868|dbj|BAH74857.1| 6-pyruvoyl tetrahydropterin synthase family protein [Desulfovibrio
           magneticus RS-1]
          Length = 130

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 39/121 (32%), Positives = 64/121 (52%), Gaps = 9/121 (7%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDV-DPKTGFVDDFFNIEQYFS 60
           ++T +  F A+H L        C  +HGH++ VE V+EG+  DPK  ++ DF  +     
Sbjct: 9   RLTVSEGFCASHCLRGYE--GPCENLHGHNFGVEAVVEGERLDPKVEYLVDFKVLRGRLR 66

Query: 61  PLLEKLDHHCLNEIEEL--ENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
            +L  LDH  LN++     ENP++EN+A +++++L  +L+     L  V V E   S   
Sbjct: 67  EILAGLDHRHLNDLPAFSLENPSSENLARFVYRQLEAALAGQPVRLVCVSVSEKDSSKAT 126

Query: 115 Y 115
           Y
Sbjct: 127 Y 127


>gi|325291196|ref|YP_004267377.1| queuosine biosynthesis protein QueD [Syntrophobotulus glycolicus
           DSM 8271]
 gi|324966597|gb|ADY57376.1| queuosine biosynthesis protein QueD [Syntrophobotulus glycolicus
           DSM 8271]
          Length = 128

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 44/118 (37%), Positives = 68/118 (57%), Gaps = 9/118 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPK-----TGFVDDFFNIEQ 57
           I + FTF+AAHRL        C  +HGH+Y++++ + G V  +      G V DF  ++Q
Sbjct: 6   IVKEFTFDAAHRLEGY--QGLCQNLHGHTYKLQVGIYGPVKNEAGAADDGMVWDFVKLKQ 63

Query: 58  YFSPL-LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVE 114
                 ++KLDH  +NE+     PT+ENIA+W+ K L  +   +  +R+YETP S+VE
Sbjct: 64  AIKEKIIDKLDHQYINELVSFR-PTSENIALWMMKTLLAANIPVKFIRLYETPTSYVE 120


>gi|110637366|ref|YP_677573.1| 6-pyruvoyl tetrahydrobiopterin synthase [Cytophaga hutchinsonii
           ATCC 33406]
 gi|110280047|gb|ABG58233.1| 6-pyruvoyl tetrahydrobiopterin synthase [Cytophaga hutchinsonii
           ATCC 33406]
          Length = 135

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 44/129 (34%), Positives = 65/129 (50%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           I +   F AAHRL               KC+    HGH+Y + + + G++DP TG+V D 
Sbjct: 5   IFRKEHFNAAHRLFNASWSDEKNDAVFGKCNNPNFHGHNYELIVKLTGEIDPITGYVFDT 64

Query: 53  FNIEQYFSPLL-EKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSL--SILSSVRVY 106
             +       +  + DH  LN + EE +  NPTAENIA  I+  L + +  S+   V +Y
Sbjct: 65  KELSNLIKQHILTRYDHKNLNLDCEEFKDVNPTAENIAKQIYTTLRSLIDASLDLKVILY 124

Query: 107 ETPMSWVEY 115
           ET  ++VEY
Sbjct: 125 ETERNFVEY 133


>gi|113953090|ref|YP_731745.1| 6-pyruvoyl-tetrahydropterin synthase-like protein [Synechococcus
           sp. CC9311]
 gi|113880441|gb|ABI45399.1| 6-pyruvoyl-tetrahydropterin synthase homolog [Synechococcus sp.
           CC9311]
          Length = 306

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 45/130 (34%), Positives = 68/130 (52%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL R   +         KC R HGH  +Y V++ + G +DP+TG V D 
Sbjct: 156 LTIRTHFAAAHRLARPELSQEENELIYGKCARPHGHGHNYLVDVTVRGSIDPRTGMVCDL 215

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSL----SILSSVR 104
             +++  S  ++E  DH  LN ++    +   TAENIA+ I  RL+T +    + L  VR
Sbjct: 216 AALQRLVSDLVVEPFDHTFLNKDVAHFADCVPTAENIALHIVDRLTTPVRAIGAQLHKVR 275

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 276 LQESPNNAAE 285



 Score = 82.5 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 36/134 (26%), Positives = 55/134 (41%), Gaps = 21/134 (15%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F ++HR                 C     HGH+Y + + M G      G V + 
Sbjct: 18  ITRRACFSSSHRYWLPELSADDNAARFGSCAMAPGHGHNYELIVSMAG-GLDANGMVLNL 76

Query: 53  FNIEQYFS-PLLEKLDHHCLNEI-EELEN-------PTAENIAIWIWKRLSTSLSILSSV 103
             ++      + E+LD   LNE   E +        PT E +   IW RL+  L  L ++
Sbjct: 77  SEVKHAIRSEVTEQLDFRFLNEAWPEFDVSSSEGCLPTTEALVRIIWSRLANQLP-LVAL 135

Query: 104 RVYETPMSWVEYQG 117
           R+YE+   W +Y G
Sbjct: 136 RLYESSGLWADYLG 149


>gi|332703527|ref|ZP_08423615.1| queuosine biosynthesis protein QueD [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332553676|gb|EGJ50720.1| queuosine biosynthesis protein QueD [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 131

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 62/122 (50%), Gaps = 9/122 (7%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDV-DPKTGFVDDFFNIEQYFS 60
           ++T    F A+H+L       KC  +HGH++ VE+ +EGD  D +TG + DF  ++    
Sbjct: 7   RLTVREEFSASHQLRHY--QGKCEALHGHNFGVEVSIEGDRTDERTGMLLDFKVLKDITR 64

Query: 61  PLLEKLDHHCLNEIEEL--ENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
             +  LDH  LN++E    ENP++E++A ++++ +   L      L  V V E       
Sbjct: 65  ECVGLLDHKHLNDLEAFAGENPSSEHLARFLFREIEGRLGGYAVSLVEVTVAEKSSQSAT 124

Query: 115 YQ 116
           Y 
Sbjct: 125 YF 126


>gi|261405278|ref|YP_003241519.1| hypothetical protein GYMC10_1426 [Paenibacillus sp. Y412MC10]
 gi|261281741|gb|ACX63712.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Paenibacillus sp. Y412MC10]
          Length = 163

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 65/125 (52%), Gaps = 14/125 (11%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y+V   + G    + G   DF +I+  +   
Sbjct: 35  VSKEFTFDAAHHLHCYE--GKCKNLHGHTYKVVFGISGTP-NEVGITVDFGDIKDCWKTS 91

Query: 63  LEKL-DHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSS----------VRVYETPMS 111
           +E   DH  LNE     N TAEN+ +W+++++  +L    S          VR++ETP S
Sbjct: 92  IEPYLDHRYLNETLPQMNTTAENMVVWLFEKMEEALRSRESYEEQGMRTEFVRLFETPTS 151

Query: 112 WVEYQ 116
           + E +
Sbjct: 152 YAEVR 156


>gi|312890753|ref|ZP_07750285.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Mucilaginibacter paludis DSM 18603]
 gi|311296767|gb|EFQ73904.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Mucilaginibacter paludis DSM 18603]
          Length = 138

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 39/136 (28%), Positives = 67/136 (49%), Gaps = 19/136 (13%)

Query: 1   MKITQAFTFEAAHRLPRVPK--------THKCHR--MHGHSYRVELVMEGDVDPKTGFVD 50
           + IT+   F AAHR+ R             KC     HGH+Y + + ++G+V   TG++ 
Sbjct: 2   IYITRKEHFNAAHRMYREEWSAEKNEEMFGKCANPNWHGHNYNLFVTVKGEVTHATGYLM 61

Query: 51  DFFNIEQYFSPL-LEKLDHHCLN-EIEELENPTA--ENIAIWIWKRLSTSLSI-----LS 101
           D  +++   +   +EKLDH  +N ++  ++   A  E + I I+ +L   +       L 
Sbjct: 62  DLKDLKVIINDCVIEKLDHKNINLDVPFMKGKMASTELLCIEIFNQLKAPIEAYQGVFLH 121

Query: 102 SVRVYETPMSWVEYQG 117
           SV++YET  +  EY G
Sbjct: 122 SVKLYETENNSAEYFG 137


>gi|78222866|ref|YP_384613.1| putative 6-pyruvoyl tetrahydropterin synthase [Geobacter
           metallireducens GS-15]
 gi|78194121|gb|ABB31888.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Geobacter metallireducens GS-15]
          Length = 122

 Score = 97.9 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 34/115 (29%), Positives = 60/115 (52%), Gaps = 8/115 (6%)

Query: 8   TFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLD 67
           +F AAH L        C  +HGH+++VE+ +      K G   DF  ++Q  + +L  LD
Sbjct: 9   SFAAAHCLINYQGD--CENLHGHNWKVEVTVTARELDKAGLGIDFKILKQETNAILRTLD 66

Query: 68  HHCLNEIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEYQ 116
           H  LNE+      +P++ENI+ ++++ LS  L+     + S+ V+E+  +   Y 
Sbjct: 67  HKYLNELTPFREISPSSENISRFLYEELSKRLNDGNVKVESITVWESDNAAATYY 121


>gi|264679997|ref|YP_003279906.1| 6-pyruvoyl tetrahydropterin synthase and [Comamonas testosteroni
           CNB-2]
 gi|299531399|ref|ZP_07044807.1| putative 6-pyruvoyl tetrahydropterin synthase [Comamonas
           testosteroni S44]
 gi|262210512|gb|ACY34610.1| 6-pyruvoyl tetrahydropterin synthase and [Comamonas testosteroni
           CNB-2]
 gi|298720562|gb|EFI61511.1| putative 6-pyruvoyl tetrahydropterin synthase [Comamonas
           testosteroni S44]
          Length = 121

 Score = 97.9 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 37/106 (34%), Positives = 57/106 (53%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             + Q F F+AAH L R  +T    R+HGH+Y  E+ + G  +P  G V D  ++     
Sbjct: 3   FTVHQRFFFDAAHTLERAIETESSRRIHGHTYWAEVSVRGPRNPDNGMVIDLGHLRARLE 62

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVY 106
            L ++LDHH L+E+  L  PT EN+ ++I   L+      S +RV+
Sbjct: 63  LLRDQLDHHFLDEVPGLGKPTLENLCLFIANALADLEPAPSRIRVW 108


>gi|87125218|ref|ZP_01081064.1| 6-pyruvoyltetrahydropterin synthase [Synechococcus sp. RS9917]
 gi|86166987|gb|EAQ68248.1| 6-pyruvoyltetrahydropterin synthase [Synechococcus sp. RS9917]
          Length = 308

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 44/130 (33%), Positives = 64/130 (49%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL R   +         KC R HGH  +Y VE+ + G +DP+TG V D 
Sbjct: 158 LTLRTHFAAAHRLARPELSQEENERIYGKCARPHGHGHNYLVEVTVRGSIDPRTGMVCDL 217

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSL----SILSSVR 104
             ++      ++E  DH  LN ++        TAENIA+ I  RL+  +    + L  VR
Sbjct: 218 AALQSLLDDLVVEPFDHTFLNKDVPHFSTCVPTAENIALHIADRLAAPVQAIGAHLHKVR 277

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 278 LQESPNNAAE 287



 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 39/134 (29%), Positives = 55/134 (41%), Gaps = 21/134 (15%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKC--HRMHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F A+HR                 C     HGH+Y + + M G      G V + 
Sbjct: 20  ITRRACFSASHRYWLPELDADDNAARFGPCTLAPGHGHNYELIVSMAGP-LDADGMVLNL 78

Query: 53  FNIEQYFS-PLLEKLDHHCLNEI-EELEN-------PTAENIAIWIWKRLSTSLSILSSV 103
             ++      + E LD   LNE   E +        PT E +   IW RLS  L  L ++
Sbjct: 79  SEVKHAIRSEVTEALDFRFLNEAWPEFDVTRPEGCLPTTEALVRVIWHRLSAHLP-LVAL 137

Query: 104 RVYETPMSWVEYQG 117
           R+YE+P  W +Y G
Sbjct: 138 RLYESPGLWADYLG 151


>gi|30261441|ref|NP_843818.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Bacillus
           anthracis str. Ames]
 gi|47526630|ref|YP_017979.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus anthracis str.
           'Ames Ancestor']
 gi|47566229|ref|ZP_00237257.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Bacillus cereus
           G9241]
 gi|49184275|ref|YP_027527.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus anthracis str.
           Sterne]
 gi|49477193|ref|YP_035566.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|65318710|ref|ZP_00391669.1| COG0720: 6-pyruvoyl-tetrahydropterin synthase [Bacillus anthracis
           str. A2012]
 gi|165870428|ref|ZP_02215083.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus
           anthracis str. A0488]
 gi|167634411|ref|ZP_02392732.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus
           anthracis str. A0442]
 gi|167639243|ref|ZP_02397515.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus
           anthracis str. A0193]
 gi|170686876|ref|ZP_02878096.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus
           anthracis str. A0465]
 gi|170706346|ref|ZP_02896807.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus
           anthracis str. A0389]
 gi|177651516|ref|ZP_02934305.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus
           anthracis str. A0174]
 gi|190568103|ref|ZP_03021013.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus
           anthracis Tsiankovskii-I]
 gi|196035364|ref|ZP_03102769.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus
           W]
 gi|196040702|ref|ZP_03108001.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus
           NVH0597-99]
 gi|196046545|ref|ZP_03113770.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus
           03BB108]
 gi|218902548|ref|YP_002450382.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus
           AH820]
 gi|225863304|ref|YP_002748682.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus
           03BB102]
 gi|227815812|ref|YP_002815821.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus
           anthracis str. CDC 684]
 gi|228932723|ref|ZP_04095595.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228945039|ref|ZP_04107400.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228984516|ref|ZP_04144693.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|229016690|ref|ZP_04173623.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus AH1273]
 gi|229022902|ref|ZP_04179422.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus AH1272]
 gi|229155008|ref|ZP_04283122.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus ATCC 4342]
 gi|229603059|ref|YP_002865854.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus
           anthracis str. A0248]
 gi|254682496|ref|ZP_05146357.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus
           anthracis str. CNEVA-9066]
 gi|254726159|ref|ZP_05187941.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus
           anthracis str. A1055]
 gi|254733912|ref|ZP_05191626.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus
           anthracis str. Western North America USA6153]
 gi|254740398|ref|ZP_05198089.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus
           anthracis str. Kruger B]
 gi|254753788|ref|ZP_05205823.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus
           anthracis str. Vollum]
 gi|254758885|ref|ZP_05210912.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus
           anthracis str. Australia 94]
 gi|301052980|ref|YP_003791191.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus anthracis CI]
 gi|30255295|gb|AAP25304.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus
           anthracis str. Ames]
 gi|47501778|gb|AAT30454.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus
           anthracis str. 'Ames Ancestor']
 gi|47556782|gb|EAL15113.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Bacillus cereus
           G9241]
 gi|49178202|gb|AAT53578.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Bacillus
           anthracis str. Sterne]
 gi|49328749|gb|AAT59395.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|164713923|gb|EDR19445.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus
           anthracis str. A0488]
 gi|167512682|gb|EDR88056.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus
           anthracis str. A0193]
 gi|167530299|gb|EDR93025.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus
           anthracis str. A0442]
 gi|170128880|gb|EDS97746.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus
           anthracis str. A0389]
 gi|170669399|gb|EDT20142.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus
           anthracis str. A0465]
 gi|172082794|gb|EDT67857.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus
           anthracis str. A0174]
 gi|190560837|gb|EDV14812.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus
           anthracis Tsiankovskii-I]
 gi|195992041|gb|EDX56004.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus
           W]
 gi|196022729|gb|EDX61411.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus
           03BB108]
 gi|196028492|gb|EDX67100.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus
           NVH0597-99]
 gi|218537218|gb|ACK89616.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus
           AH820]
 gi|225787198|gb|ACO27415.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus
           03BB102]
 gi|227002402|gb|ACP12145.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus
           anthracis str. CDC 684]
 gi|228628566|gb|EEK85279.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus ATCC 4342]
 gi|228738437|gb|EEL88913.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus AH1272]
 gi|228744598|gb|EEL94667.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus AH1273]
 gi|228775219|gb|EEM23608.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|228814708|gb|EEM60968.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228826928|gb|EEM72690.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|229267467|gb|ACQ49104.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus
           anthracis str. A0248]
 gi|300375149|gb|ADK04053.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus biovar
           anthracis str. CI]
          Length = 163

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 40/126 (31%), Positives = 69/126 (54%), Gaps = 15/126 (11%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQ-YFSP 61
           +++ FTF+AAH L       KC  +HGH+Y+V   + G    + G   DF +I++ + + 
Sbjct: 34  VSKEFTFDAAHHLHCYE--GKCKNLHGHTYKVVFGISG-YVNEIGLAIDFGDIKEIWKNE 90

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSS-----------VRVYETPM 110
           +   LDH  LNE     N TAEN+ +WI+++++ +L+  +            VR++ETP 
Sbjct: 91  IEIYLDHRYLNETLPAMNTTAENMVVWIYEKMAEALTKDNRANEYKGARVEFVRLFETPT 150

Query: 111 SWVEYQ 116
           S+ E +
Sbjct: 151 SYAEVR 156


>gi|319945215|ref|ZP_08019477.1| queuosine biosynthesis protein QueD [Lautropia mirabilis ATCC
           51599]
 gi|319741785|gb|EFV94210.1| queuosine biosynthesis protein QueD [Lautropia mirabilis ATCC
           51599]
          Length = 140

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 41/140 (29%), Positives = 71/140 (50%), Gaps = 26/140 (18%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVD---PKTGFVDDFFNIEQY 58
           KI + F+F+ AH L       KC  +HGH+YR+++ + G +    PK G V D+ +++  
Sbjct: 3   KIAKEFSFDIAHMLDG--HDGKCRNLHGHTYRLQVEVGGPLHASGPKAGMVMDYADLKDI 60

Query: 59  F-SPLLEKLDHHCLNE------------IEELEN--------PTAENIAIWIWKRLSTSL 97
               +++ +DH  L +            ++EL++         TAENI+  I+  L    
Sbjct: 61  VKRHVVDPMDHAFLYDTGSPRECRVATLLQELDSKVHGLPMRTTAENISAHIFHVLQDQG 120

Query: 98  SILSSVRVYETPMSWVEYQG 117
             +S +R++ETP S+ EY G
Sbjct: 121 LPVSLIRLWETPTSYCEYSG 140


>gi|325105592|ref|YP_004275246.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Pedobacter saltans DSM 12145]
 gi|324974440|gb|ADY53424.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Pedobacter saltans DSM 12145]
          Length = 137

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 38/135 (28%), Positives = 70/135 (51%), Gaps = 18/135 (13%)

Query: 1   MKITQAFTFEAAHRLPRVPK--------THKCHR--MHGHSYRVELVMEGDVDPKTGFVD 50
           + IT+   F AAH+L R              C     HGH+Y + + ++G+++ +TGFV 
Sbjct: 2   IYITRKEHFNAAHKLYREDWSKEKNEEVFGICANANWHGHNYDLYVTVKGEINEETGFVI 61

Query: 51  DFFNIEQ-YFSPLLEKLDHHCLNEIEEL---ENPTAENIAIWIWKRL----STSLSILSS 102
           D  +++    + +++K+DH  LN   +    +  + E +A+  WK+L        + L S
Sbjct: 62  DLKDLKDIIITHVIDKVDHRNLNLDVDFMRGKMASTEILAVEFWKQLDGPIKERGAQLHS 121

Query: 103 VRVYETPMSWVEYQG 117
           +++YET  ++VEY G
Sbjct: 122 IKLYETVNNYVEYFG 136


>gi|229090394|ref|ZP_04221637.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus Rock3-42]
 gi|228692977|gb|EEL46695.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus Rock3-42]
          Length = 163

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 40/126 (31%), Positives = 69/126 (54%), Gaps = 15/126 (11%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQ-YFSP 61
           +++ FTF+AAH L       KC  +HGH+Y+V   + G    + G   DF +I++ + + 
Sbjct: 34  VSKEFTFDAAHHLHCYE--GKCKNLHGHTYKVVFGISG-YVNEIGLAIDFGDIKEIWKNE 90

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSS-----------VRVYETPM 110
           +   LDH  LNE     N TAEN+ +WI+++++ +L+  +            VR++ETP 
Sbjct: 91  IEIYLDHRYLNETLPAMNTTAENMVVWIYEKMAEALTKDNRANEYKGARVEFVRLFETPT 150

Query: 111 SWVEYQ 116
           S+ E +
Sbjct: 151 SYAEVR 156


>gi|297568916|ref|YP_003690260.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfurivibrio alkaliphilus AHT2]
 gi|296924831|gb|ADH85641.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfurivibrio alkaliphilus AHT2]
          Length = 123

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 38/120 (31%), Positives = 59/120 (49%), Gaps = 8/120 (6%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++     F + H L   P    C + HGH+++V+++M  D   + G   DF +++     
Sbjct: 3   EVFTTTHFSSGHHLRNYP--GNCEKPHGHNWKVKVIMRADELDELGMALDFRDLKAALKV 60

Query: 62  LLEKLDHHCLNEIEEL--ENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEY 115
           +++ LDH  LNE      ENP++ENIA +I+  L  SLS        V V ET    V Y
Sbjct: 61  IIDDLDHRDLNEHPAFQQENPSSENIARYIFAELKKSLSSDRYRPHKVTVLETDACGVSY 120


>gi|118602337|ref|YP_903552.1| putative 6-pyruvoyl tetrahydropterin synthase [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
 gi|118567276|gb|ABL02081.1| preQ(0) biosynthesis protein QueD [Candidatus Ruthia magnifica str.
           Cm (Calyptogena magnifica)]
          Length = 125

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 36/114 (31%), Positives = 59/114 (51%), Gaps = 8/114 (7%)

Query: 9   FEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDH 68
           F +AH L   P    C R+HGH+++VE+++        G   DF  I++    +++ LDH
Sbjct: 10  FASAHLLRDYPGD--CSRLHGHNWKVEMMVVARKLNSNGITIDFREIKKQTKVVVKLLDH 67

Query: 69  HCLNEIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEYQ 116
             LNEI   +  NPTAENIA + +  +   ++     +  V ++ET  + V Y 
Sbjct: 68  QYLNEIAPFDKLNPTAENIAKYFFYEVGQLINTNDVKVKEVTIWETSRASVTYY 121


>gi|229172080|ref|ZP_04299645.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus MM3]
 gi|228611423|gb|EEK68680.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus MM3]
          Length = 163

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 40/126 (31%), Positives = 68/126 (53%), Gaps = 15/126 (11%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQ-YFSP 61
           +++ FTF+AAH L       KC  +HGH+Y+V   + G    + G   DF +I++ + + 
Sbjct: 34  VSKEFTFDAAHHLHCYE--GKCKNLHGHTYKVVFGISG-YVNEIGLAIDFGDIKEIWKNE 90

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSS-----------VRVYETPM 110
           +   LDH  LNE     N TAEN+ +WI+++++ +L   +            VR++ETP 
Sbjct: 91  IEIYLDHRYLNETLPAMNTTAENMVVWIYEKMAEALLKDNRANEYKGARVEFVRLFETPT 150

Query: 111 SWVEYQ 116
           S+ E +
Sbjct: 151 SYAEVR 156


>gi|94969237|ref|YP_591285.1| 6-pyruvoyl tetrahydropterin synthase [Candidatus Koribacter
           versatilis Ellin345]
 gi|94551287|gb|ABF41211.1| 6-pyruvoyl tetrahydropterin synthase [Candidatus Koribacter
           versatilis Ellin345]
          Length = 137

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 47/131 (35%), Positives = 70/131 (53%), Gaps = 16/131 (12%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCHR--MHGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+   F A+H                 KC+    HGH+Y +E+ ++G VD  TGFV D 
Sbjct: 5   LTRKSEFSASHHYHNPDFTAEENLRVFGKCNNSNGHGHNYTLEVTVKGTVDATTGFVVDL 64

Query: 53  FNIEQYFS-PLLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSL--SILSSVRVY 106
             +++  +  +++ +DH  LN E+ E ++  PT ENIAI IWKRL   L  + L  VR+Y
Sbjct: 65  KQLKEIMNREVVDAMDHRYLNHEVPEFKSQIPTTENIAIAIWKRLEGKLHVAKLHRVRLY 124

Query: 107 ETPMSWVEYQG 117
           E    WV+Y G
Sbjct: 125 EMHDLWVDYLG 135


>gi|206977565|ref|ZP_03238459.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus
           H3081.97]
 gi|217958917|ref|YP_002337465.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus
           AH187]
 gi|222095074|ref|YP_002529134.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus Q1]
 gi|229100294|ref|ZP_04231180.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus Rock3-29]
 gi|229102040|ref|ZP_04232753.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus Rock3-28]
 gi|229114879|ref|ZP_04244292.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus Rock1-3]
 gi|229138127|ref|ZP_04266725.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus BDRD-ST26]
 gi|229160393|ref|ZP_04288391.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus R309803]
 gi|229195637|ref|ZP_04322403.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus m1293]
 gi|206744283|gb|EDZ55696.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus
           H3081.97]
 gi|217066272|gb|ACJ80522.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus
           AH187]
 gi|221239132|gb|ACM11842.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus Q1]
 gi|228587886|gb|EEK45938.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus m1293]
 gi|228623117|gb|EEK79945.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus R309803]
 gi|228645472|gb|EEL01706.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus BDRD-ST26]
 gi|228668571|gb|EEL24000.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus Rock1-3]
 gi|228681427|gb|EEL35591.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus Rock3-28]
 gi|228683124|gb|EEL37116.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus Rock3-29]
 gi|324325458|gb|ADY20718.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 163

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 40/126 (31%), Positives = 69/126 (54%), Gaps = 15/126 (11%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQ-YFSP 61
           +++ FTF+AAH L       KC  +HGH+Y+V   + G    + G   DF +I++ + + 
Sbjct: 34  VSKEFTFDAAHHLHCYE--GKCKNLHGHTYKVVFGISG-YVNEIGLAIDFGDIKEIWKNE 90

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSS-----------VRVYETPM 110
           +   LDH  LNE     N TAEN+ +WI+++++ +L+  +            VR++ETP 
Sbjct: 91  IEIYLDHRYLNETLPAMNTTAENMVVWIYEKMAEALTKDNRVNEYKGARVEFVRLFETPT 150

Query: 111 SWVEYQ 116
           S+ E +
Sbjct: 151 SYAEVR 156


>gi|52143997|ref|YP_082832.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus E33L]
 gi|228914012|ref|ZP_04077634.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|228926471|ref|ZP_04089543.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|229120980|ref|ZP_04250222.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus 95/8201]
 gi|229183634|ref|ZP_04310857.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus BGSC 6E1]
 gi|51977466|gb|AAU19016.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus E33L]
 gi|228599877|gb|EEK57474.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus BGSC 6E1]
 gi|228662640|gb|EEL18238.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus 95/8201]
 gi|228833295|gb|EEM78860.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228845617|gb|EEM90646.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
          Length = 163

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 40/126 (31%), Positives = 69/126 (54%), Gaps = 15/126 (11%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQ-YFSP 61
           +++ FTF+AAH L       KC  +HGH+Y+V   + G    + G   DF +I++ + + 
Sbjct: 34  VSKEFTFDAAHHLHCYE--GKCKNLHGHTYKVVFGISG-YVNEIGLAIDFGDIKEIWKNE 90

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSS-----------VRVYETPM 110
           +   LDH  LNE     N TAEN+ +WI+++++ +L+  +            VR++ETP 
Sbjct: 91  IEIYLDHRYLNETLPAMNTTAENMVVWIYEKMAEALTKDNRANEYKGARVEFVRLFETPT 150

Query: 111 SWVEYQ 116
           S+ E +
Sbjct: 151 SYAEVR 156


>gi|220905874|ref|YP_002481185.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Cyanothece sp. PCC 7425]
 gi|219862485|gb|ACL42824.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Cyanothece sp. PCC 7425]
          Length = 294

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 41/130 (31%), Positives = 65/130 (50%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           ++ +  F AAHRL R   +         KC R HGH  +Y +E+ ++G++DP+TG + D 
Sbjct: 138 LSVSTHFSAAHRLARPDLSYEENCQIYGKCARPHGHGHNYHLEVTVKGEIDPRTGMIVDL 197

Query: 53  FNI-EQYFSPLLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSL----SILSSVR 104
             + +     + E  DH  LN +I       PTAENIA+ I   L   +    + L  V+
Sbjct: 198 VALEKAIDDHVTEPFDHTFLNKDIPYFAEVVPTAENIAVHIRDLLQQPIRDLGAKLHRVK 257

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 258 LIESPNNSCE 267



 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 35/129 (27%), Positives = 61/129 (47%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           I +   F A+HR                 C R   HGH+Y + + M G+   + G V + 
Sbjct: 5   INRRDEFSASHRYWIPEWSEAKNLHCFGACTRFPGHGHNYVLYVSMIGE-LDEYGMVLNL 63

Query: 53  FNIEQYF-SPLLEKLDHHCLNEI-EELEN--PTAENIAIWIWKRLSTSLSILSSVRVYET 108
             ++      + ++L+   LN++  E +   PT EN+A  IW+RL+  L  L  ++++E 
Sbjct: 64  SEVKHTIRREVTQQLNFSYLNDVWPEFQQTLPTTENLARVIWQRLAPHLP-LVRIQLFEH 122

Query: 109 PMSWVEYQG 117
           P  W +Y+G
Sbjct: 123 PRLWADYEG 131


>gi|148240548|ref|YP_001225935.1| 6-pyruvoyl-tetrahydropterin synthase [Synechococcus sp. WH 7803]
 gi|147849087|emb|CAK24638.1| 6-pyruvoyl-tetrahydropterin synthase [Synechococcus sp. WH 7803]
          Length = 306

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 44/130 (33%), Positives = 65/130 (50%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL R   +         KC R HGH  +Y V++ + G +DP+TG V D 
Sbjct: 156 LTIRTHFAAAHRLARPELSQEENERIYGKCARPHGHGHNYLVDVTVRGAIDPRTGMVCDL 215

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSL----SILSSVR 104
             +++     ++E  DH  LN ++        TAENIA+ I  RLS  +    + L  VR
Sbjct: 216 SALQRLVDDLVVEPFDHTFLNKDVPFFAECVPTAENIALHIADRLSGPVGAIGAHLHKVR 275

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 276 LQESPNNAAE 285



 Score = 79.8 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 34/134 (25%), Positives = 56/134 (41%), Gaps = 21/134 (15%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F A+HR                 C     HGH+Y + + M G      G V + 
Sbjct: 18  ITRRACFSASHRYWLPELSADDNAARFGACALAPGHGHNYELIVSMAG-GLDADGMVLNL 76

Query: 53  FNIEQYFS-PLLEKLDHHCLNEIEELEN--------PTAENIAIWIWKRLSTSLSILSSV 103
             ++      + ++L+   LN+     +        PT E +   IW+RLS  L  ++++
Sbjct: 77  SEVKHAIRKEVTDQLNFRFLNDAWSDFDVSKPDGCLPTTEALVHRIWQRLSPHLP-ITAL 135

Query: 104 RVYETPMSWVEYQG 117
           R+YE P  W +Y G
Sbjct: 136 RLYEQPGLWADYLG 149


>gi|228990441|ref|ZP_04150406.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus pseudomycoides
           DSM 12442]
 gi|228996542|ref|ZP_04156181.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus mycoides
           Rock3-17]
 gi|229004192|ref|ZP_04161993.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus mycoides Rock1-4]
 gi|228757053|gb|EEM06297.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus mycoides Rock1-4]
 gi|228763174|gb|EEM12082.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus mycoides
           Rock3-17]
 gi|228768967|gb|EEM17565.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus pseudomycoides
           DSM 12442]
          Length = 164

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 40/126 (31%), Positives = 69/126 (54%), Gaps = 15/126 (11%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQ-YFSP 61
           +++ FTF+AAH L       KC  +HGH+Y+V   + G    + G   DF +I++ + + 
Sbjct: 35  VSKEFTFDAAHHLHCYE--GKCKNLHGHTYKVVFGISG-YVNEIGLAIDFGDIKEIWKNE 91

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSL-----------SILSSVRVYETPM 110
           +   LDH  LNE     N TAEN+ +WI+++++ +L           + +  VR++ETP 
Sbjct: 92  IEIYLDHRYLNETLPAMNTTAENMVVWIYEKMAEALTKEDRANEYKGARVEFVRLFETPT 151

Query: 111 SWVEYQ 116
           S+ E +
Sbjct: 152 SYAEVR 157


>gi|311746201|ref|ZP_07719986.1| 6-pyruvoyl tetrahydrobiopterin synthase [Algoriphagus sp. PR1]
 gi|126576429|gb|EAZ80707.1| 6-pyruvoyl tetrahydrobiopterin synthase [Algoriphagus sp. PR1]
          Length = 139

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 35/137 (25%), Positives = 65/137 (47%), Gaps = 20/137 (14%)

Query: 1   MKITQAFTFEAAHRLPRVPK--------THKCHRM--HGHSYRVELVMEGDVDPKTGFVD 50
           + + +   F AAH+L                C  +  HGH++ + ++++G  DP+TGFV 
Sbjct: 2   IYVCRKEHFNAAHKLWNPKWSEEKNVEVFGPCANVNWHGHNFELIVMVKGTPDPETGFVV 61

Query: 51  DFFNIEQYFSP-LLEKLDHHCLNEIEEL---ENPTAENIAIWIWKRLSTSLSI------L 100
           D   +       +++++DH  LN   +    +  + EN+ +  WK L  ++        L
Sbjct: 62  DLKKLSTTIRTLVIDRVDHKNLNVDVDFMEGKLASCENLVMEFWKILEPAVRELTHHGGL 121

Query: 101 SSVRVYETPMSWVEYQG 117
             + +YETP ++VEY G
Sbjct: 122 HKLTLYETPRNFVEYFG 138


>gi|154685783|ref|YP_001420944.1| YkvK [Bacillus amyloliquefaciens FZB42]
 gi|154351634|gb|ABS73713.1| YkvK [Bacillus amyloliquefaciens FZB42]
          Length = 147

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 35/129 (27%), Positives = 59/129 (45%), Gaps = 17/129 (13%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ +     AAH +PR      C R+HGH+Y V + + GD    +GF+ +F  +++   
Sbjct: 15  FELNKDMHISAAHFIPR-ESAGACSRVHGHTYTVNITVAGDELDDSGFLVNFSVLKKLVH 73

Query: 61  PLLEKLDHHCLNEIEEL-------ENPTAENIAIWIWKRLSTSLSILS------SVRVYE 107
                 DH  LN+ +E          PT E +A  I+ ++ + L  L        + V E
Sbjct: 74  ---GAYDHTLLNDHDEFSADDDRYSLPTTEVVAKTIYDKVQSYLETLENQPVCVQIFVRE 130

Query: 108 TPMSWVEYQ 116
           TP S+  Y+
Sbjct: 131 TPTSYCVYR 139


>gi|87301780|ref|ZP_01084614.1| 6-pyruvoyl-tetrahydropterin synthase-like protein [Synechococcus
           sp. WH 5701]
 gi|87283348|gb|EAQ75303.1| 6-pyruvoyl-tetrahydropterin synthase-like protein [Synechococcus
           sp. WH 5701]
          Length = 328

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 40/130 (30%), Positives = 64/130 (49%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           ++    F AAHRL R   +         KC R HGH  +Y +++ + G +DP++G V D 
Sbjct: 178 LSIRTHFSAAHRLAREELSQGENEAIYGKCARPHGHGHNYLLDVTVRGAIDPRSGMVCDL 237

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSL----SILSSVR 104
             ++   +  ++E  DH  LN ++        TAENIA+ I   LS  +    + L  VR
Sbjct: 238 GELQGLVNELVVEPFDHTFLNKDVAHFATCVPTAENIALHIADLLSAPIAATGAALHKVR 297

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 298 LQESPNNAAE 307



 Score = 81.0 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 58/131 (44%), Gaps = 21/131 (16%)

Query: 3   ITQAFTFEAAH--RLPRVPK------THKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F A+H  RLP +          +C     HGH+Y + + M G +D   G V + 
Sbjct: 40  ITRRALFSASHLYRLPELSDAENASRFGRCSLAPGHGHNYELIVAMAGPLDGD-GMVLNL 98

Query: 53  FNIEQYF-SPLLEKLDHHCLNEI-EELE-------NPTAENIAIWIWKRLSTSLSILSSV 103
            +++      + + LD   LN+   E +        PT E +   IW RL+  L  L  +
Sbjct: 99  SDVKHAIRREVTDPLDFRFLNDCWPEFDLSRPEGRLPTTEALTQAIWTRLAPHLP-LVGL 157

Query: 104 RVYETPMSWVE 114
           R+YE P  W +
Sbjct: 158 RLYEQPTLWAD 168


>gi|229029112|ref|ZP_04185210.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus AH1271]
 gi|228732210|gb|EEL83094.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus AH1271]
          Length = 163

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 40/126 (31%), Positives = 69/126 (54%), Gaps = 15/126 (11%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQ-YFSP 61
           +++ FTF+AAH L       KC  +HGH+Y+V   + G    + G   DF +I++ + + 
Sbjct: 34  VSKEFTFDAAHHLHCYE--GKCKNLHGHTYKVVFGISG-YVNEIGLAIDFGDIKEIWKNE 90

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSL-----------SILSSVRVYETPM 110
           +   LDH  LNE     N TAEN+ +WI+++++ +L           + +  VR++ETP 
Sbjct: 91  IEIYLDHRYLNETLPAMNTTAENMVVWIYEKMAEALIKDNRANEYKGARVEFVRLFETPT 150

Query: 111 SWVEYQ 116
           S+ E +
Sbjct: 151 SYAEVR 156


>gi|194014742|ref|ZP_03053359.1| 6-pyruvoyltetrahydropterin synthase [Bacillus pumilus ATCC 7061]
 gi|194013768|gb|EDW23333.1| 6-pyruvoyltetrahydropterin synthase [Bacillus pumilus ATCC 7061]
          Length = 146

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 16/128 (12%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ +     AAH +PR      C R+HGH+Y + + + GD   ++GF+ +F  +++   
Sbjct: 15  FELNKDMHISAAHFIPR-EDAGACSRVHGHTYTINITIAGDDLDESGFLVNFSTLKKLIH 73

Query: 61  PLLEKLDHHCLNEIEELEN------PTAENIAIWIWKRLSTSLSIL------SSVRVYET 108
               + DH  LN+ EE  +      PT E +A  +  +++  LS L        V V ET
Sbjct: 74  ---GQYDHTLLNDHEEFSSTDPYAMPTTEVVAKTVHDKVAAYLSTLANKPVCVQVFVRET 130

Query: 109 PMSWVEYQ 116
           P S+  Y+
Sbjct: 131 PTSYCIYR 138


>gi|83596052|gb|ABC25410.1| 6-pyruvoyl-tetrahydropterin synthase [uncultured marine bacterium
           Ant39E11]
          Length = 137

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 34/135 (25%), Positives = 64/135 (47%), Gaps = 18/135 (13%)

Query: 1   MKITQAFTFEAAHRLPRVPK--------THKCHRM--HGHSYRVELVMEGDVDPKTGFVD 50
           + I +   F AAHRL                C     HGH++++ + ++G+V+  TGFV 
Sbjct: 2   IYIQRRAIFSAAHRLANPSWSDEKNQAVFGHCANEYSHGHNFQLIVTVKGEVNTDTGFVM 61

Query: 51  DFFNIEQYFS-PLLEKLDHHCLNEIEELEN---PTAENIAIWIWKRLSTSLSI----LSS 102
           +  +++      +++ +DH  LN          P+ EN+A+  W+++   ++     L  
Sbjct: 62  NMVDLKAIMDSEIIQHVDHRNLNHDVPFMQGIMPSTENLAMIFWQQIEGPIAKHGAALHC 121

Query: 103 VRVYETPMSWVEYQG 117
           +R+ ET  + VEY G
Sbjct: 122 IRIVETENNMVEYYG 136


>gi|221065387|ref|ZP_03541492.1| 6-pyruvoyl tetrahydropterin synthase [Comamonas testosteroni KF-1]
 gi|220710410|gb|EED65778.1| 6-pyruvoyl tetrahydropterin synthase [Comamonas testosteroni KF-1]
          Length = 121

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 37/106 (34%), Positives = 57/106 (53%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             + Q F F+AAH L R  +T    R+HGH+Y  E+ + G  +P  G V D  ++     
Sbjct: 3   FTVHQRFFFDAAHTLERAIETESSRRIHGHTYWAEVSVTGPRNPDNGMVIDLGHLRARLE 62

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVY 106
            L ++LDHH L+E+  L  PT EN+ ++I   L+      S +RV+
Sbjct: 63  LLRDQLDHHFLDEVPGLGKPTLENLCLFIASALADLEPAPSRIRVW 108


>gi|148261739|ref|YP_001235866.1| putative 6-pyruvoyl tetrahydropterin synthase [Acidiphilium cryptum
           JF-5]
 gi|146403420|gb|ABQ31947.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Acidiphilium cryptum JF-5]
          Length = 118

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 45/115 (39%), Positives = 64/115 (55%), Gaps = 2/115 (1%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +IT+ F FEAAH L R        R+HGHSYR  + + G  D  +G + DF  + Q+ + 
Sbjct: 3   EITKEFRFEAAHTLQRQIAAEASRRIHGHSYRATVTLRGAPDA-SGMLMDFGRLGQHLAA 61

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYE-TPMSWVEY 115
           + E LDH  L+E+E L   T EN+A +IW RL+TS   L+ V V+  +      Y
Sbjct: 62  IREALDHRFLDEVEGLGPATLENLARFIWTRLATSCPGLARVAVFRDSEGESCAY 116


>gi|289548175|ref|YP_003473163.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermocrinis albus DSM 14484]
 gi|289181792|gb|ADC89036.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Thermocrinis albus DSM 14484]
          Length = 116

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 35/114 (30%), Positives = 57/114 (50%), Gaps = 5/114 (4%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++     F AAH L           +HGH++ VE+ +  D   K G   DF  I+++   
Sbjct: 4   RVVVKRQFNAAHFLTDY--HGAPEPLHGHTWCVEIHIRADSLDKGGMGVDFVEIDRFLKD 61

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEY 115
           +L   D+  LNE+ E  +P+AEN+A W+++++      L  V V+ET     EY
Sbjct: 62  ILP--DYKLLNEVFEF-SPSAENVARWLFEKVKERFPTLEKVVVWETENCGAEY 112


>gi|118476911|ref|YP_894062.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           str. Al Hakam]
 gi|118416136|gb|ABK84555.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           str. Al Hakam]
          Length = 163

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 40/126 (31%), Positives = 69/126 (54%), Gaps = 15/126 (11%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQ-YFSP 61
           +++ FTF+AAH L       KC  +HGH+Y+V   + G    + G   DF +I++ + + 
Sbjct: 34  VSKEFTFDAAHHLHCYE--GKCKNLHGHTYKVVFGISG-YVNEIGLAIDFGDIKEIWKNE 90

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSS-----------VRVYETPM 110
           +   LDH  LNE     N TAEN+ +WI+++++ +L+  +            VR++ETP 
Sbjct: 91  IEIYLDHRYLNETLPAMNTTAENMVVWIYEKMTEALTKDNRANEYKGARVEFVRLFETPT 150

Query: 111 SWVEYQ 116
           S+ E +
Sbjct: 151 SYAEVR 156


>gi|30019492|ref|NP_831123.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus ATCC
           14579]
 gi|75759342|ref|ZP_00739439.1| Queuosine biosynthesis protein queD [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|206968618|ref|ZP_03229574.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus
           AH1134]
 gi|218234630|ref|YP_002366124.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus
           B4264]
 gi|218896374|ref|YP_002444785.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus
           G9842]
 gi|228900022|ref|ZP_04064258.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis IBL
           4222]
 gi|228907073|ref|ZP_04070937.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis IBL
           200]
 gi|228938556|ref|ZP_04101164.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228951822|ref|ZP_04113920.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228957713|ref|ZP_04119457.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228964404|ref|ZP_04125518.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228971435|ref|ZP_04132061.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228978048|ref|ZP_04138427.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           Bt407]
 gi|229043183|ref|ZP_04190906.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus AH676]
 gi|229068992|ref|ZP_04202285.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus F65185]
 gi|229078626|ref|ZP_04211183.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus Rock4-2]
 gi|229144045|ref|ZP_04272461.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus BDRD-ST24]
 gi|229149642|ref|ZP_04277873.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus m1550]
 gi|229177848|ref|ZP_04305221.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus 172560W]
 gi|229189523|ref|ZP_04316539.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus ATCC
           10876]
 gi|296502022|ref|YP_003663722.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           BMB171]
 gi|29895036|gb|AAP08324.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus ATCC
           14579]
 gi|74493174|gb|EAO56293.1| Queuosine biosynthesis protein queD [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|206737538|gb|EDZ54685.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus
           AH1134]
 gi|218162587|gb|ACK62579.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus
           B4264]
 gi|218541922|gb|ACK94316.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus
           G9842]
 gi|228593968|gb|EEK51771.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus ATCC
           10876]
 gi|228605639|gb|EEK63087.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus 172560W]
 gi|228633852|gb|EEK90450.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus m1550]
 gi|228639442|gb|EEK95856.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus BDRD-ST24]
 gi|228704696|gb|EEL57125.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus Rock4-2]
 gi|228714104|gb|EEL65986.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus F65185]
 gi|228726145|gb|EEL77379.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus AH676]
 gi|228781709|gb|EEM29908.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           Bt407]
 gi|228788302|gb|EEM36255.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228795261|gb|EEM42753.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228801956|gb|EEM48829.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228807745|gb|EEM54266.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228821154|gb|EEM67171.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228852577|gb|EEM97367.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis IBL
           200]
 gi|228859636|gb|EEN04060.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis IBL
           4222]
 gi|296323074|gb|ADH06002.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           BMB171]
 gi|326939065|gb|AEA14961.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           serovar chinensis CT-43]
          Length = 163

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 40/126 (31%), Positives = 69/126 (54%), Gaps = 15/126 (11%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQ-YFSP 61
           +++ FTF+AAH L       KC  +HGH+Y+V   + G    + G   DF +I++ + + 
Sbjct: 34  VSKEFTFDAAHHLHCYE--GKCKNLHGHTYKVVFGISG-YVNEIGLAIDFGDIKEIWKNE 90

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSL-----------SILSSVRVYETPM 110
           +   LDH  LNE     N TAEN+ +WI+++++ +L           + +  VR++ETP 
Sbjct: 91  IEIYLDHRYLNETLPAMNTTAENMVVWIYEKMAEALTKENRVNEYKGARVEFVRLFETPT 150

Query: 111 SWVEYQ 116
           S+ E +
Sbjct: 151 SYAEVR 156


>gi|23100259|ref|NP_693726.1| 6-pyruvoyl tetrahydrobiopterin synthase [Oceanobacillus iheyensis
           HTE831]
 gi|22778491|dbj|BAC14760.1| 6-pyruvoyl tetrahydrobiopterin synthase [Oceanobacillus iheyensis
           HTE831]
          Length = 147

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 59/127 (46%), Gaps = 16/127 (12%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ + F F AAH +P   +  KC +MHGH+Y   + + GD   +TGF+ +F  I+     
Sbjct: 18  ELNKDFQFSAAHYIPH-DQAGKCQQMHGHTYFTNITVVGDELDETGFLVNFKQIKNLIHK 76

Query: 62  LLEKLDHHCLNEIEELEN------PTAENIAIWIWKRLSTSL------SILSSVRVYETP 109
              + DH  +N+     +      PT E +A  I++ +   L           V + ETP
Sbjct: 77  ---RFDHGVINDDAAFSDEQAVDFPTTEVVARKIYEIIQEYLDGLQNKPKCIQVYLRETP 133

Query: 110 MSWVEYQ 116
            S+  Y+
Sbjct: 134 TSYCIYR 140


>gi|153809322|ref|ZP_01961990.1| hypothetical protein BACCAC_03635 [Bacteroides caccae ATCC 43185]
 gi|149128092|gb|EDM19313.1| hypothetical protein BACCAC_03635 [Bacteroides caccae ATCC 43185]
          Length = 129

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 56/116 (48%), Gaps = 9/116 (7%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             + +     A+H+L  +P   KC  +HGH++ + +          G V DF  I++   
Sbjct: 2   FTVIKRLEISASHKLV-LPYRSKCASLHGHNWIITVYCRSARLNADGMVVDFTRIKEVVM 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
              EKLDH  LNE+    NPTAENIA W+ K++         V V E+  + V Y+
Sbjct: 61  ---EKLDHQNLNEVLPF-NPTAENIARWVCKQI----PQCYKVEVQESEGNIVIYE 108


>gi|307252733|ref|ZP_07534624.1| 6-pyruvoyl tetrahydrobiopterin synthase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307257149|ref|ZP_07538921.1| 6-pyruvoyl tetrahydrobiopterin synthase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306859765|gb|EFM91787.1| 6-pyruvoyl tetrahydrobiopterin synthase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306864311|gb|EFM96222.1| 6-pyruvoyl tetrahydrobiopterin synthase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
          Length = 140

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 33/139 (23%), Positives = 66/139 (47%), Gaps = 26/139 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPK---TGFVDDFFNIEQ 57
            KI + F+F+ AH L       KC  +HGH+Y++++ + GD+  +      V D+ +++ 
Sbjct: 2   FKIAKEFSFDMAHMLDG--HDGKCQNLHGHTYKLQVEVSGDLVAEGAKRSMVMDYADLKS 59

Query: 58  YF-SPLLEKLDHHCLNEIEE--------------------LENPTAENIAIWIWKRLSTS 96
                +L+ +DH  + ++                          TAE +A +++++L   
Sbjct: 60  VVKHEILDPMDHAYIYDLNSERESQVAKLLVDLNSKVYGIPSRTTAEEMAKYMFEKLEKV 119

Query: 97  LSILSSVRVYETPMSWVEY 115
              +S +R++ETP S+ EY
Sbjct: 120 GLPVSLIRLWETPTSYCEY 138


>gi|229108897|ref|ZP_04238501.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus Rock1-15]
 gi|228674553|gb|EEL29793.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus Rock1-15]
          Length = 163

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 40/126 (31%), Positives = 69/126 (54%), Gaps = 15/126 (11%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQ-YFSP 61
           +++ FTF+AAH L       KC  +HGH+Y+V   + G    + G   DF +I++ + + 
Sbjct: 34  VSKEFTFDAAHHLHCYE--GKCKNLHGHTYKVVFGISG-YVNQIGLAIDFGDIKEIWKNE 90

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSL-----------SILSSVRVYETPM 110
           +   LDH  LNE     N TAEN+ +WI+++++ +L           + +  VR++ETP 
Sbjct: 91  IEIYLDHRYLNETLPAMNTTAENMVVWIYEKMAEALTKENRVNEYKGARVEFVRLFETPT 150

Query: 111 SWVEYQ 116
           S+ E +
Sbjct: 151 SYAEVR 156


>gi|254361905|ref|ZP_04978038.1| 6-pyruvoyltetrahydropterin synthase [Mannheimia haemolytica PHL213]
 gi|261495368|ref|ZP_05991817.1| 6-pyruvoyltetrahydropterin synthase [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|153093446|gb|EDN74434.1| 6-pyruvoyltetrahydropterin synthase [Mannheimia haemolytica PHL213]
 gi|261308971|gb|EEY10225.1| 6-pyruvoyltetrahydropterin synthase [Mannheimia haemolytica
           serotype A2 str. OVINE]
          Length = 140

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 34/139 (24%), Positives = 66/139 (47%), Gaps = 26/139 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGD---VDPKTGFVDDFFNIEQ 57
            KI + F+F+ AH L       KC  +HGH+Y++++ + G+      K G V D+ +++ 
Sbjct: 2   FKIAKEFSFDMAHMLDG--HDGKCQNLHGHTYKLQVEVAGELFQEGAKRGMVMDYSDLKA 59

Query: 58  YFSPLL-EKLDHHCLNEIEELE--------------------NPTAENIAIWIWKRLSTS 96
                + E +DH  + +++                         TAE +A +++++L   
Sbjct: 60  VVKQHILEPMDHAFIYDLQSERESQVAQLLIDLNSKVYGIPTRTTAEEMAKYMFEKLEKV 119

Query: 97  LSILSSVRVYETPMSWVEY 115
              +S +R++ETP S+ EY
Sbjct: 120 GLPVSLIRLWETPTSYCEY 138


>gi|32035297|ref|ZP_00135304.1| COG0720: 6-pyruvoyl-tetrahydropterin synthase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126208570|ref|YP_001053795.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Actinobacillus
           pleuropneumoniae L20]
 gi|190150423|ref|YP_001968948.1| 6-pyruvoyl tetrahydrobiopterin synthase [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|307246014|ref|ZP_07528096.1| 6-pyruvoyl tetrahydrobiopterin synthase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307250349|ref|ZP_07532298.1| 6-pyruvoyl tetrahydrobiopterin synthase [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|307254995|ref|ZP_07536813.1| 6-pyruvoyl tetrahydrobiopterin synthase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307259431|ref|ZP_07541156.1| 6-pyruvoyl tetrahydrobiopterin synthase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307263766|ref|ZP_07545372.1| 6-pyruvoyl tetrahydrobiopterin synthase [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|126097362|gb|ABN74190.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|189915554|gb|ACE61806.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|306852949|gb|EFM85172.1| 6-pyruvoyl tetrahydrobiopterin synthase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306857624|gb|EFM89731.1| 6-pyruvoyl tetrahydrobiopterin synthase [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306861868|gb|EFM93844.1| 6-pyruvoyl tetrahydrobiopterin synthase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306866367|gb|EFM98230.1| 6-pyruvoyl tetrahydrobiopterin synthase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306870887|gb|EFN02625.1| 6-pyruvoyl tetrahydrobiopterin synthase [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 140

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 33/139 (23%), Positives = 66/139 (47%), Gaps = 26/139 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPK---TGFVDDFFNIEQ 57
            KI + F+F+ AH L       KC  +HGH+Y++++ + GD+  +      V D+ +++ 
Sbjct: 2   FKIAKEFSFDMAHMLDG--HDGKCQNLHGHTYKLQVEVSGDLVAEGAKRSMVMDYADLKS 59

Query: 58  YF-SPLLEKLDHHCLNEIEE--------------------LENPTAENIAIWIWKRLSTS 96
                +L+ +DH  +  +                          TAE +A +++++L  +
Sbjct: 60  VVKREILDPMDHAYIYNLNSERESQVAKLLVDLNSKVYGIPSRTTAEEMAKYMFEKLEKA 119

Query: 97  LSILSSVRVYETPMSWVEY 115
              +S +R++ETP S+ EY
Sbjct: 120 GLPVSLIRLWETPTSYCEY 138


>gi|254525663|ref|ZP_05137715.1| 6-pyruvoyl tetrahydropterin synthase [Prochlorococcus marinus str.
           MIT 9202]
 gi|221537087|gb|EEE39540.1| 6-pyruvoyl tetrahydropterin synthase [Prochlorococcus marinus str.
           MIT 9202]
          Length = 308

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 38/130 (29%), Positives = 66/130 (50%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRL--------PRVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL               KC R+  HGH+Y +++ + G ++P+TG + D 
Sbjct: 156 LTVQSHFNAAHRLAKDEISLSENKKIYGKCARINGHGHNYFLDVTVRGQINPRTGMICDL 215

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSL----SILSSVR 104
            +++      ++E+ DH  LN +IE  +    T ENIA+ I   L++ +    + L  +R
Sbjct: 216 PSLQSIIDDLIVEQFDHTFLNKDIEYFKTCVPTCENIALHISDILASPIKNIGANLHKIR 275

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 276 LQESPNNAAE 285



 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 38/134 (28%), Positives = 62/134 (46%), Gaps = 21/134 (15%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHR--MHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F ++HR           +    KC     HGH+Y + + M G++D   G V + 
Sbjct: 18  ITRRACFSSSHRYWLPEKSQEENLSLFGKCSFAPGHGHNYELIVSMGGELDSD-GMVLNL 76

Query: 53  FNIEQYF-SPLLEKLDHHCLNEIEELEN--------PTAENIAIWIWKRLSTSLSILSSV 103
            +++    + +  +LD   LN++    N        PT E +   IW RL   L  L+S+
Sbjct: 77  SDVKHSIKNEVTGQLDFRFLNDVWPEFNIYSQDGILPTTEALVKVIWNRLKDDLP-LTSL 135

Query: 104 RVYETPMSWVEYQG 117
           R+YE+P  W +Y G
Sbjct: 136 RLYESPTLWADYFG 149


>gi|304408384|ref|ZP_07390031.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Paenibacillus curdlanolyticus YK9]
 gi|304342673|gb|EFM08520.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Paenibacillus curdlanolyticus YK9]
          Length = 159

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 38/119 (31%), Positives = 65/119 (54%), Gaps = 10/119 (8%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF++AH L       KC  MHGH+Y+V+L+M G  D +   +D         + +
Sbjct: 30  LSKEFTFDSAHHLHHYE--GKCQSMHGHTYKVQLMMSGKPDERGISIDFADMKRIAQARI 87

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSI--------LSSVRVYETPMSWV 113
           +E LDH  LNE     N TAEN+ +W+++++  +L          +  +R++ETP S+ 
Sbjct: 88  IEPLDHKYLNEALPPMNTTAENMVVWMYEQVHEALVEEGLYPNVRVEEIRLWETPTSFA 146


>gi|124265720|ref|YP_001019724.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Methylibium
           petroleiphilum PM1]
 gi|124258495|gb|ABM93489.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Methylibium
           petroleiphilum PM1]
          Length = 129

 Score = 97.2 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 40/108 (37%), Positives = 66/108 (61%), Gaps = 3/108 (2%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKC---HRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQ 57
            +++Q+F FE+AH L R  + ++     R+HGH+Y  E+ + G+ DP TG V D   +  
Sbjct: 2   FELSQSFYFESAHTLRRQVERNEADGSRRVHGHTYTAEVTVRGEADPATGMVVDLALLRS 61

Query: 58  YFSPLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRV 105
             + + E+LDHH L+E+  L  PT EN+  +I +RL T++  ++SV V
Sbjct: 62  AIATVREQLDHHFLDEVPGLGLPTLENLCRFIHERLLTTVPAIASVSV 109


>gi|229541151|ref|ZP_04430211.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Bacillus coagulans 36D1]
 gi|229325571|gb|EEN91246.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Bacillus coagulans 36D1]
          Length = 163

 Score = 97.2 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 40/123 (32%), Positives = 64/123 (52%), Gaps = 14/123 (11%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP- 61
           +T+AFTF+AAH L       KC  +HGH+Y+V++        + G   DF ++++ F   
Sbjct: 31  VTKAFTFDAAHHLHLYE--GKCKSLHGHTYKVKITCSA-YLNEIGISIDFGDLKKIFQEA 87

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSL----------SILSSVRVYETPMS 111
           + EKLDH  LN +    N T EN+ +W+W+ +   L          + L  + +YETP S
Sbjct: 88  VEEKLDHQYLNNVLPPMNTTVENMVVWMWEEIENRLNRQKDYKDRGARLEELVLYETPKS 147

Query: 112 WVE 114
           +  
Sbjct: 148 YAT 150


>gi|157692045|ref|YP_001486507.1| 6-pyruvoyltetrahydropterin synthase [Bacillus pumilus SAFR-032]
 gi|157680803|gb|ABV61947.1| 6-pyruvoyltetrahydropterin synthase [Bacillus pumilus SAFR-032]
          Length = 146

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 36/128 (28%), Positives = 61/128 (47%), Gaps = 16/128 (12%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ +     AAH +PR      C R+HGH+Y + + + GD    +GF+ +F  +++   
Sbjct: 15  FELNKDMHISAAHFIPR-EDAGACSRVHGHTYTINITIAGDELDDSGFLVNFSTLKKLIH 73

Query: 61  PLLEKLDHHCLNEIEELEN------PTAENIAIWIWKRLSTSLSIL------SSVRVYET 108
               + DH  LN+ EE  +      PT E +A  +  +++  LS L        V V ET
Sbjct: 74  ---GQYDHTLLNDHEEFSSTNPYAMPTTEVVAKTVHDKVADYLSTLANKPVCVQVFVRET 130

Query: 109 PMSWVEYQ 116
           P S+  Y+
Sbjct: 131 PTSYCIYR 138


>gi|229002867|ref|ZP_04160743.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus mycoides
           Rock3-17]
 gi|229008541|ref|ZP_04165968.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus mycoides Rock1-4]
 gi|228752736|gb|EEM02337.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus mycoides Rock1-4]
 gi|228758392|gb|EEM07563.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus mycoides
           Rock3-17]
          Length = 163

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 40/126 (31%), Positives = 69/126 (54%), Gaps = 15/126 (11%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQ-YFSP 61
           +++ FTF+AAH L       KC  +HGH+Y+V   + G      G   DF +I++ + + 
Sbjct: 34  VSKEFTFDAAHHLHCYE--GKCKNLHGHTYKVVFGISG-YVNDIGLAIDFGDIKEIWKNE 90

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSL-----------SILSSVRVYETPM 110
           +   LDH  LNE   + N TAEN+ +WI+++++ +L           + +  VR++ETP 
Sbjct: 91  IEIYLDHRYLNETLPVMNTTAENMVVWIYEKMAEALTKGNRAEEYKGARVEFVRLFETPT 150

Query: 111 SWVEYQ 116
           S+ E +
Sbjct: 151 SYAEVR 156


>gi|229099949|ref|ZP_04230871.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus Rock3-29]
 gi|228683494|gb|EEL37450.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus Rock3-29]
          Length = 163

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 40/126 (31%), Positives = 69/126 (54%), Gaps = 15/126 (11%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQ-YFSP 61
           +++ FTF+AAH L       KC  +HGH+Y+V   + G      G   DF +I++ + + 
Sbjct: 34  VSKEFTFDAAHHLHCYE--GKCKNLHGHTYKVVFGISG-YVNDIGLAIDFGDIKEIWKNE 90

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSL-----------SILSSVRVYETPM 110
           +   LDH  LNE   + N TAEN+ +WI+++++ +L           + +  VR++ETP 
Sbjct: 91  IEIYLDHRYLNETLPVMNTTAENMVVWIYEKMAEALIKGNRTEEYKGARVEFVRLFETPT 150

Query: 111 SWVEYQ 116
           S+ E +
Sbjct: 151 SYAEVR 156


>gi|116753751|ref|YP_842869.1| putative 6-pyruvoyl tetrahydropterin synthase [Methanosaeta
           thermophila PT]
 gi|116665202|gb|ABK14229.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Methanosaeta thermophila PT]
          Length = 120

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 48/125 (38%), Positives = 73/125 (58%), Gaps = 13/125 (10%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M++  +  F+AAH LP      KC R+HGH+YRVE+V++GD     G + DF+ +++   
Sbjct: 1   MRMGLSMEFDAAHHLPM--HDGKCSRIHGHTYRVEVVLQGDPGDD-GMIIDFYMLKKIVG 57

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSL--------SILSSVRVYETPMSW 112
            ++++LDH+ LN +  L+NPTAE IA  I +RL   L        + L SVR++E    W
Sbjct: 58  RVIQELDHNNLNTV--LQNPTAEMIASHIHRRLHEELKMTGLSDKATLLSVRLWEGRDKW 115

Query: 113 VEYQG 117
           V   G
Sbjct: 116 VMVDG 120


>gi|194333693|ref|YP_002015553.1| hypothetical protein Paes_0860 [Prosthecochloris aestuarii DSM 271]
 gi|194311511|gb|ACF45906.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Prosthecochloris aestuarii DSM 271]
          Length = 149

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 43/136 (31%), Positives = 70/136 (51%), Gaps = 21/136 (15%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+   F AAHRL     +         KC  +  HGH+Y +E+ + G VD KTGF+ D 
Sbjct: 13  VTRTVEFNAAHRLFNPSISDEENLKTYGKCSNLYGHGHNYELEITVSGTVDRKTGFLLDM 72

Query: 53  FNIEQYF-SPLLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLS-------ILS 101
             ++    + ++ + DH  LN ++EEL+N  P+ E +A+ +W  L  +L         L 
Sbjct: 73  KELKIILENEIMSRFDHKHLNFDVEELKNTVPSTEILAVTVWDILHDALQSYSNKEITLH 132

Query: 102 SVRVYETPMSWVEYQG 117
            V+++ET  + V Y G
Sbjct: 133 EVKIHETRKNSVRYLG 148


>gi|116747455|ref|YP_844142.1| putative 6-pyruvoyl tetrahydropterin synthase [Syntrophobacter
           fumaroxidans MPOB]
 gi|116696519|gb|ABK15707.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Syntrophobacter fumaroxidans MPOB]
          Length = 127

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 38/120 (31%), Positives = 63/120 (52%), Gaps = 8/120 (6%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I     F AAH L       KC  +HGH++++E+V+ G    + G + DF  ++Q    
Sbjct: 7   EIKIITDFSAAHHLR--DFRGKCENLHGHNWKIEIVLRGTELNEIGVLVDFGEVKQATRA 64

Query: 62  LLEKLDHHCLNEIEEL--ENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEY 115
           LL ++DHH LNEI      NP++ENIA ++++RL+         L  V  +E+  +   +
Sbjct: 65  LLSEVDHHYLNEIPFFADRNPSSENIARYLFERLAEKFDNDKLRLYRVSAWESDDACATF 124


>gi|328950183|ref|YP_004367518.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Marinithermus hydrothermalis DSM 14884]
 gi|328450507|gb|AEB11408.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Marinithermus hydrothermalis DSM 14884]
          Length = 129

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 45/125 (36%), Positives = 57/125 (45%), Gaps = 12/125 (9%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVD------PKTGFVDDFFNI 55
           K+   FTF++AH +        C RMHGH+YRV +    D        P    V DF  +
Sbjct: 5   KLVTEFTFDSAHYITDYD--GPCGRMHGHTYRVRVEATSDRLYPSAHTPHPVMVADFKTL 62

Query: 56  EQYFSPLLE-KLDHHCLNEIEELEN-PTAENIAIWIWKRLSTSLSI--LSSVRVYETPMS 111
                 + E  LDH  LNE+   E   TAE IA +I       L       V V+ETP S
Sbjct: 63  RWAKKDVTEGGLDHAVLNEVLPPEYATTAEMIAKYIHDETKRRLPEGVRLKVTVWETPTS 122

Query: 112 WVEYQ 116
           WVEY+
Sbjct: 123 WVEYE 127


>gi|261492301|ref|ZP_05988863.1| 6-pyruvoyltetrahydropterin synthase [Mannheimia haemolytica
           serotype A2 str. BOVINE]
 gi|261311984|gb|EEY13125.1| 6-pyruvoyltetrahydropterin synthase [Mannheimia haemolytica
           serotype A2 str. BOVINE]
          Length = 140

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 34/139 (24%), Positives = 66/139 (47%), Gaps = 26/139 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGD---VDPKTGFVDDFFNIEQ 57
            KI + F+F+ AH L       KC  +HGH+Y++++ + G+      K G V D+ +++ 
Sbjct: 2   FKIAKEFSFDMAHMLDG--HDGKCQNLHGHTYKLQVEVAGELFQEGAKRGMVMDYSDLKA 59

Query: 58  YFSPLL-EKLDHHCLNEIEELE--------------------NPTAENIAIWIWKRLSTS 96
                + E +DH  + +++                         TAE +A +++++L   
Sbjct: 60  VVKQHILEPIDHAFIYDLQSERESQVAQLLIDLNSKVYGIPTRTTAEEMAKYMFEKLEKV 119

Query: 97  LSILSSVRVYETPMSWVEY 115
              +S +R++ETP S+ EY
Sbjct: 120 GLPVSLIRLWETPTSYCEY 138


>gi|124021919|ref|YP_001016226.1| 6-pyruvoyl tetrahydropterin synthase [Prochlorococcus marinus str.
           MIT 9303]
 gi|123962205|gb|ABM76961.1| 6-pyruvoyl tetrahydropterin synthase [Prochlorococcus marinus str.
           MIT 9303]
          Length = 306

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 45/130 (34%), Positives = 68/130 (52%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL RV  +         KC R HGH  +Y V++ + G++DP+TG V D 
Sbjct: 156 LTIRTHFAAAHRLARVELSQEENERIYGKCARPHGHGHNYFVDVTVRGEIDPRTGMVCDL 215

Query: 53  FNIEQYFSPL-LEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSL----SILSSVR 104
             ++   + + +E  DH  LN +I    N   TAENIA++I   L+  +    + L  VR
Sbjct: 216 GALQSLVNCIVVEPFDHTFLNKDIPHFANCVPTAENIALYISDCLAKPIRAIGAHLHKVR 275

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 276 LQESPNNAAE 285



 Score = 79.4 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 57/134 (42%), Gaps = 21/134 (15%)

Query: 3   ITQAFTFEAAHR--LPRVPKTHKCHRM--------HGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F A HR  LP +       R         HGH+Y + + M G      G V + 
Sbjct: 18  ITRKARFSAGHRYYLPELSSDDNAARFGLCALPAGHGHNYELIVAMAG-GLNVDGMVLNL 76

Query: 53  FNIEQYFS-PLLEKLDHHCLNEI-EELE-------NPTAENIAIWIWKRLSTSLSILSSV 103
             ++      + ++LD   LN++  E +        PT E +   IW RL   L I+ ++
Sbjct: 77  SEVKHAIRSEVTDQLDFRFLNDVWPEFDLSRPEGCLPTTEALLRIIWTRLIAHLPIV-AI 135

Query: 104 RVYETPMSWVEYQG 117
           R+YE    W +Y G
Sbjct: 136 RLYEQENLWADYHG 149


>gi|326318539|ref|YP_004236211.1| hypothetical protein Acav_3753 [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323375375|gb|ADX47644.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 125

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 55/106 (51%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             + Q F F+AAH L R  +     R+HGH+Y  E+ + G   P TG V D  ++    +
Sbjct: 3   FTVHQRFFFDAAHTLQREIEAEGSRRIHGHTYHAEISVTGPRHPATGMVIDLGHLRARCA 62

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVY 106
            L E+LDHH L+E+  L   T EN+ ++I   L       S VRV+
Sbjct: 63  QLRERLDHHLLDEVPGLGPATLENLCVFIADALGDLDPPPSRVRVW 108


>gi|228920153|ref|ZP_04083502.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228839609|gb|EEM84901.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
          Length = 163

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 40/126 (31%), Positives = 69/126 (54%), Gaps = 15/126 (11%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQ-YFSP 61
           +++ FTF+AAH L       KC  +HGH+Y+V   + G    + G   DF +I++ + + 
Sbjct: 34  VSKEFTFDAAHHLHCYE--GKCKNLHGHTYKVVFGISG-YVNEIGLAIDFGDIKEIWKNE 90

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSL-----------SILSSVRVYETPM 110
           +   LDH  LNE     N TAEN+ +WI+++++ +L           + +  VR++ETP 
Sbjct: 91  IEIHLDHRYLNETLPAMNTTAENMVVWIYEKMAEALTKENRVNEYKGARVEFVRLFETPT 150

Query: 111 SWVEYQ 116
           S+ E +
Sbjct: 151 SYAEVR 156


>gi|33866733|ref|NP_898292.1| 6-pyruvoyl-tetrahydropterin synthase-like protein [Synechococcus
           sp. WH 8102]
 gi|33639334|emb|CAE08716.1| 6-pyruvoyl-tetrahydropterin synthase homolog [Synechococcus sp. WH
           8102]
          Length = 306

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 44/130 (33%), Positives = 66/130 (50%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL R   +         KC R HGH  +Y V++ + G +DP+TG V D 
Sbjct: 156 LTIRTHFAAAHRLARPELSQEENEAIYGKCARPHGHGHNYLVDVTVRGAIDPRTGMVCDL 215

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSL----SILSSVR 104
             +++     ++E  DH  LN ++        TAENIA+ I  RLST +    + L  +R
Sbjct: 216 SALQRLVDDLVVEPFDHTFLNKDVAFFAECVPTAENIALHIADRLSTPVKAIGAHLHKIR 275

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 276 LQESPNNAAE 285



 Score = 87.1 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 56/134 (41%), Gaps = 21/134 (15%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F A+HR                 C     HGH+Y + + M G      G V + 
Sbjct: 18  ITRRACFSASHRYWLPELSADDNAARFGPCAIAPGHGHNYELIVSMAG-GLDADGMVLNL 76

Query: 53  FNIEQYF-SPLLEKLDHHCLNEI-EELEN-------PTAENIAIWIWKRLSTSLSILSSV 103
             ++      +  +LD   LNE   E +        PT E +   IW+RLS  L  ++++
Sbjct: 77  SEVKHAIRQEVTGQLDFRFLNEAWPEFDVSGPSGCLPTTEALVRVIWQRLSPHLP-ITAL 135

Query: 104 RVYETPMSWVEYQG 117
           R+YE P  W +Y G
Sbjct: 136 RLYEQPGLWADYLG 149


>gi|282895484|ref|ZP_06303621.1| hypothetical protein CRD_00116 [Raphidiopsis brookii D9]
 gi|281199517|gb|EFA74380.1| hypothetical protein CRD_00116 [Raphidiopsis brookii D9]
          Length = 422

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 47/130 (36%), Positives = 70/130 (53%), Gaps = 13/130 (10%)

Query: 1   MKITQAFTFEAAHRLP---RVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQ 57
           + +T    F AAHRL    R  K  KC R HGH+Y +E+ +EG++D +TG + D   + +
Sbjct: 136 ISLTARSHFSAAHRLAPNLRAEKYGKCTRTHGHNYHLEVTVEGEMDGRTGTIVDLGCLHE 195

Query: 58  YF-SPLLEKLDHHCLN-EIEELEN----PTAENIAIWIWKRLSTSLSI----LSSVRVYE 107
                +LE  DH C+N +I         PT ENIA ++   L   +S     LS V+++E
Sbjct: 196 TVEREILELFDHSCINEDIPYFSTSHIVPTTENIARYMSDLLQFPISELGVKLSRVKLFE 255

Query: 108 TPMSWVEYQG 117
           +   WVEY+G
Sbjct: 256 SDHLWVEYEG 265



 Score = 87.9 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 42/129 (32%), Positives = 62/129 (48%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           I +   F A+HR           V K   C +   HGH+Y + + M G+   + G V + 
Sbjct: 5   INRRAQFSASHRYWLPELGEAQNVGKFGLCAKFPGHGHNYVLFISMSGE-LDEYGMVLNL 63

Query: 53  FNIEQYFS-PLLEKLDHHCLNEIEELEN---PTAENIAIWIWKRLSTSLSILSSVRVYET 108
            +++Q     +  +LD   LNE+ E      PT ENIA  IW RL+  L  L  V+++E 
Sbjct: 64  SDVKQVIKSEVTSELDFSYLNEVWEEFQATLPTTENIARVIWNRLTPHLP-LVRVQLFEH 122

Query: 109 PMSWVEYQG 117
           P  W EY+G
Sbjct: 123 PQLWTEYEG 131



 Score = 87.1 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 38/124 (30%), Positives = 61/124 (49%), Gaps = 18/124 (14%)

Query: 9   FEAAHRLPRVPKT--------HKCHRM--HGHSYRVELVMEGDVDPKTGFVDDFFNIEQY 58
           F AAHRL     +         KC R+  HGH+Y +E+ + G++D  TG   D   + Q 
Sbjct: 278 FSAAHRLADPTLSLEKNQTIYGKCSRINGHGHNYHLEVTVRGEIDSVTGMSVDLVGLNQI 337

Query: 59  FSPL-LEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSL----SILSSVRVYETPM 110
                +E +DH  LN ++       PTAENIA++I   + + +    + L  V++ E+P 
Sbjct: 338 IQHYVIEPMDHSFLNQDLPYFTEVVPTAENIAVYISDVVRSPIEELGAKLHKVKLIESPN 397

Query: 111 SWVE 114
           +  E
Sbjct: 398 NSCE 401


>gi|163939248|ref|YP_001644132.1| putative 6-pyruvoyl tetrahydropterin synthase [Bacillus
           weihenstephanensis KBAB4]
 gi|229010737|ref|ZP_04167934.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus mycoides DSM
           2048]
 gi|229132238|ref|ZP_04261094.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus
           BDRD-ST196]
 gi|229166275|ref|ZP_04294034.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus AH621]
 gi|163861445|gb|ABY42504.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Bacillus weihenstephanensis KBAB4]
 gi|228617220|gb|EEK74286.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus AH621]
 gi|228651176|gb|EEL07155.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus
           BDRD-ST196]
 gi|228750411|gb|EEM00240.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus mycoides DSM
           2048]
          Length = 163

 Score = 96.8 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/126 (31%), Positives = 69/126 (54%), Gaps = 15/126 (11%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQ-YFSP 61
           +++ FTF+AAH L       KC  +HGH+Y+V   + G    + G   DF +I++ + + 
Sbjct: 34  VSKEFTFDAAHHLHCYE--GKCKNLHGHTYKVVFGISG-YVNEIGLAIDFGDIKEIWKNE 90

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSS-----------VRVYETPM 110
           +   LDH  LNE     N TAEN+ +WI+++++ +L+  +            VR++ETP 
Sbjct: 91  IEIYLDHRYLNETLPEMNTTAENMVVWIYEKMAEALTKDNRANEYKGARVEFVRLFETPT 150

Query: 111 SWVEYQ 116
           S+ E +
Sbjct: 151 SYAEVR 156


>gi|223041978|ref|ZP_03612162.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Actinobacillus
           minor 202]
 gi|223017235|gb|EEF15663.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Actinobacillus
           minor 202]
          Length = 140

 Score = 96.8 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/139 (23%), Positives = 68/139 (48%), Gaps = 26/139 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGD---VDPKTGFVDDFFNIEQ 57
            KI + F+F+ AH L       KC  +HGH+Y++++ + G+      K G V D+ +++ 
Sbjct: 2   FKIAKEFSFDMAHMLDG--HDGKCQNLHGHTYKLQVEVTGNLHLYGAKRGMVMDYSDLKA 59

Query: 58  YFSPLL-EKLDHHCLNEIEELE--------------------NPTAENIAIWIWKRLSTS 96
                + + +DH  + +++  +                      TAE +A +++++L+  
Sbjct: 60  VVKQHILDPMDHAFIYDLQSEKETKVAQLLMDLDSKVYGIPSRTTAEEMAKYMFEKLANV 119

Query: 97  LSILSSVRVYETPMSWVEY 115
              +S +R++ETP S+ EY
Sbjct: 120 GLPVSLIRLWETPTSYCEY 138


>gi|110598451|ref|ZP_01386722.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Chlorobium ferrooxidans DSM 13031]
 gi|110339901|gb|EAT58405.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Chlorobium ferrooxidans DSM 13031]
          Length = 149

 Score = 96.8 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 44/136 (32%), Positives = 63/136 (46%), Gaps = 21/136 (15%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHR--MHGHSYRVELVMEGDVDPKTGFVDDF 52
           +++   F AAHRL     T         KC     HGH+Y +E+ + G VDP TGF+ D 
Sbjct: 13  VSRKIEFNAAHRLFNPDFTDEENGEIYGKCSNKNGHGHNYLLEITLYGVVDPATGFLFDL 72

Query: 53  FNIEQYFSPL-LEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSLSI-------LS 101
             ++       +E+ DH  LN ++ EL     T E +A+ IW  L   L         L 
Sbjct: 73  KELKAILEEEIIERFDHRNLNLDVPELRECVPTTEVLAVLIWDILEQRLRNINNREIALH 132

Query: 102 SVRVYETPMSWVEYQG 117
            V++YET  + V Y G
Sbjct: 133 EVKIYETGKNSVRYLG 148


>gi|15606204|ref|NP_213581.1| hypothetical protein aq_853 [Aquifex aeolicus VF5]
 gi|2983398|gb|AAC06983.1| hypothetical protein aq_853 [Aquifex aeolicus VF5]
          Length = 114

 Score = 96.8 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/114 (28%), Positives = 56/114 (49%), Gaps = 5/114 (4%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +     F AAH L       K   +HGH++ VE+ ++ +   K G   DF  I+ +   +
Sbjct: 5   VRVKRKFNAAHFLTDY--HGKPEPLHGHTWTVEVFIKAEELDKGGMGVDFVEIDNFLKDI 62

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
           L   D+  LN++ +  +P+AEN+A  ++K++      L  V V+ET     EY 
Sbjct: 63  LP--DYTLLNDVFDF-SPSAENVAKGLYKKVKEKYPNLVKVVVWETETCGAEYY 113


>gi|120612486|ref|YP_972164.1| putative 6-pyruvoyl tetrahydropterin synthase [Acidovorax citrulli
           AAC00-1]
 gi|120590950|gb|ABM34390.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Acidovorax citrulli AAC00-1]
          Length = 125

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 55/106 (51%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             + Q F F+AAH L R  +     R+HGH+Y  E+ + G   P TG V D  ++    +
Sbjct: 3   FTVHQRFFFDAAHTLQREIEAEGSRRIHGHTYHAEISVTGPRHPATGMVIDLGHLRARCA 62

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVY 106
            L E+LDHH L+E+  L   T EN+ ++I   L       S VRV+
Sbjct: 63  QLRERLDHHLLDEVPGLGPATLENLCVFIADALGDLDPAPSRVRVW 108


>gi|78778495|ref|YP_396607.1| 6-pyruvoyl tetrahydropterin synthase [Prochlorococcus marinus str.
           MIT 9312]
 gi|78711994|gb|ABB49171.1| 6-pyruvoyl tetrahydropterin synthase [Prochlorococcus marinus str.
           MIT 9312]
          Length = 308

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 43/130 (33%), Positives = 69/130 (53%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRL--------PRVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL               KC R+  HGH+Y V++ ++GD+D +TG V D 
Sbjct: 156 LTVQTHFAAAHRLAKEEISFDENKKIYGKCARVNGHGHNYLVDITVKGDIDKRTGMVCDL 215

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSL----SILSSVR 104
             +++  +  ++E+LDH  LN +IE   +   TAENIA++I   L   +    + L  +R
Sbjct: 216 SALQEIINDLVVEQLDHTFLNKDIEFFHSCVPTAENIALYISDILKKPIHNLGATLHKIR 275

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 276 LQESPNNAAE 285



 Score = 93.7 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 38/134 (28%), Positives = 60/134 (44%), Gaps = 21/134 (15%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F ++HR           +    KC     HGH+Y + + M G++D   G V + 
Sbjct: 18  ITRRACFSSSHRYWLPEKSPEENLSLFGKCSIAPGHGHNYELIVSMGGELDSD-GMVLNL 76

Query: 53  FNIEQYF-SPLLEKLDHHCLNEIEELEN--------PTAENIAIWIWKRLSTSLSILSSV 103
            +++      +  +LD   LN++    N        PT E +   IW RL   L  L+S+
Sbjct: 77  SDVKHSIKDKVTGQLDFRFLNDVWPEFNVNNQEGLLPTTEALVKVIWSRLKDDLP-LTSL 135

Query: 104 RVYETPMSWVEYQG 117
           R+YE P  W +Y G
Sbjct: 136 RLYENPNLWADYFG 149


>gi|228995354|ref|ZP_04155039.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus pseudomycoides
           DSM 12442]
 gi|228764396|gb|EEM13259.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus pseudomycoides
           DSM 12442]
          Length = 163

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 39/126 (30%), Positives = 69/126 (54%), Gaps = 15/126 (11%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQ-YFSP 61
           +++ FTF+AAH L       KC  +HGH+Y+V   + G      G   DF +I++ + + 
Sbjct: 34  VSKEFTFDAAHHLHCYE--GKCKNLHGHTYKVVFGISG-YVNDIGLAIDFGDIKEIWKNE 90

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSL-----------SILSSVRVYETPM 110
           +   LDH  LNE   + N TAEN+ +WI+++++ +L           + +  +R++ETP 
Sbjct: 91  IEIYLDHRYLNETLPVMNTTAENMVVWIYEKMAEALTKGNRAEEYKGARVEFIRLFETPT 150

Query: 111 SWVEYQ 116
           S+ E +
Sbjct: 151 SYAEVR 156


>gi|229126758|ref|ZP_04255770.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus BDRD-Cer4]
 gi|228656698|gb|EEL12524.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus BDRD-Cer4]
          Length = 131

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/126 (31%), Positives = 69/126 (54%), Gaps = 15/126 (11%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQ-YFSP 61
           +++ FTF+AAH L       KC  +HGH+Y+V   + G    + G   DF +I++ + + 
Sbjct: 2   VSKEFTFDAAHHLHCYE--GKCKNLHGHTYKVVFGISG-YVNEIGLAIDFGDIKEIWKNE 58

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSL-----------SILSSVRVYETPM 110
           +   LDH  LNE     N TAEN+ +WI+++++ +L           + +  VR++ETP 
Sbjct: 59  IEIYLDHRYLNETLPAMNTTAENMVVWIYEKMAEALTKENRVNEYKGARVEFVRLFETPT 118

Query: 111 SWVEYQ 116
           S+ E +
Sbjct: 119 SYAEVR 124


>gi|329955364|ref|ZP_08296272.1| putative queuosine biosynthesis protein QueD [Bacteroides clarus
           YIT 12056]
 gi|328525767|gb|EGF52791.1| putative queuosine biosynthesis protein QueD [Bacteroides clarus
           YIT 12056]
          Length = 110

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 35/114 (30%), Positives = 54/114 (47%), Gaps = 9/114 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + +     AAH L ++    KC  +HGH++ + +          G V DF +I+Q     
Sbjct: 4   VIKRMEVSAAHSL-KLSYQSKCENLHGHNWIITVYCRSKELNADGMVVDFSHIKQVVK-- 60

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            E+LDH  +NE+    NPTAENIA WI  ++         V V E+  +   Y+
Sbjct: 61  -EQLDHRNINEVLPF-NPTAENIARWICDQI----PTCFKVEVQESESNIAVYE 108


>gi|198274528|ref|ZP_03207060.1| hypothetical protein BACPLE_00676 [Bacteroides plebeius DSM 17135]
 gi|319642226|ref|ZP_07996885.1| hypothetical protein HMPREF9011_02485 [Bacteroides sp. 3_1_40A]
 gi|198272582|gb|EDY96851.1| hypothetical protein BACPLE_00676 [Bacteroides plebeius DSM 17135]
 gi|317386082|gb|EFV67002.1| hypothetical protein HMPREF9011_02485 [Bacteroides sp. 3_1_40A]
          Length = 111

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/114 (28%), Positives = 54/114 (47%), Gaps = 9/114 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + +     A+H L ++    KC  +HGH++ + +          G V DF +I+Q     
Sbjct: 4   VRKRIEISASHSL-KLSYESKCENLHGHNWIIVVWCRAKQLNDDGMVVDFTHIKQKIQ-- 60

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            E+LDH  LNE+    N TAEN+A WI +++         V V E+  +   Y+
Sbjct: 61  -EQLDHRNLNEVLSF-NTTAENMARWICEQV----PACFKVMVQESENNIAWYE 108


>gi|319795395|ref|YP_004157035.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Variovorax paradoxus EPS]
 gi|315597858|gb|ADU38924.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Variovorax paradoxus EPS]
          Length = 120

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 59/106 (55%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             I+Q F F+AAH L R  +     R+HGH+Y  E+ + G+ DP TG V D   + +   
Sbjct: 3   FTISQRFFFDAAHTLKREIEVEGSRRIHGHTYHAEVWLAGERDPVTGMVIDLGLLRRRLE 62

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVY 106
            + E LDHH L+++  L  PT EN+ ++I   L    + L+ VRV+
Sbjct: 63  DVRELLDHHLLDDVAGLHPPTLENLCLFIADALPEFRASLARVRVW 108


>gi|332876611|ref|ZP_08444371.1| beta-phosphoglucomutase [Capnocytophaga sp. oral taxon 329 str.
           F0087]
 gi|332685444|gb|EGJ58281.1| beta-phosphoglucomutase [Capnocytophaga sp. oral taxon 329 str.
           F0087]
          Length = 361

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 60/146 (41%), Gaps = 34/146 (23%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPK-----TGFVDDFFNI 55
           ++IT+ F FEA H L       KC  +HGHSY++ + + G           G V DF ++
Sbjct: 2   IRITKKFDFEAGHALYGYD--GKCKNLHGHSYKLLVTVIGTPINDPHNVKNGMVIDFGDL 59

Query: 56  EQYFSPL-LEKLDH---------------------HCLNEIEELENPTAENIAIWIWKRL 93
           ++      +   DH                     H +  +     PT+EN+ I   +R+
Sbjct: 60  KRIVQEQIITPFDHAMVFNSNSPHQELAESLRAKGHNIISVPY--QPTSENLVIDFAQRI 117

Query: 94  STSLS---ILSSVRVYETPMSWVEYQ 116
              L     L S+R+ ET  S+ E+ 
Sbjct: 118 QQQLPPNVQLYSIRLCETESSYAEWF 143


>gi|17232046|ref|NP_488594.1| hypothetical protein alr4554 [Nostoc sp. PCC 7120]
 gi|17133690|dbj|BAB76253.1| alr4554 [Nostoc sp. PCC 7120]
          Length = 290

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 42/130 (32%), Positives = 66/130 (50%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T +  F AAHRL     +         KC R HGH  +Y +E+ ++G++DP+TG + D 
Sbjct: 138 LTISTHFSAAHRLAHPNLSQEDNTEIYGKCARPHGHGHNYHLEVTVKGEIDPRTGMIVDL 197

Query: 53  FNIEQYFSPL-LEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSL----SILSSVR 104
             + Q      +E  DH  LN +I       PTAENIA++I   L + +    + L  V+
Sbjct: 198 GALNQAIEDYVVEPFDHTFLNKDIPYFAEVVPTAENIALYISNLLRSPIQELGAKLYKVK 257

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 258 LIESPNNSCE 267



 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 39/129 (30%), Positives = 63/129 (48%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           + +   F A+HR           + K   C R   HGH+Y + + + G+   + G V + 
Sbjct: 5   VNRRAQFSASHRYWLPELSEAENIEKFGACSRFPGHGHNYVIFISLAGE-LDEYGMVLNL 63

Query: 53  FNIEQYF-SPLLEKLDHHCLNEI-EELEN--PTAENIAIWIWKRLSTSLSILSSVRVYET 108
            +++Q     +  +LD   LN++  E     PT ENIA  IW+RL+  L  L  V+++E 
Sbjct: 64  SDVKQVIKREVTSQLDFSYLNDVWAEFGQTLPTTENIARVIWQRLAPHLP-LVRVQLFEH 122

Query: 109 PMSWVEYQG 117
           P  W +YQG
Sbjct: 123 PELWADYQG 131


>gi|324540561|gb|ADY49592.1| 6-pyruvoyl tetrahydrobiopterin synthase [Ascaris suum]
          Length = 138

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 38/133 (28%), Positives = 67/133 (50%), Gaps = 16/133 (12%)

Query: 1   MKITQAFTFEAAHRLP--------RVPKTHKCHR--MHGHSYRVELVMEGDVDPKTGFVD 50
           + +T+  +F A+HRL               KC+    HGH+Y  E+ + G +D  TG V 
Sbjct: 6   IDLTRIESFSASHRLHSQSLSATENQKLYGKCNNTNGHGHNYIWEVTLRGPIDVVTGMVY 65

Query: 51  DFFNIEQYFSPLLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSLSI---LSSVR 104
           +  ++++  + +LE +DH  L+ +IE  +    T EN+ I++WK L   +S    L    
Sbjct: 66  NLSDLKKEMAEVLELVDHKNLDLDIEYFKTCVSTTENLTIFLWKELKKHMSKPELLYKTV 125

Query: 105 VYETPMSWVEYQG 117
           V+ET  +   ++G
Sbjct: 126 VHETSKNVFTFRG 138


>gi|317968055|ref|ZP_07969445.1| 6-pyruvoyl tetrahydropterin synthase [Synechococcus sp. CB0205]
          Length = 290

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 42/130 (32%), Positives = 64/130 (49%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL R             KC R HGH  +Y +++ + G +DP+TG V D 
Sbjct: 140 LTIRTHFAAAHRLARPELNFEENTAIYGKCARPHGHGHNYLLDITVRGAIDPRTGMVCDL 199

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI----LSSVR 104
             ++      ++E  DH  LN ++E   +  PTAENIA+ I   L   ++     L  +R
Sbjct: 200 SALQSAVDELVVEPFDHTFLNKDVEHFSSTVPTAENIALHIADLLQAPVAALGASLHKIR 259

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 260 LQESPNNAAE 269



 Score = 81.4 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 56/134 (41%), Gaps = 21/134 (15%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+  TF ++HR             +   C     HGH+Y + + M G      G V + 
Sbjct: 2   ITRRATFSSSHRYWLPELSPEQNAAQFGPCSLAPGHGHNYELIVAMGG-GLDANGMVLNL 60

Query: 53  FNIEQYFSPL-LEKLDHHCLNEI-EELE-------NPTAENIAIWIWKRLSTSLSILSSV 103
            +++         +LD   LNE   E +        PT E + + IWKRL+  L  L  +
Sbjct: 61  SDVKHAIREQVTAQLDFRSLNEAWPEFDLSRPEGILPTTEALVLAIWKRLAPHLP-LMGL 119

Query: 104 RVYETPMSWVEYQG 117
           R+YET   W +  G
Sbjct: 120 RLYETDKLWADVLG 133


>gi|152974869|ref|YP_001374386.1| putative 6-pyruvoyl tetrahydropterin synthase [Bacillus cereus
           subsp. cytotoxis NVH 391-98]
 gi|152023621|gb|ABS21391.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Bacillus cytotoxicus NVH 391-98]
          Length = 164

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/126 (31%), Positives = 69/126 (54%), Gaps = 15/126 (11%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQ-YFSP 61
           +++ FTF+AAH L       KC  +HGH+Y+V   + G    + G   DF +I++ + + 
Sbjct: 35  VSKEFTFDAAHHLHCYD--GKCKNLHGHTYKVVFGISG-YVNEIGIAIDFGDIKEIWKNE 91

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSL-----------SILSSVRVYETPM 110
           +   LDH  LNE     N TAEN+ +WI+++++ +L           + +  VR++ETP 
Sbjct: 92  IEIYLDHRYLNETLPAMNTTAENMVVWIYEKMAEALTKGGRAEEYKGARVEFVRLFETPT 151

Query: 111 SWVEYQ 116
           S+ E +
Sbjct: 152 SYTEVR 157


>gi|229057067|ref|ZP_04196459.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus AH603]
 gi|228720208|gb|EEL71787.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus AH603]
          Length = 163

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/126 (31%), Positives = 69/126 (54%), Gaps = 15/126 (11%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQ-YFSP 61
           +++ FTF+AAH L       KC  +HGH+Y+V   + G    + G   DF +I++ + + 
Sbjct: 34  VSKEFTFDAAHHLHCYE--GKCKNLHGHTYKVVFGISG-YVNEIGLAIDFGDIKEIWKNE 90

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSS-----------VRVYETPM 110
           +   LDH  LNE     N TAEN+ +WI+++++ +L+  +            VR++ETP 
Sbjct: 91  IEIYLDHRYLNETLPEMNTTAENMVVWIYEKMAEALTKDNRENEYKGARVEFVRLFETPT 150

Query: 111 SWVEYQ 116
           S+ E +
Sbjct: 151 SYAEVR 156


>gi|219871539|ref|YP_002475914.1| 6-pyruvoyl tetrahydrobiopterin synthase [Haemophilus parasuis
           SH0165]
 gi|219691743|gb|ACL32966.1| 6-pyruvoyl tetrahydrobiopterin synthase [Haemophilus parasuis
           SH0165]
          Length = 140

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 36/139 (25%), Positives = 69/139 (49%), Gaps = 26/139 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGD---VDPKTGFVDDFFNIEQ 57
            KI + F+F+ AH L       KC  +HGH+Y +++ + G+      K+G V D+ +++ 
Sbjct: 2   FKIAKEFSFDMAHMLDG--HDGKCKNLHGHTYTLQVEIAGELHTDGAKSGMVMDYSDLKA 59

Query: 58  YFSPLL-EKLDHHCLNE------------IEELEN--------PTAENIAIWIWKRLSTS 96
                + +K+DH  + +            ++ L++         TAE +A +I+  L+  
Sbjct: 60  VVKQHILDKMDHAFIYDSTSEKECKVATLLQSLDSKTFGIPARTTAEQMAKYIFDTLTAE 119

Query: 97  LSILSSVRVYETPMSWVEY 115
              +S +R++ETP S+ EY
Sbjct: 120 GLPVSLIRLWETPTSYCEY 138


>gi|229084431|ref|ZP_04216711.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus Rock3-44]
 gi|228698971|gb|EEL51676.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus cereus Rock3-44]
          Length = 166

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/128 (31%), Positives = 67/128 (52%), Gaps = 17/128 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQ-YFSP 61
           +++ FTF+AAH L       KC  +HGH+Y+V   + G    + G   DF +I++ + + 
Sbjct: 35  VSKEFTFDAAHHLHCYE--GKCKNLHGHTYKVVFGISG-YVNEIGLAIDFGDIKEIWKNE 91

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSS-------------VRVYET 108
           +   LDH  LNE     N TAEN+ +WI++++  +L   +              VR++ET
Sbjct: 92  IEIYLDHRYLNETLPAMNTTAENMVVWIYEKMEEALKKENRANEYEYKGARVEFVRLFET 151

Query: 109 PMSWVEYQ 116
           P S+ E +
Sbjct: 152 PTSYAEVR 159


>gi|85714275|ref|ZP_01045263.1| 6-pyruvoyl tetrahydropterin synthase [Nitrobacter sp. Nb-311A]
 gi|85698722|gb|EAQ36591.1| 6-pyruvoyl tetrahydropterin synthase [Nitrobacter sp. Nb-311A]
          Length = 121

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 42/117 (35%), Positives = 62/117 (52%), Gaps = 2/117 (1%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++T++F FEAAH LP          +HGHS+R E+ + G  DP +G V D   +E+    
Sbjct: 3   ELTKSFRFEAAHALPGTTLGIASMEIHGHSFRAEVSLRGKPDPASGMVLDLGLLERSMDK 62

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYE-TPMSWVEYQG 117
           +  KLDH  LN+IE L  PT EN+A +IW  +      ++ V V+  +      Y G
Sbjct: 63  VRNKLDHKLLNDIEGLGLPTLENLARFIWDHVQ-HAGHVTRVSVHRDSCGESCAYFG 118


>gi|167763254|ref|ZP_02435381.1| hypothetical protein BACSTE_01626 [Bacteroides stercoris ATCC
           43183]
 gi|167698548|gb|EDS15127.1| hypothetical protein BACSTE_01626 [Bacteroides stercoris ATCC
           43183]
          Length = 110

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 35/114 (30%), Positives = 53/114 (46%), Gaps = 9/114 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + +     AAH L  +    KC  +HGH++ + +          G V DF +I+Q     
Sbjct: 4   VIKRMEVSAAHSL-NLSYQSKCENLHGHNWIITVYCRAKELNADGMVVDFSHIKQTVK-- 60

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            EKLDH  +NE+    NPTAEN+A WI  ++         V V E+  +   Y+
Sbjct: 61  -EKLDHRNINEVLPF-NPTAENMARWICSQI----PACFKVEVQESESNIAIYE 108


>gi|293390437|ref|ZP_06634771.1| queuosine biosynthesis protein QueD [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290950971|gb|EFE01090.1| queuosine biosynthesis protein QueD [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 141

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/141 (26%), Positives = 75/141 (53%), Gaps = 29/141 (20%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGD---VDPKTGFVDDFFNIEQ 57
            K+++ F+F+ AH L       KC  +HGH+Y++++ + GD      K G V DF ++++
Sbjct: 2   FKVSKEFSFDMAHLLDG--HDGKCQNLHGHTYKLQVEVRGDLYQEGAKQGMVIDFSDLKK 59

Query: 58  YFSPLL-EKLDHHCLNE------------IEELEN--------PTAENIAIWIWKRLS-- 94
             +  + E +DH  + +            +++L++         TAE +A +I+ +L   
Sbjct: 60  TVNHTILEPMDHAFIYDQTSERESKIAALLQQLDSKTFGVPFRTTAEQLAQFIFNQLKYQ 119

Query: 95  TSLSILSSVRVYETPMSWVEY 115
            +L  +S++R++ETP S+ EY
Sbjct: 120 KNLP-VSAIRLWETPTSFCEY 139


>gi|88812689|ref|ZP_01127936.1| hypothetical protein NB231_00850 [Nitrococcus mobilis Nb-231]
 gi|88790105|gb|EAR21225.1| hypothetical protein NB231_00850 [Nitrococcus mobilis Nb-231]
          Length = 127

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 41/113 (36%), Positives = 63/113 (55%), Gaps = 8/113 (7%)

Query: 9   FEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDH 68
           F A+H L   P   KC R+HGH++ VE+ +E     + G   DF  ++     ++E +DH
Sbjct: 13  FSASHILEGHP--GKCSRLHGHNWSVEVEVEARELDRLGMAIDFAELKAATRQIVETMDH 70

Query: 69  HCLNEIEELE--NPTAENIAIWIWKRLSTSL----SILSSVRVYETPMSWVEY 115
             LN++ E    NPTAE++A  I++ L T L    + LS+V V+ET  + V Y
Sbjct: 71  RHLNDLPEFAGINPTAEHVAGAIYRALRTWLSGHHARLSAVTVWETAHARVRY 123


>gi|163783744|ref|ZP_02178730.1| hypothetical protein HG1285_01568 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880990|gb|EDP74508.1| hypothetical protein HG1285_01568 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 114

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 35/114 (30%), Positives = 53/114 (46%), Gaps = 5/114 (4%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           I     F AAH L           +HGH++ VE+ ++     + G   DF  I+++    
Sbjct: 5   IRVKRKFNAAHFLTDY--HGSPEPLHGHTWEVEVYIDAHELDRGGMGIDFVEIDRFLQET 62

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
           L   D+  LNE+ E  +P+AEN+A W++  L      L  V V+ET     EY 
Sbjct: 63  LP--DYRLLNEVFEF-SPSAENVARWLYGVLKDRYPALRKVVVWETENCGAEYY 113


>gi|303229330|ref|ZP_07316120.1| queuosine biosynthesis protein QueD [Veillonella atypica
           ACS-134-V-Col7a]
 gi|302515866|gb|EFL57818.1| queuosine biosynthesis protein QueD [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 112

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/114 (27%), Positives = 54/114 (47%), Gaps = 7/114 (6%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++     A+H+L ++    KC  +HGH++ + +    +     G V DF  I++     
Sbjct: 4   VSKRLEVSASHQL-QLDYPSKCQNLHGHNWIITVHARSEELDHNGMVIDFTIIKEKIH-- 60

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
             +LDH  +N++    NPTAEN+A WI   L         V V E+  +   Y+
Sbjct: 61  -GRLDHKHINDVLGGINPTAENMAKWIADELG---PKCFKVEVQESEGNVAIYE 110


>gi|258646636|ref|ZP_05734105.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Dialister invisus
           DSM 15470]
 gi|260404057|gb|EEW97604.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Dialister invisus
           DSM 15470]
          Length = 109

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/116 (32%), Positives = 54/116 (46%), Gaps = 9/116 (7%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             +T+      AH L R+    KC  MHGH++ V + ++ D   + G V DF  I+    
Sbjct: 2   FTVTKRMEISGAHFL-RLNYESKCTSMHGHNWIVTVTVQNDKLDENGMVVDFTKIKDIV- 59

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
                 DH C N+I E  NPTAEN+A W+  R+         V V ET  +   Y+
Sbjct: 60  ---NLFDHRCANDIMEGLNPTAENMAKWLCDRI----PHCIRVAVQETEGNTAVYE 108


>gi|261867763|ref|YP_003255685.1| queuosine biosynthesis protein QueD [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261413095|gb|ACX82466.1| queuosine biosynthesis protein QueD [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 141

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/141 (26%), Positives = 75/141 (53%), Gaps = 29/141 (20%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGD---VDPKTGFVDDFFNIEQ 57
            K+++ F+F+ AH L       KC  +HGH+Y++++ + GD      K G V DF ++++
Sbjct: 2   FKVSKEFSFDMAHLLDG--HDGKCQNLHGHTYKLQVEVRGDLYQEGAKQGMVIDFSDLKK 59

Query: 58  YFSPLL-EKLDHHCLNE------------IEELEN--------PTAENIAIWIWKRLS-- 94
             +  + E +DH  + +            +++L++         TAE +A +I+ +L   
Sbjct: 60  IVNHAILEPMDHAFIYDQTSERESKIASLLQQLDSKTFGVPFRTTAEQLAQFIFNQLKYQ 119

Query: 95  TSLSILSSVRVYETPMSWVEY 115
            +L  +S++R++ETP S+ EY
Sbjct: 120 KNLP-VSAIRLWETPTSFCEY 139


>gi|148264176|ref|YP_001230882.1| putative 6-pyruvoyl tetrahydropterin synthase [Geobacter
           uraniireducens Rf4]
 gi|146397676|gb|ABQ26309.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Geobacter uraniireducens Rf4]
          Length = 122

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 35/121 (28%), Positives = 60/121 (49%), Gaps = 8/121 (6%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           K+    +F AAH L        C  +HGH+++VE+ +      K G   DF  ++   + 
Sbjct: 3   KLKVETSFAAAHCLIHYQGD--CENLHGHNWKVEVTVTAMELDKAGLGIDFKILKGETNT 60

Query: 62  LLEKLDHHCLNEIEEL--ENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEY 115
           LL+ LDH  LNE+      +P++ENIA ++++ L+   +     L  V V+E+  +   Y
Sbjct: 61  LLKTLDHKYLNELPPFIESSPSSENIARYLYRELANKFNNGNVKLDMVTVWESDFASASY 120

Query: 116 Q 116
            
Sbjct: 121 Y 121


>gi|121608215|ref|YP_996022.1| putative 6-pyruvoyl tetrahydropterin synthase [Verminephrobacter
           eiseniae EF01-2]
 gi|121552855|gb|ABM57004.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Verminephrobacter eiseniae EF01-2]
          Length = 128

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 58/105 (55%), Gaps = 1/105 (0%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           I+Q F F+AAH L R  +     R+HGH+Y  E+ + G  DP TG V D   + Q    +
Sbjct: 5   ISQRFFFDAAHTLRREIEAEGSRRVHGHTYHAEVALTGACDPATGMVLDLGLLRQGLERV 64

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS-ILSSVRVY 106
             +LDHH L+++  L  PT EN+ ++I + L   L    S VRV+
Sbjct: 65  RAQLDHHMLDDVPGLGPPTLENLCVFIARALPDELRWRASRVRVW 109


>gi|319901440|ref|YP_004161168.1| 6-pyruvoyl tetrahydropterin synthase [Bacteroides helcogenes P
           36-108]
 gi|319416471|gb|ADV43582.1| 6-pyruvoyl tetrahydropterin synthase [Bacteroides helcogenes P
           36-108]
          Length = 110

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/114 (28%), Positives = 54/114 (47%), Gaps = 9/114 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + +     AAH L ++    KC  +HGH++ + +          G V DF +I++     
Sbjct: 4   VIKRMEVSAAHSL-QLSYRSKCENLHGHNWIITVYCRSKELNADGMVIDFSHIKKVVK-- 60

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            E++DH  LN++    NPTAENIA W+  R+         V V E+  +   Y+
Sbjct: 61  -EQMDHRNLNDVFPF-NPTAENIARWVCDRI----PSCFKVEVQESESNTAIYE 108


>gi|75908718|ref|YP_323014.1| putative 6-pyruvoyl tetrahydropterin synthase [Anabaena variabilis
           ATCC 29413]
 gi|75702443|gb|ABA22119.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Anabaena variabilis ATCC 29413]
          Length = 290

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 42/130 (32%), Positives = 66/130 (50%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T +  F AAHRL     +         KC R HGH  +Y +E+ ++G++DP+TG + D 
Sbjct: 138 LTISTHFSAAHRLAHPNLSQEDNTEIYGKCARPHGHGHNYHLEVTVKGEIDPRTGMIIDL 197

Query: 53  FNIEQYFSPL-LEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSL----SILSSVR 104
             + Q      +E  DH  LN +I       PTAENIA++I   L + +    + L  V+
Sbjct: 198 GALNQAIEDYVVEPFDHTFLNKDIPYFAEVVPTAENIALYISNLLRSPVQELGAKLYKVK 257

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 258 LIESPNNSCE 267



 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 39/129 (30%), Positives = 63/129 (48%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           + +   F A+HR           + K   C R   HGH+Y + + + G+   + G V + 
Sbjct: 5   VNRRAQFSASHRYWLPELSEAENIEKFGACSRFPGHGHNYVIFISLAGE-LDEYGMVLNL 63

Query: 53  FNIEQYF-SPLLEKLDHHCLNEI-EELEN--PTAENIAIWIWKRLSTSLSILSSVRVYET 108
            +++Q     +  +LD   LN++  E     PT ENIA  IW+RL+  L  L  V+++E 
Sbjct: 64  SDVKQVIKREVTSQLDFSYLNDVWAEFGQTLPTTENIARVIWQRLAPHLP-LVRVQLFEH 122

Query: 109 PMSWVEYQG 117
           P  W +YQG
Sbjct: 123 PELWADYQG 131


>gi|67921619|ref|ZP_00515137.1| 6-pyruvoyltetrahydropterin synthase [Crocosphaera watsonii WH 8501]
 gi|67856731|gb|EAM51972.1| 6-pyruvoyltetrahydropterin synthase [Crocosphaera watsonii WH 8501]
          Length = 291

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 43/129 (33%), Positives = 67/129 (51%), Gaps = 19/129 (14%)

Query: 8   TFEAAHRLPRVPKT--------HKCHR--MHGHSYRVELVMEGDVDPKTGFVDDFFNIEQ 57
            F AAHRL R   +         KC R   HGH+Y +E+ + GD+DP+TG + D   ++ 
Sbjct: 143 HFSAAHRLARPDLSLEENTKIYGKCARTHGHGHNYHLEVSVSGDIDPRTGMLVDLVALQN 202

Query: 58  YFSPL-LEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSL----SILSSVRVYETP 109
             +   +E  DH+ LN ++       PTAENIA++I + L   +    + L  V++ E+P
Sbjct: 203 IVNDYVVEPFDHNFLNKDVPYFAEVVPTAENIALYIAQLLQQPIRELGAQLEKVKLIESP 262

Query: 110 MSWVE-YQG 117
            +  E Y G
Sbjct: 263 NNSCEIYCG 271



 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 41/129 (31%), Positives = 65/129 (50%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           I +   F A HR                 C R   HGH+Y + + + G++D + G V++ 
Sbjct: 5   INRRAQFSANHRYWLPEWDESKNQQAFGLCSRFPGHGHNYVLFVSLLGEID-QYGMVENL 63

Query: 53  FNIEQYF-SPLLEKLDHHCLNEI-EELEN--PTAENIAIWIWKRLSTSLSILSSVRVYET 108
             ++Q     +  +LD+  LN++ EE +   PT ENIA  IW+RL   L I+  ++++E 
Sbjct: 64  STVKQVIKREVTSQLDYAYLNDVWEEFQTTLPTTENIARVIWQRLKDHLPIV-KIQLFEH 122

Query: 109 PMSWVEYQG 117
           P  W EYQG
Sbjct: 123 PQLWAEYQG 131


>gi|251792176|ref|YP_003006896.1| queuosine biosynthesis protein QueD [Aggregatibacter aphrophilus
           NJ8700]
 gi|247533563|gb|ACS96809.1| queuosine biosynthesis protein QueD [Aggregatibacter aphrophilus
           NJ8700]
          Length = 141

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/142 (26%), Positives = 74/142 (52%), Gaps = 29/142 (20%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGD---VDPKTGFVDDFFNIEQ 57
            K+++ F+F+ AH L       KC  +HGH+Y++++ + GD      K G V DF +++ 
Sbjct: 2   FKVSKEFSFDMAHLLDG--HDGKCQNLHGHTYKLQVEVCGDLYSSGAKQGMVIDFSDLKS 59

Query: 58  YFSPLL-EKLDHHCLNE------------IEELEN--------PTAENIAIWIWKRLSTS 96
                + + +DH  + +            +++L++         TAE +A +I++RL   
Sbjct: 60  IVKRAVLDPMDHAFIYDQTSERESKIAILLQQLDSKTFGVPFRTTAEQLAQFIYRRLKDE 119

Query: 97  --LSILSSVRVYETPMSWVEYQ 116
             L  +S++R++ETP S+ EY+
Sbjct: 120 ENLP-VSAIRLWETPTSFCEYE 140


>gi|33862437|ref|NP_893997.1| 6-pyruvoyl tetrahydropterin synthase [Prochlorococcus marinus str.
           MIT 9313]
 gi|33640550|emb|CAE20339.1| 6-pyruvoyl tetrahydropterin synthase [Prochlorococcus marinus str.
           MIT 9313]
          Length = 306

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 44/130 (33%), Positives = 67/130 (51%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL RV  +         KC R HGH  +Y V++ + G++D +TG V D 
Sbjct: 156 LTIRTHFAAAHRLARVELSQEENERIYGKCARPHGHGHNYFVDVTVRGEIDSRTGMVCDL 215

Query: 53  FNIEQYFSPL-LEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSL----SILSSVR 104
             ++   + + +E  DH  LN +I    N   TAENIA++I   L+  +    + L  VR
Sbjct: 216 GALQSLVNDIVVEPFDHTFLNKDIPHFANCVPTAENIALYISDCLAKPIRAIGAHLHKVR 275

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 276 LQESPNNAAE 285



 Score = 81.4 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 38/134 (28%), Positives = 59/134 (44%), Gaps = 21/134 (15%)

Query: 3   ITQAFTFEAAHR--LPRVPKTHKCHRM--------HGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+  TF A+HR  LP +       R         HGH+Y + + M G      G V + 
Sbjct: 18  ITRKATFSASHRYYLPELSSDDNAARFGLCALPAGHGHNYELIVAMAG-GLNVDGMVLNL 76

Query: 53  FNIEQYFS-PLLEKLDHHCLNEI-EELE-------NPTAENIAIWIWKRLSTSLSILSSV 103
             ++      + ++LD   LN++  E +        PT E +   IW RL   L I+ ++
Sbjct: 77  SEVKHAIRSEVTDQLDFRFLNDVWPEFDLSRPEGCLPTTEALLRIIWTRLMPHLPIV-AI 135

Query: 104 RVYETPMSWVEYQG 117
           R+YE    W +Y G
Sbjct: 136 RLYEQENLWADYHG 149


>gi|160888846|ref|ZP_02069849.1| hypothetical protein BACUNI_01265 [Bacteroides uniformis ATCC 8492]
 gi|270293622|ref|ZP_06199824.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|317479411|ref|ZP_07938545.1| queuosine biosynthesis protein QueD [Bacteroides sp. 4_1_36]
 gi|156861745|gb|EDO55176.1| hypothetical protein BACUNI_01265 [Bacteroides uniformis ATCC 8492]
 gi|270275089|gb|EFA20949.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|316904485|gb|EFV26305.1| queuosine biosynthesis protein QueD [Bacteroides sp. 4_1_36]
          Length = 110

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 37/114 (32%), Positives = 55/114 (48%), Gaps = 9/114 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + +     AAH L ++    KC  +HGH++ + +          G V DF +I+Q     
Sbjct: 4   VIKRMEVSAAHSL-KLSYRSKCENLHGHNWIITVYCRSKELNADGMVVDFSHIKQVVK-- 60

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            E+LDHH LNE+    NPTAENIA WI  ++         V V E+  +   Y+
Sbjct: 61  -EQLDHHNLNEVLSF-NPTAENIARWICDQI----PTCFKVEVQESESNIAVYE 108


>gi|189500519|ref|YP_001959989.1| hypothetical protein Cphamn1_1587 [Chlorobium phaeobacteroides BS1]
 gi|189495960|gb|ACE04508.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Chlorobium phaeobacteroides BS1]
          Length = 149

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 39/136 (28%), Positives = 65/136 (47%), Gaps = 21/136 (15%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHR--MHGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+   F AAHRL     +         KC     HGH+Y +E+ + G +D  TGF+ D 
Sbjct: 13  VTRTVEFNAAHRLYNPDLSEDENLNIYGKCSNARGHGHNYELEITVSGVIDNVTGFLLDM 72

Query: 53  FNIEQYF-SPLLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSLSI-------LS 101
             ++      ++ + DH  LN ++EEL N   + E + + +W  LS +L         L 
Sbjct: 73  KELKMILEKEIMVRFDHKHLNFDVEELRNCVPSTEILTVTVWDILSNALRKYNHNDLTLH 132

Query: 102 SVRVYETPMSWVEYQG 117
            + ++ET  + V Y+G
Sbjct: 133 EITIHETRKNSVRYRG 148


>gi|218129818|ref|ZP_03458622.1| hypothetical protein BACEGG_01398 [Bacteroides eggerthii DSM 20697]
 gi|317475834|ref|ZP_07935091.1| queuosine biosynthesis protein QueD [Bacteroides eggerthii
           1_2_48FAA]
 gi|217987928|gb|EEC54253.1| hypothetical protein BACEGG_01398 [Bacteroides eggerthii DSM 20697]
 gi|316907994|gb|EFV29691.1| queuosine biosynthesis protein QueD [Bacteroides eggerthii
           1_2_48FAA]
          Length = 110

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/114 (31%), Positives = 54/114 (47%), Gaps = 9/114 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + +     AAH L ++    KC  +HGH++ + +          G V DF +I+Q     
Sbjct: 4   VIKRMEVSAAHSL-KLSYQSKCENLHGHNWIITVFCRSKELNSDGMVVDFSHIKQAVK-- 60

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            EKLDH  +NE+    NPTAENIA WI  ++         V V E+  +   Y+
Sbjct: 61  -EKLDHRNINEVLPF-NPTAENIARWICDQI----PTCFKVEVQESESNIAVYE 108


>gi|303230729|ref|ZP_07317476.1| queuosine biosynthesis protein QueD [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302514489|gb|EFL56484.1| queuosine biosynthesis protein QueD [Veillonella atypica
           ACS-049-V-Sch6]
          Length = 112

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/114 (27%), Positives = 53/114 (46%), Gaps = 7/114 (6%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++     A+H+L ++    KC  +HGH++ + +    +     G V DF  I++     
Sbjct: 4   VSKRLEVSASHQL-QLDYPSKCQNLHGHNWIITVHARSEELDHNGMVIDFTIIKEKIHGC 62

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
              LDH  +N++    NPTAEN+A WI   L         V V E+  +   Y+
Sbjct: 63  ---LDHKHINDVLGGINPTAENMAKWIADELG---PKCFKVEVQESEGNVAIYE 110


>gi|294793986|ref|ZP_06759123.1| queuosine biosynthesis protein QueD [Veillonella sp. 3_1_44]
 gi|294455556|gb|EFG23928.1| queuosine biosynthesis protein QueD [Veillonella sp. 3_1_44]
          Length = 112

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 32/116 (27%), Positives = 54/116 (46%), Gaps = 7/116 (6%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             +T+     A+H+L ++    KC  +HGH++ + +          G V DF  +++   
Sbjct: 2   FTVTKRLEVSASHQL-KLDYPSKCQNLHGHNWIITVHARSKELDHNGMVIDFTIVKEKIH 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
               +LDH  +N++    NPTAEN+A WI   L    S    V V E+  +   Y+
Sbjct: 61  ---GRLDHRHINDVLGDINPTAENMAKWIADELG---SKCFKVEVQESEGNTAIYE 110


>gi|172035409|ref|YP_001801910.1| 6-pyruvoyl tetrahydropterin synthase [Cyanothece sp. ATCC 51142]
 gi|171696863|gb|ACB49844.1| 6-pyruvoyl tetrahydropterin synthase [Cyanothece sp. ATCC 51142]
          Length = 291

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 43/134 (32%), Positives = 65/134 (48%), Gaps = 19/134 (14%)

Query: 3   ITQAFTFEAAHRL--------PRVPKTHKCHR--MHGHSYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL               KC R   HGH+Y +E+ + G++DP+TG + D 
Sbjct: 138 LTIQTHFSAAHRLALPHLSLEENTEIYGKCARTHGHGHNYHLEVSVSGEIDPRTGMIVDL 197

Query: 53  FNIEQYFSPL-LEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVR 104
             ++       +E  DH+ LN +I       PTAENIA++I + L   +      L  V+
Sbjct: 198 GKLQTIVEDYVVEPFDHNFLNKDIPYFAEVVPTAENIALYIAQLLEKPIKDLGVQLEKVK 257

Query: 105 VYETPMSWVE-YQG 117
           + E+P +  E Y G
Sbjct: 258 LIESPNNSCEIYCG 271



 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 39/129 (30%), Positives = 66/129 (51%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           I +   F A+HR                 C     HGH+Y + + + G++D + G V++ 
Sbjct: 5   INRRAQFSASHRYWIPEWDEAKNKQVFGACSHFPGHGHNYVLFVSLWGEID-QYGMVENL 63

Query: 53  FNIEQYFS-PLLEKLDHHCLNEI-EELEN--PTAENIAIWIWKRLSTSLSILSSVRVYET 108
             ++Q     +  +LD+  LN++ EE +   PT EN+A  IW+RL+  L I+  ++++E 
Sbjct: 64  STVKQVIKGEVTSQLDYAYLNDVWEEFQTTLPTTENLARVIWQRLADHLPIV-KIQLFEH 122

Query: 109 PMSWVEYQG 117
           P  W EYQG
Sbjct: 123 PQLWAEYQG 131


>gi|325954616|ref|YP_004238276.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Weeksella virosa DSM 16922]
 gi|323437234|gb|ADX67698.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Weeksella virosa DSM 16922]
          Length = 152

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 40/143 (27%), Positives = 71/143 (49%), Gaps = 30/143 (20%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEG-----DVDPKTGFVDDFFNI 55
           +++++AFTFE AH L       KC  +HGHSY++ + ++G     + D K G V DF ++
Sbjct: 4   IRLSKAFTFETAHALYGYD--GKCKNIHGHSYKLYVTLKGQPSEKEGDVKLGMVMDFGDL 61

Query: 56  EQYFSP-LLEKLDHH-CLNEIEELE------------------NPTAENIAIWIWKRLST 95
           ++  +  +++  DH   LNE    +                   P+ EN+ +WI  +L  
Sbjct: 62  KKIVNKAVVDIFDHAILLNENSPHKSLGDQLLAEGHKVIFTAYQPSCENMILWIVDQLKP 121

Query: 96  SLS---ILSSVRVYETPMSWVEY 115
            L     L ++++YET  S+ E+
Sbjct: 122 LLPSHTELVALKLYETENSYCEW 144


>gi|73667684|ref|YP_303699.1| 6-pyruvoyltetrahydropterin synthase [Methanosarcina barkeri str.
           Fusaro]
 gi|72394846|gb|AAZ69119.1| 6-pyruvoyltetrahydropterin synthase [Methanosarcina barkeri str.
           Fusaro]
          Length = 117

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 41/118 (34%), Positives = 65/118 (55%), Gaps = 6/118 (5%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M++      ++AH LP      KC R+HGH+Y++E+++EG+V  + G V DF+++++   
Sbjct: 4   MRLGVIDYIDSAHYLPG---HGKCGRVHGHTYKIEVLVEGEV-RENGMVIDFYDLKKGIK 59

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQGF 118
             LE+ DH  LNEI E   P++E++   I  RL         VRV+E    W E   F
Sbjct: 60  ETLEEYDHILLNEILEF--PSSEHLCQHIHSRLYKRFGFPLQVRVWEGEGKWCEMDNF 115


>gi|148253794|ref|YP_001238379.1| putative 6-pyruvoyltetrahydropterin synthase [Bradyrhizobium sp.
           BTAi1]
 gi|146405967|gb|ABQ34473.1| putative 6-pyruvoyltetrahydropterin synthase [Bradyrhizobium sp.
           BTAi1]
          Length = 118

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 41/115 (35%), Positives = 63/115 (54%), Gaps = 2/115 (1%)

Query: 4   TQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLL 63
           T++FTFEAAH L           +HGHS+R E+ + G  DP TG V DF  + Q    + 
Sbjct: 2   TKSFTFEAAHALAHTTLGEASQEIHGHSFRAEVTVRGTPDPTTGMVVDFGLLTQRLGEIQ 61

Query: 64  EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYE-TPMSWVEYQG 117
             LDH  LN+IE +  PT EN++ +I++R+ + +  ++ V V+  +      Y G
Sbjct: 62  AMLDHKFLNKIEAIGLPTLENLSRFIYERVRS-IGHVTKVSVHRDSCRETCTYFG 115


>gi|167856372|ref|ZP_02479099.1| conserved possible 6-pyruvoyl tetrahydrobiopterin synthase
           [Haemophilus parasuis 29755]
 gi|167852510|gb|EDS23797.1| conserved possible 6-pyruvoyl tetrahydrobiopterin synthase
           [Haemophilus parasuis 29755]
          Length = 140

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 38/139 (27%), Positives = 71/139 (51%), Gaps = 26/139 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGD---VDPKTGFVDDFFNIE- 56
            KI + F+F+ AH L       KC  +HGH+Y +++ + G+      K+G V D+ +++ 
Sbjct: 2   FKIAKEFSFDMAHMLDG--HDGKCKNLHGHTYTLQVEIAGELHTDGAKSGMVMDYSDLKV 59

Query: 57  QYFSPLLEKLDHHCLNE------------IEELEN--------PTAENIAIWIWKRLSTS 96
                +L+K+DH  + +            ++ L++         TAE +A +I+  L+T 
Sbjct: 60  AVKQHILDKMDHAFIYDSTSEKECKVATLLQSLDSKTFGIPARTTAEQMAKYIFDTLTTE 119

Query: 97  LSILSSVRVYETPMSWVEY 115
              +S +R++ETP S+ EY
Sbjct: 120 GLPVSLIRLWETPTSYCEY 138


>gi|300866723|ref|ZP_07111407.1| conserved hypothetical protein [Oscillatoria sp. PCC 6506]
 gi|300335323|emb|CBN56567.1| conserved hypothetical protein [Oscillatoria sp. PCC 6506]
          Length = 294

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 39/130 (30%), Positives = 67/130 (51%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           +T +  F AAHRL     +         KC     HGH+Y +E+ ++G++D +TG + D 
Sbjct: 138 LTISTHFSAAHRLAHPKLSYEENCEIYGKCARPNGHGHNYHLEVTVKGEMDERTGMIVDL 197

Query: 53  FNIEQYFSPLL-EKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSL----SILSSVR 104
             +++     + + LDH  LN +I       PTAENIAI+I + L + +    + L  ++
Sbjct: 198 GALQKAIDEYVLDPLDHTFLNKDIAYFAEVVPTAENIAIYIRELLRSPIRELGAQLYKIK 257

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 258 LIESPNNSCE 267



 Score = 84.1 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 38/129 (29%), Positives = 58/129 (44%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHR--MHGHSYRVELVMEGDVDPKTGFVDDF 52
           I +   F A+HR             +     R   HGH+Y + + M G+     G V + 
Sbjct: 5   INRRAQFSASHRYWLPELSAAENSDRFGPTARAPGHGHNYVLYVSMIGE-LDSYGMVLNL 63

Query: 53  FNIEQYF-SPLLEKLDHHCLNEI-EELEN--PTAENIAIWIWKRLSTSLSILSSVRVYET 108
            N++      +   LD   LN+   E E   PT ENIA  IW+RL+  L  L+ ++++E 
Sbjct: 64  SNVKHVIKREVTNHLDFSYLNQAWPEFEQTLPTTENIARVIWQRLAPHLP-LTRIQLFEH 122

Query: 109 PMSWVEYQG 117
           P  W +Y G
Sbjct: 123 PELWADYLG 131


>gi|189424904|ref|YP_001952081.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Geobacter lovleyi SZ]
 gi|189421163|gb|ACD95561.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Geobacter lovleyi SZ]
          Length = 122

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 63/121 (52%), Gaps = 8/121 (6%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++T    F AAH L        C  +HGH+++VE+ +      + G   DF  +++  + 
Sbjct: 3   RLTIKTGFAAAHNLINYQGD--CENLHGHNWKVEVTVTASELDQAGLAIDFKLLKRETNA 60

Query: 62  LLEKLDHHCLNEIEELEN--PTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEY 115
           LL++LDH  +N+     +  P++ENI+ ++++ LS  L+     +  + V+E+  +  EY
Sbjct: 61  LLDELDHKYVNQHHFFLDLSPSSENISRYLFQELSKRLNDGNVKVERIGVWESDNACAEY 120

Query: 116 Q 116
            
Sbjct: 121 Y 121


>gi|33239579|ref|NP_874521.1| 6-pyruvoyl tetrahydropterin synthase [Prochlorococcus marinus
           subsp. marinus str. CCMP1375]
 gi|33237104|gb|AAP99173.1| 6-pyruvoyl-tetrahydropterin synthase [Prochlorococcus marinus
           subsp. marinus str. CCMP1375]
          Length = 302

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 43/130 (33%), Positives = 65/130 (50%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL R   +         KC     HGH+Y VE+ ++G +D +TG + D 
Sbjct: 156 LTIKKHFSAAHRLAREELSQKENEMIYGKCARTNGHGHNYFVEITVKGTIDKRTGMLCDL 215

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSL----SILSSVR 104
            ++EQ     ++E  DH  LN +I    N   TAENIA+ I   L+  +    + L  +R
Sbjct: 216 ASLEQLVEDLVIEPFDHTFLNKDITHFSNCVPTAENIALHIADILNNPIHSIGASLHKIR 275

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 276 LQESPNNAAE 285



 Score = 78.7 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 38/134 (28%), Positives = 55/134 (41%), Gaps = 21/134 (15%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F A+H+             +  KC     HGH+Y + + M G      G V + 
Sbjct: 18  ITRRALFSASHQYSLPELSANDNSKQFGKCAIPPGHGHNYELIVSMAGS-LNVDGMVLNL 76

Query: 53  FNIEQYFSPL-LEKLDHHCLNEI-EELEN-------PTAENIAIWIWKRLSTSLSILSSV 103
             ++         +LD  CLN+   E +        PT E +   IW RL   L  L S+
Sbjct: 77  SEVKHAIKQQVTSQLDFRCLNQTWPEFDMSKPEGCLPTTEALTRIIWNRLKCYLP-LVSL 135

Query: 104 RVYETPMSWVEYQG 117
           R+YE P  W +Y G
Sbjct: 136 RLYEQPSLWADYLG 149


>gi|118580206|ref|YP_901456.1| putative 6-pyruvoyl tetrahydropterin synthase [Pelobacter
           propionicus DSM 2379]
 gi|118502916|gb|ABK99398.1| preQ(0) biosynthesis protein QueD [Pelobacter propionicus DSM 2379]
          Length = 122

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 63/121 (52%), Gaps = 8/121 (6%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           K+T   +F AAH L        C  +HGH+++V++ +      K G   DF  +++    
Sbjct: 3   KLTIRTSFAAAHNLVNYQGD--CENLHGHNWKVDVAVIARQLDKAGLGIDFKVLKREAGV 60

Query: 62  LLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEY 115
           ++ +LDH  LN+       +P++E+I+ ++++RLS  L+     + SV V+E+  +   Y
Sbjct: 61  VINELDHKYLNDNPAFAGISPSSEHISRFLFERLSEHLNSDVIKVESVTVWESDNASACY 120

Query: 116 Q 116
            
Sbjct: 121 Y 121


>gi|94986702|ref|YP_594635.1| F0F1-type ATP synthase, subunit c [Lawsonia intracellularis
           PHE/MN1-00]
 gi|94730951|emb|CAJ54314.1| F0F1-type ATP synthase, subunit c [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 126

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 34/99 (34%), Positives = 52/99 (52%), Gaps = 5/99 (5%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVD-PKTGFVDDFFNIEQYFSP 61
           +T    F AAH L       KC R+HGH+Y +++++ G      T  + DF  ++     
Sbjct: 8   LTVRSEFCAAHALRHYK--GKCERLHGHNYGIKIIVGGHELTSDTELLIDFTELKAILKD 65

Query: 62  LLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLS 98
           +LE LDH  LN I   +  NP+AEN+A +IW+ +   L 
Sbjct: 66  VLEPLDHRYLNNIPPFDQINPSAENLARYIWQNVKKRLP 104


>gi|163856913|ref|YP_001631211.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Bordetella petrii
           DSM 12804]
 gi|163260641|emb|CAP42943.1| Putative 6-pyruvoyl tetrahydrobiopterin synthase [Bordetella
           petrii]
          Length = 147

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 41/148 (27%), Positives = 64/148 (43%), Gaps = 33/148 (22%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDP-----KTGFVDDFFNI 55
           + +T+   F+A HR+P      +C  +HGH Y +E+ +EGDV         G + DF  I
Sbjct: 2   ISVTRRLEFDAGHRIP--DHRSQCRNLHGHRYVLEVTLEGDVADAPGASHNGMLMDFSEI 59

Query: 56  EQY-FSPLLEKLDHH------------CLNEIEELEN------PTAENIAIWIWKRLSTS 96
           +      +++  DH              L+ +   +       PTAEN+A  I+  L+  
Sbjct: 60  KAIAKRHIVDPWDHAFLVYRDDAAVRGFLDTLPGHKTVVLDCIPTAENLARVIFAALAPH 119

Query: 97  LS-------ILSSVRVYETPMSWVEYQG 117
                     LS VR+YETP  W +  G
Sbjct: 120 YHGHYGAQLRLSRVRLYETPNCWADCSG 147


>gi|57641054|ref|YP_183532.1| 6-pyruvoyl-tetrahydropterin synthase [Thermococcus kodakarensis
           KOD1]
 gi|57159378|dbj|BAD85308.1| 6-pyruvoyl-tetrahydropterin synthase [Thermococcus kodakarensis
           KOD1]
          Length = 115

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 38/118 (32%), Positives = 67/118 (56%), Gaps = 10/118 (8%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ + F FEAAH    V    +   +HGH++R+E+ +EG +  K G+V DF  + +    
Sbjct: 4   RVVERFKFEAAHA---VIIDGQAEEIHGHTFRLEVAVEGPL--KNGYVMDFLELRRIVEN 58

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLS---ILSSVRVYETPMSWVEYQ 116
           ++++LDH  LN +   +NPT ENIA+WI + +   L     L  + ++E   + VE++
Sbjct: 59  IIKELDHKNLNSL--FKNPTTENIALWIAEEIQEKLPGGVQLKRIVLWEGDENGVEFE 114


>gi|281358521|ref|ZP_06245001.1| 6-pyruvoyl tetrahydropterin synthase [Victivallis vadensis ATCC
           BAA-548]
 gi|281315003|gb|EFA99036.1| 6-pyruvoyl tetrahydropterin synthase [Victivallis vadensis ATCC
           BAA-548]
          Length = 123

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 63/122 (51%), Gaps = 8/122 (6%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            +I    +F AAH+L        C ++HGH+Y++ + +      + G   DF  ++    
Sbjct: 2   FEIEIDRSFSAAHQLRGY--NGDCCKLHGHNYKITVTVRSSELDEIGIALDFKKLKAELD 59

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
            LL + DH  L+E+ + +  NPT+EN+A  I++++S  ++     +  VRV E+  S V 
Sbjct: 60  ALLAEYDHSNLSELADFQAVNPTSENLARTIYRKISEKMNSGTIRVHRVRVGESDHSAVT 119

Query: 115 YQ 116
           Y 
Sbjct: 120 YF 121


>gi|294498042|ref|YP_003561742.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus megaterium QM
           B1551]
 gi|295703392|ref|YP_003596467.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus megaterium DSM
           319]
 gi|294347979|gb|ADE68308.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus megaterium QM
           B1551]
 gi|294801051|gb|ADF38117.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus megaterium DSM
           319]
          Length = 146

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 60/124 (48%), Gaps = 10/124 (8%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ +   F AAH +P   +  KC ++HGH+Y V L + GD   + GF+ +F  +++  S 
Sbjct: 16  ELNKDMQFAAAHFVPH-TEAGKCRQVHGHTYFVNLTVAGDTLDEAGFLVNFALLKKIVSG 74

Query: 62  LLEKL---DHHCLNEIEELENPTAENIAIWIWKRLSTSL------SILSSVRVYETPMSW 112
             +     DH   NE    + PT E +A  I++ +   L           V V ETP S+
Sbjct: 75  QFDHTLLNDHSIFNEENPNDFPTTEVVARKIYELVQEYLDTLPNKPSCVQVFVRETPTSY 134

Query: 113 VEYQ 116
           V Y+
Sbjct: 135 VVYR 138


>gi|261417331|ref|YP_003251014.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Fibrobacter succinogenes subsp. succinogenes S85]
 gi|261373787|gb|ACX76532.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Fibrobacter succinogenes subsp. succinogenes S85]
 gi|302327012|gb|ADL26213.1| putative 6-pyruvoyl tetrahydrobiopterin synthase [Fibrobacter
           succinogenes subsp. succinogenes S85]
          Length = 109

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 35/115 (30%), Positives = 60/115 (52%), Gaps = 9/115 (7%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ +      AH+L  +P   KC  +HGH++ + +  + +   + G V DF  I++    
Sbjct: 3   RVIKRIEISGAHKL-SLPYESKCRGLHGHNWIITVFCQSETLDENGMVVDFSRIKEIVK- 60

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
              KLDH  LN++    NPTAEN+A WI +++         V+V E+  + VEY+
Sbjct: 61  --GKLDHQFLNDVVNF-NPTAENMARWICEQV----PHCYKVQVQESEGNTVEYE 108


>gi|78357240|ref|YP_388689.1| 6-pyruvoyl tetrahydrobiopterin synthase [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
 gi|78219645|gb|ABB38994.1| preQ(0) biosynthesis protein QueD [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 130

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 37/121 (30%), Positives = 59/121 (48%), Gaps = 9/121 (7%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVD-PKTGFVDDFFNIEQYFS 60
           ++T    F AAH L       KC  +HGH++ VE  +EG +  P T  + DF  ++    
Sbjct: 7   RLTVRSDFAAAHSLRNYC--GKCEALHGHNFGVEATVEGGILTPDTELLVDFKVLKNALK 64

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
            +L+ LDH  LNE    +  NP++EN+A  I++ ++  +      + SV V E       
Sbjct: 65  QVLDGLDHCVLNETPPFDTCNPSSENLARHIYRHMAPLVQPHGVRMHSVTVSEKQAQSAT 124

Query: 115 Y 115
           Y
Sbjct: 125 Y 125


>gi|123965354|ref|YP_001010435.1| 6-pyruvoyl tetrahydropterin synthase [Prochlorococcus marinus str.
           MIT 9515]
 gi|123199720|gb|ABM71328.1| 6-pyruvoyl tetrahydropterin synthase [Prochlorococcus marinus str.
           MIT 9515]
          Length = 308

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 39/130 (30%), Positives = 66/130 (50%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRL--------PRVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL               KC R+  HGH+Y +++ + G +DP+TG + D 
Sbjct: 156 LTIQSHFNAAHRLAKDEISLDENKKIYGKCARVNGHGHNYFLDVTVRGQIDPRTGMICDL 215

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSL----SILSSVR 104
            +++      ++E+ DH  LN +IE  +    T ENIA+ I   LS+ +    + L  ++
Sbjct: 216 PSLQTIIDDLVVEQFDHTFLNKDIEYFKTCVPTCENIALHISDILSSPIKNIGANLHKIK 275

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 276 LQESPNNAAE 285



 Score = 94.1 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 60/134 (44%), Gaps = 21/134 (15%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F ++HR                KC     HGH+Y + + M G+     G V + 
Sbjct: 18  ITRRACFSSSHRYWLPEKSLEDNFSLFGKCSIAPGHGHNYELIVSMGGE-LDSYGMVLNL 76

Query: 53  FNIEQYF-SPLLEKLDHHCLNEIEELEN--------PTAENIAIWIWKRLSTSLSILSSV 103
            +++    + + E+LD   LN++    N        PT E +   IW RL   L  L+++
Sbjct: 77  SDVKHSIKNKVTEQLDFRFLNDVWPEFNIHSHDGILPTTEALVKVIWNRLKDDLP-LTNI 135

Query: 104 RVYETPMSWVEYQG 117
           R+YE+P  W +Y G
Sbjct: 136 RLYESPTLWADYSG 149


>gi|255011038|ref|ZP_05283164.1| putative 6-pyruvoyl tetrahydropterin synthase [Bacteroides fragilis
           3_1_12]
          Length = 103

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 55/110 (50%), Gaps = 9/110 (8%)

Query: 7   FTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKL 66
               AAH+L  +P   KC  +HGH++ + +    +     G V DF  I+Q      EKL
Sbjct: 1   MEISAAHKLI-LPYRSKCATLHGHNWIITVYCRSERLNSDGMVVDFTQIKQTVK---EKL 56

Query: 67  DHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
           DH  LNE+    NPTAENIA W+ K++         V V E+  + V Y+
Sbjct: 57  DHQNLNEVLPF-NPTAENIARWVCKQI----PQCYKVEVQESEANTVIYE 101


>gi|311030029|ref|ZP_07708119.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus sp. m3-13]
 gi|311032349|ref|ZP_07710439.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus sp. m3-13]
          Length = 145

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 35/128 (27%), Positives = 61/128 (47%), Gaps = 17/128 (13%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ +     AAH +P      KC ++HGH+Y V + + GD   + GF+ +F  +++    
Sbjct: 16  ELNKDMQIAAAHFVP-TDAAGKCRQLHGHTYFVNVTVAGDALDEAGFLVNFQILKKLLH- 73

Query: 62  LLEKLDHHCLNEIEELEN-------PTAENIAIWIWKRLSTSL------SILSSVRVYET 108
             +K DH  LN+ +++ N       PT E +A  +W+ +   L           V V ET
Sbjct: 74  --DKFDHTVLNDHKDVFNDEDPNFFPTTEVVARVMWETIEKHLETLPSKPTCLQVYVRET 131

Query: 109 PMSWVEYQ 116
           P S+  Y+
Sbjct: 132 PTSYCIYR 139


>gi|282896545|ref|ZP_06304565.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Raphidiopsis brookii D9]
 gi|281198651|gb|EFA73532.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Raphidiopsis brookii D9]
          Length = 129

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 61/125 (48%), Gaps = 12/125 (9%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVM------EGDVDPKTGFVDDFFNI 55
           K++  FTF++AH +        C RMHGH+Y+V++ +        +  P    V DF ++
Sbjct: 5   KLSTEFTFDSAHYIKDYK--GPCGRMHGHTYKVKIEVTSSQLHSSEYCPHPVMVADFKSL 62

Query: 56  EQYFSPLLE-KLDHHCLNEIEELE-NPTAENIAIWIWKRLSTSLSILSSVR--VYETPMS 111
                 + +  LDH  LNE+   E   TAE IA +I+      L     ++  V ETP S
Sbjct: 63  RWAKKDVTQGGLDHCVLNEVLPPEYETTAEMIAKYIYDETKRRLPTEVKLKVAVSETPNS 122

Query: 112 WVEYQ 116
           W EY+
Sbjct: 123 WAEYE 127


>gi|294496218|ref|YP_003542711.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Methanohalophilus mahii DSM 5219]
 gi|292667217|gb|ADE37066.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Methanohalophilus mahii DSM 5219]
          Length = 116

 Score = 94.5 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 43/113 (38%), Positives = 66/113 (58%), Gaps = 6/113 (5%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MK+      ++AH LP       C  +HGH+Y+VE+V+EG+  P +G V DF++++Q   
Sbjct: 4   MKLGVEEYIDSAHYLPGHES---CGIVHGHTYKVEVVLEGEKKP-SGMVIDFYDVKQTVR 59

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWV 113
             L++ DH  LN+I  LE P++EN+   I+ RLS  L    SV+V+E    W 
Sbjct: 60  STLKEYDHCMLNDI--LEYPSSENLCEHIYNRLSQQLDFPLSVKVWEGHGKWC 110


>gi|254282216|ref|ZP_04957184.1| queuosine biosynthesis protein QueD [gamma proteobacterium NOR51-B]
 gi|219678419|gb|EED34768.1| queuosine biosynthesis protein QueD [gamma proteobacterium NOR51-B]
          Length = 86

 Score = 94.5 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 55/82 (67%)

Query: 36  LVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEELENPTAENIAIWIWKRLST 95
           + ++G+VD  TG++ DF  I+   +P++++LDH+ LNEI  LENPT+E +A+W+W+ ++ 
Sbjct: 1   MTIDGEVDEHTGWLMDFAEIKAAVTPVIDRLDHYFLNEIPGLENPTSEVLAMWLWEEIAP 60

Query: 96  SLSILSSVRVYETPMSWVEYQG 117
            L  L  + V ET  +   Y+G
Sbjct: 61  RLEGLVQIEVKETCNAGCIYRG 82


>gi|301164331|emb|CBW23889.1| putative 6-pyruvoyl tetrahydropterin synthase [Bacteroides fragilis
           638R]
          Length = 103

 Score = 94.5 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 55/110 (50%), Gaps = 9/110 (8%)

Query: 7   FTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKL 66
               AAH+L  +P   KC  +HGH++ + +    +     G V DF  I+Q      EKL
Sbjct: 1   MEISAAHKLI-LPYRSKCASLHGHNWIITVYCRSERLNADGMVVDFTQIKQAVK---EKL 56

Query: 67  DHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
           DH  LNE+    NPTAENIA W+ K++         V V E+  + V Y+
Sbjct: 57  DHRNLNEVLPF-NPTAENIARWVCKQI----PQCYKVEVQESEANTVIYE 101


>gi|297584921|ref|YP_003700701.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Bacillus selenitireducens MLS10]
 gi|297143378|gb|ADI00136.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Bacillus selenitireducens MLS10]
          Length = 160

 Score = 94.5 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 41/124 (33%), Positives = 70/124 (56%), Gaps = 15/124 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ F+F+AAH L       KC  +HGH+YRV   + G VD + G + DF +I++ +   
Sbjct: 31  VSKEFSFDAAHHLHCYD--GKCKNLHGHTYRVVFGISGYVD-EIGLMMDFGDIKEIWKED 87

Query: 63  LE-KLDHHCLNEIEELENPTAENIAIWIWKRLSTSL---SILSS--------VRVYETPM 110
           +E  LDH  +N+     N TAEN+ +WI+++++ ++     LS         VR++ET  
Sbjct: 88  IEVHLDHRYVNQTLPKMNTTAENMVVWIFEQMAGAIEERPKLSKDQGARVEFVRLFETQT 147

Query: 111 SWVE 114
           S+ E
Sbjct: 148 SYAE 151


>gi|261749517|ref|YP_003257203.1| 6-pyruvoyl tetrahydrobiopterin synthase [Blattabacterium sp.
           (Periplaneta americana) str. BPLAN]
 gi|261497610|gb|ACX84060.1| 6-pyruvoyl tetrahydrobiopterin synthase [Blattabacterium sp.
           (Periplaneta americana) str. BPLAN]
          Length = 136

 Score = 94.5 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 43/131 (32%), Positives = 68/131 (51%), Gaps = 16/131 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           I++   F AAH+L               KC     HGH+Y   + + G ++P+TGFV   
Sbjct: 5   ISKKGYFSAAHKLYNPQWDYHKNIEMFGKCAYLNYHGHNYEYIVSLTGKINPETGFVFSL 64

Query: 53  FNIEQYFSPLLEKL-DHHCLN-EIEELE--NPTAENIAIWIWKRLSTSL-SILS-SVRVY 106
             ++      +E+L DH  +N +I++    NPTAENI I++W R+   + S L   + +Y
Sbjct: 65  QKLKNLLHEEIEELFDHKNINLDIKDFSIINPTAENIVIFLWNRIKKKISSNLHLKIILY 124

Query: 107 ETPMSWVEYQG 117
           ET  ++VEY G
Sbjct: 125 ETKNNFVEYDG 135


>gi|158337937|ref|YP_001519113.1| 6-pyruvoyl-tetrahydropterin synthase [Acaryochloris marina
           MBIC11017]
 gi|158308178|gb|ABW29795.1| 6-pyruvoyl-tetrahydropterin synthase [Acaryochloris marina
           MBIC11017]
          Length = 291

 Score = 94.5 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 42/130 (32%), Positives = 65/130 (50%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRL--------PRVPKTHKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL               KC R HGH  +Y +E+ ++G+VD +TG + D 
Sbjct: 138 LTVGSHFSAAHRLALPELSFEENCEIYGKCARPHGHGHNYHLEVTVKGEVDARTGMIVDL 197

Query: 53  FNIEQYFSPLL-EKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSL----SILSSVR 104
             ++     ++ + LDH  LN +I   E   PTAENIA +I K L   +    + L  ++
Sbjct: 198 VALQSLVDDVVLDPLDHTFLNKDIPYFEKVVPTAENIAFYIAKLLREPILKIGAELHRIK 257

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 258 LIESPNNSCE 267



 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 38/129 (29%), Positives = 64/129 (49%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHR--MHGHSYRVELVMEGDVDPKTGFVDDF 52
           I +   F A+HR             K  +C R   HGH+Y + + M G+   + G V + 
Sbjct: 5   IHRRAEFSASHRYWLPELSKSENQEKFGQCTRSPGHGHNYELFVSMWGE-LDQYGMVLNL 63

Query: 53  FNIEQYF-SPLLEKLDHHCLNEI-EELEN--PTAENIAIWIWKRLSTSLSILSSVRVYET 108
            N++Q     +   L+   LNE+  E +   PT E++A  IW+RL   L I++ ++++E 
Sbjct: 64  SNVKQVIKREVTAPLNFSYLNEVWPEFKETLPTTEHLARVIWQRLEPHLPIVN-IQLFEH 122

Query: 109 PMSWVEYQG 117
           P  W +Y+G
Sbjct: 123 PKLWADYKG 131


>gi|16273112|ref|NP_439346.1| 6-pyruvoyl tetrahydrobiopterin synthase [Haemophilus influenzae Rd
           KW20]
 gi|145637057|ref|ZP_01792720.1| 6-pyruvoyl tetrahydrobiopterin synthase [Haemophilus influenzae
           PittHH]
 gi|148828341|ref|YP_001293094.1| 6-pyruvoyl tetrahydrobiopterin synthase [Haemophilus influenzae
           PittGG]
 gi|260581109|ref|ZP_05848930.1| queuosine biosynthesis protein QueD [Haemophilus influenzae RdAW]
 gi|319776567|ref|YP_004139055.1| 6-pyruvoyl-tetrahydropterin synthase [Haemophilus influenzae F3047]
 gi|329124079|ref|ZP_08252626.1| queuosine biosynthesis protein QueD [Haemophilus aegyptius ATCC
           11116]
 gi|1175542|sp|P44123|QUED_HAEIN RecName: Full=6-carboxy-5,6,7,8-tetrahydropterin synthase;
           Short=CPH4 synthase; AltName: Full=Queuosine
           biosynthesis protein queD
 gi|1574117|gb|AAC22843.1| 6-pyruvoyl tetrahydrobiopterin synthase, putative [Haemophilus
           influenzae Rd KW20]
 gi|145269711|gb|EDK09651.1| 6-pyruvoyl tetrahydrobiopterin synthase [Haemophilus influenzae
           PittHH]
 gi|148719583|gb|ABR00711.1| 6-pyruvoyl tetrahydrobiopterin synthase [Haemophilus influenzae
           PittGG]
 gi|260092238|gb|EEW76180.1| queuosine biosynthesis protein QueD [Haemophilus influenzae RdAW]
 gi|317451158|emb|CBY87391.1| predicted 6-pyruvoyl-tetrahydropterin synthase [Haemophilus
           influenzae F3047]
 gi|327467504|gb|EGF13002.1| queuosine biosynthesis protein QueD [Haemophilus aegyptius ATCC
           11116]
          Length = 141

 Score = 94.1 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 41/141 (29%), Positives = 68/141 (48%), Gaps = 27/141 (19%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGD---VDPKTGFVDDFFNIEQ 57
            KI++ F+F+ AH L       KC  +HGH+Y++++ + GD      K   V DF +++ 
Sbjct: 2   FKISKEFSFDMAHLLDG--HDGKCQNLHGHTYKLQVEISGDLYKSGAKKAMVIDFSDLKS 59

Query: 58  YFSPLL-EKLDHHCLNE--------IEELEN------------PTAENIAIWIWKRLS-T 95
               ++ + +DH  + +        I  L               TAE IA +I+ RL   
Sbjct: 60  IVKKVILDPMDHAFIYDQTNERESQIATLLQKLNSKTFGVPFRTTAEEIARFIFNRLKHD 119

Query: 96  SLSILSSVRVYETPMSWVEYQ 116
               +SS+R++ETP S+ EYQ
Sbjct: 120 EQLSISSIRLWETPTSFCEYQ 140


>gi|186683091|ref|YP_001866287.1| 6-pyruvoyl tetrahydropterin synthase [Nostoc punctiforme PCC 73102]
 gi|186465543|gb|ACC81344.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Nostoc punctiforme PCC 73102]
          Length = 290

 Score = 94.1 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 42/130 (32%), Positives = 66/130 (50%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T +  F AAHRL     +         KC R HGH  +Y +E+ ++G++DP+TG + D 
Sbjct: 138 LTISTHFSAAHRLAHPHLSNEENTEIYGKCARPHGHGHNYHLEVTVKGEIDPRTGMIVDL 197

Query: 53  FNIEQYFSPL-LEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSL----SILSSVR 104
             + Q      +E  DH  LN +I       PTAENIA++I   L + +    + L  V+
Sbjct: 198 GGLNQVIEDYVVEPFDHTFLNKDIPYFAEIVPTAENIALYISNLLRSPIQELGAKLHKVK 257

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 258 LIESPNNSCE 267



 Score = 84.4 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 36/129 (27%), Positives = 61/129 (47%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           + +   F A+HR           + K   C +   HGH+Y + + + G+   K G V + 
Sbjct: 5   VNRRAQFSASHRYWLPELSEAENIEKFGACSKFPGHGHNYVLFISLAGE-LDKYGMVLNL 63

Query: 53  FNIEQYF-SPLLEKLDHHCLNEIE-ELEN--PTAENIAIWIWKRLSTSLSILSSVRVYET 108
            +++      +  +LD   +N+   E +   PT ENIA  IW+RL+  L  L  V+++E 
Sbjct: 64  SDVKHVIKREVTSQLDFSYINDAWTEFQQTLPTTENIARIIWQRLAPHLP-LVRVQLFEH 122

Query: 109 PMSWVEYQG 117
           P  W +Y G
Sbjct: 123 PELWADYIG 131


>gi|283781955|ref|YP_003372710.1| hypothetical protein Psta_4202 [Pirellula staleyi DSM 6068]
 gi|283440408|gb|ADB18850.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Pirellula staleyi DSM 6068]
          Length = 169

 Score = 94.1 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 37/133 (27%), Positives = 60/133 (45%), Gaps = 19/133 (14%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYF- 59
            ++++   F   HRL       KC  +HGH+ R  + +E       G V DF +I++   
Sbjct: 29  FRVSREIDFCYGHRLLNYD--GKCRHLHGHNGRAVITIESSSLDNRGMVMDFSDIKRVVS 86

Query: 60  SPLLEKLDHHC-----------LNEI-EEL----ENPTAENIAIWIWKRLSTSLSILSSV 103
           S + E LDH             L ++ E L    ENPTAENI   I +  ++    +   
Sbjct: 87  SWIDENLDHRMLLCKRDPYVQILKDLGEPLFLLDENPTAENICKLIHEFTASRGFPIVET 146

Query: 104 RVYETPMSWVEYQ 116
           +++ETP  +  Y+
Sbjct: 147 QLWETPHCFATYR 159


>gi|189467679|ref|ZP_03016464.1| hypothetical protein BACINT_04070 [Bacteroides intestinalis DSM
           17393]
 gi|224538810|ref|ZP_03679349.1| hypothetical protein BACCELL_03705 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|189435943|gb|EDV04928.1| hypothetical protein BACINT_04070 [Bacteroides intestinalis DSM
           17393]
 gi|224519567|gb|EEF88672.1| hypothetical protein BACCELL_03705 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 110

 Score = 94.1 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 35/114 (30%), Positives = 54/114 (47%), Gaps = 9/114 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + +     AAH L ++    KC  +HGH++ + +          G V DF +I++     
Sbjct: 4   VIKRMEISAAHSL-KLSYRSKCEDLHGHNWIITVYCRSRELNADGMVVDFSHIKETVK-- 60

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
             KLDH  LNE+    NPTAENIA WI +++         V V E+  +   Y+
Sbjct: 61  -GKLDHRNLNEVLPF-NPTAENIARWICEQI----PTCFKVEVQESESNVATYE 108


>gi|145627829|ref|ZP_01783630.1| 6-pyruvoyl tetrahydrobiopterin synthase [Haemophilus influenzae
           22.1-21]
 gi|145631239|ref|ZP_01787012.1| 6-pyruvoyl tetrahydrobiopterin synthase [Haemophilus influenzae
           R3021]
 gi|145633080|ref|ZP_01788812.1| 6-pyruvoyl tetrahydrobiopterin synthase [Haemophilus influenzae
           3655]
 gi|145635039|ref|ZP_01790745.1| 6-pyruvoyl tetrahydrobiopterin synthase [Haemophilus influenzae
           PittAA]
 gi|145639291|ref|ZP_01794897.1| 6-pyruvoyl tetrahydrobiopterin synthase [Haemophilus influenzae
           PittII]
 gi|145641209|ref|ZP_01796789.1| 6-pyruvoyl tetrahydrobiopterin synthase [Haemophilus influenzae
           R3021]
 gi|148826201|ref|YP_001290954.1| 6-pyruvoyl tetrahydrobiopterin synthase [Haemophilus influenzae
           PittEE]
 gi|229844855|ref|ZP_04464993.1| 6-pyruvoyl tetrahydrobiopterin synthase [Haemophilus influenzae
           6P18H1]
 gi|229846221|ref|ZP_04466333.1| 6-pyruvoyl tetrahydrobiopterin synthase [Haemophilus influenzae
           7P49H1]
 gi|260582120|ref|ZP_05849914.1| queuosine biosynthesis protein QueD [Haemophilus influenzae NT127]
 gi|144979604|gb|EDJ89263.1| 6-pyruvoyl tetrahydrobiopterin synthase [Haemophilus influenzae
           22.1-21]
 gi|144983166|gb|EDJ90661.1| 6-pyruvoyl tetrahydrobiopterin synthase [Haemophilus influenzae
           R3021]
 gi|144986306|gb|EDJ92885.1| 6-pyruvoyl tetrahydrobiopterin synthase [Haemophilus influenzae
           3655]
 gi|145267647|gb|EDK07645.1| 6-pyruvoyl tetrahydrobiopterin synthase [Haemophilus influenzae
           PittAA]
 gi|145271594|gb|EDK11505.1| 6-pyruvoyl tetrahydrobiopterin synthase [Haemophilus influenzae
           PittII]
 gi|145274046|gb|EDK13912.1| 6-pyruvoyl tetrahydrobiopterin synthase [Haemophilus influenzae
           22.4-21]
 gi|148716361|gb|ABQ98571.1| 6-pyruvoyl tetrahydrobiopterin synthase [Haemophilus influenzae
           PittEE]
 gi|229811225|gb|EEP46942.1| 6-pyruvoyl tetrahydrobiopterin synthase [Haemophilus influenzae
           7P49H1]
 gi|229812236|gb|EEP47927.1| 6-pyruvoyl tetrahydrobiopterin synthase [Haemophilus influenzae
           6P18H1]
 gi|260094752|gb|EEW78646.1| queuosine biosynthesis protein QueD [Haemophilus influenzae NT127]
 gi|301169928|emb|CBW29532.1| predicted 6-pyruvoyl-tetrahydropterin synthase [Haemophilus
           influenzae 10810]
 gi|309751167|gb|ADO81151.1| Probable 7-cyano-7-deazaguanine (preQ0) synthesis protein QueD
           [Haemophilus influenzae R2866]
 gi|309973346|gb|ADO96547.1| Probable 7-cyano-7-deazaguanine (preQ0) synthesis protein QueD
           [Haemophilus influenzae R2846]
          Length = 141

 Score = 94.1 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 40/141 (28%), Positives = 68/141 (48%), Gaps = 27/141 (19%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEG---DVDPKTGFVDDFFNIEQ 57
            KI++ F+F+ AH L       KC  +HGH+Y++++ + G   +   K   V DF +++ 
Sbjct: 2   FKISKEFSFDMAHLLDG--HDGKCQNLHGHTYKLQVEISGDLYESGAKKAMVIDFSDLKS 59

Query: 58  YFSPLL-EKLDHHCLNE--------IEELEN------------PTAENIAIWIWKRLS-T 95
               ++ + +DH  + +        I  L               TAE IA +I+ RL   
Sbjct: 60  IVKKVILDPMDHAFIYDQTNERESQIATLLQKLNSKTFGVPFRTTAEEIARFIFNRLKHD 119

Query: 96  SLSILSSVRVYETPMSWVEYQ 116
               +SS+R++ETP S+ EYQ
Sbjct: 120 EQLSISSIRLWETPTSFCEYQ 140


>gi|86608161|ref|YP_476923.1| 6-pyruvoyl-tetrahydropterin synthase [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86556703|gb|ABD01660.1| putative 6-pyruvoyl-tetrahydropterin synthase [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 301

 Score = 94.1 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 44/133 (33%), Positives = 66/133 (49%), Gaps = 18/133 (13%)

Query: 3   ITQAFTFEAAHRL--------PRVPKTHKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T A  F AAHRL                C R HGH  +Y +E+ ++G +DP+TG + D 
Sbjct: 140 LTVATHFSAAHRLALDHLSFEENSAIYGLCARPHGHGHNYGLEITVKGSIDPRTGMIVDL 199

Query: 53  FNIEQYFSPL-LEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI----LSSVR 104
             +++      ++ LDH  LN +I       PTAENIA++I + L+  L      L  VR
Sbjct: 200 AALQRLIEEQVVKPLDHTFLNKDIPYFAQVVPTAENIALYIQRLLTLPLRELGVQLHRVR 259

Query: 105 VYETPMSWVEYQG 117
           + E+P +  E  G
Sbjct: 260 LQESPNNSSEVYG 272



 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 43/129 (33%), Positives = 64/129 (49%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           I +   F A+HR           + +     R   HGH+Y +E+ M G+VD   G V + 
Sbjct: 7   IYRRAQFAASHRYWLPELSEAENLARFGPNARFPGHGHNYVLEVGMSGEVDD-YGMVLNL 65

Query: 53  FNIEQYFSPLLEK-LDHHCLNEI-EELEN--PTAENIAIWIWKRLSTSLSILSSVRVYET 108
             ++Q     + + L+   LN+   E     PT E IA  IW+RL+ +L  L+SVR+YE 
Sbjct: 66  SEVKQVIRQRVIQDLNFAYLNQAWPEFAQTLPTTEFIAYVIWQRLADALP-LTSVRLYED 124

Query: 109 PMSWVEYQG 117
           P  W EY+G
Sbjct: 125 PELWAEYRG 133


>gi|225850919|ref|YP_002731153.1| putative 6-pyruvoyl tetrahydrobiopterin synthase (ptps)(ptp
           synthase) [Persephonella marina EX-H1]
 gi|225645631|gb|ACO03817.1| putative 6-pyruvoyl tetrahydrobiopterin synthase (ptps)(ptp
           synthase) [Persephonella marina EX-H1]
          Length = 161

 Score = 94.1 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 39/157 (24%), Positives = 66/157 (42%), Gaps = 41/157 (26%)

Query: 2   KITQAFTFEAAHRLPRVPKTH--------------KCHRMHGHSYRVELVMEGDVDPKTG 47
           +IT+ F FEA HR+ +   +                C  +HGHSY+VE+ +  D   +  
Sbjct: 4   EITKRFKFEAGHRVWKQNLSSGKGAKLMADEIPPNPCINIHGHSYKVEVTVGSDKLNEQE 63

Query: 48  FVDDFFNIEQYFSPLLE-KLDHHCLNE-----IEELEN-------------PTAENIAIW 88
            V DF++I+     L++ +LDH  + +       + +              PTAE +A +
Sbjct: 64  MVIDFYHIKSALKDLIDNQLDHSFIIDKNDPLFPKFKENFGFLKLTVVDFCPTAEALAKY 123

Query: 89  IWKRLSTSLSI--------LSSVRVYETPMSWVEYQG 117
           I+  L   L          + SV ++ET      Y+G
Sbjct: 124 IYDFLEDKLREAGLLDEIKVVSVTIWETETGKAVYKG 160


>gi|86605788|ref|YP_474551.1| 6-pyruvoyl tetrahydropterin synthase [Synechococcus sp. JA-3-3Ab]
 gi|86554330|gb|ABC99288.1| putative 6-pyruvoyl tetrahydropterin synthase [Synechococcus sp.
           JA-3-3Ab]
          Length = 317

 Score = 94.1 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 43/130 (33%), Positives = 69/130 (53%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRM-----------HGHSYRVELVMEGDVDPKTGFVDD 51
           I +   F A+HR   +P+  +   +           HGH+Y +E+ + G+VD + G V +
Sbjct: 7   IYRRAHFAASHRYW-LPELSEAENLARFGSHARFPGHGHNYVLEVGLTGEVD-EYGMVLN 64

Query: 52  FFNIEQYFSPL-LEKLDHHCLNEI-EELEN--PTAENIAIWIWKRLSTSLSILSSVRVYE 107
              ++Q      +++L+   LN++  E     PT E IA  IW+RL+ +L  LSSVR+YE
Sbjct: 65  LSQVKQVIRERVIQELNFAYLNQVWPEFAQTLPTTEFIAYTIWQRLADALP-LSSVRLYE 123

Query: 108 TPMSWVEYQG 117
            P  W EY+G
Sbjct: 124 DPQLWAEYRG 133



 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 42/133 (31%), Positives = 66/133 (49%), Gaps = 18/133 (13%)

Query: 3   ITQAFTFEAAHRL--------PRVPKTHKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T A  F AAHRL                C R HGH  +Y +E+ ++G +DP+TG + D 
Sbjct: 140 LTVATHFSAAHRLALDHLSLEENTAIYGLCARPHGHGHNYGLEITVKGSIDPRTGMIVDL 199

Query: 53  FNIEQYFSPL-LEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI----LSSVR 104
             +++      ++ LDH  LN ++       PTAENIA+++ + L+  L      L  VR
Sbjct: 200 AALQRVIEEQVVKPLDHTFLNKDVPYFAQVVPTAENIALYVQRLLTLPLRELGVQLHRVR 259

Query: 105 VYETPMSWVEYQG 117
           + E+P +  E  G
Sbjct: 260 LQESPNNSSEVYG 272


>gi|282900347|ref|ZP_06308298.1| hypothetical protein CRC_02223 [Cylindrospermopsis raciborskii
           CS-505]
 gi|281194852|gb|EFA69798.1| hypothetical protein CRC_02223 [Cylindrospermopsis raciborskii
           CS-505]
          Length = 129

 Score = 93.7 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 42/125 (33%), Positives = 60/125 (48%), Gaps = 12/125 (9%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVM------EGDVDPKTGFVDDFFNI 55
           K++  FTF++AH +        C RMHGH+YRV++ +        +  P    V DF ++
Sbjct: 5   KLSTEFTFDSAHYIKDYK--GPCGRMHGHTYRVKMEVTSSQLHSSEYCPHPVMVADFKSL 62

Query: 56  EQYFSPLLE-KLDHHCLNEIEELE-NPTAENIAIWIWKRLSTSLSI--LSSVRVYETPMS 111
                 + +  LDH  LNE+   E   TAE IA +I+      L       V V ETP S
Sbjct: 63  RWAKKDVTQGGLDHCVLNEVLPPEYETTAEMIAKYIYDETKRRLPTGVKLKVAVSETPNS 122

Query: 112 WVEYQ 116
           W EY+
Sbjct: 123 WAEYE 127


>gi|150007938|ref|YP_001302681.1| 6-pyruvoyl-tetrahydropterin synthase [Parabacteroides distasonis
           ATCC 8503]
 gi|255013374|ref|ZP_05285500.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. 2_1_7]
 gi|256840896|ref|ZP_05546404.1| queuosine biosynthesis protein QueD [Parabacteroides sp. D13]
 gi|262381500|ref|ZP_06074638.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. 2_1_33B]
 gi|298376716|ref|ZP_06986671.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. 3_1_19]
 gi|301310019|ref|ZP_07215958.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. 20_3]
 gi|149936362|gb|ABR43059.1| 6-pyruvoyl-tetrahydropterin synthase [Parabacteroides distasonis
           ATCC 8503]
 gi|256738168|gb|EEU51494.1| queuosine biosynthesis protein QueD [Parabacteroides sp. D13]
 gi|262296677|gb|EEY84607.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. 2_1_33B]
 gi|298266594|gb|EFI08252.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. 3_1_19]
 gi|300831593|gb|EFK62224.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. 20_3]
          Length = 110

 Score = 93.7 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 33/114 (28%), Positives = 54/114 (47%), Gaps = 9/114 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + +     A+H L R+    KC  +HGH++ + +          G V DF +I++     
Sbjct: 4   VIKRMEISASHSL-RLSYPSKCENLHGHNWMITVYCRSKELNADGMVVDFSHIKRSVK-- 60

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
              LDH  LN+I    NPTAENIA W+++++         V V E+  +   Y+
Sbjct: 61  -SLLDHQNLNDILPF-NPTAENIAFWVYEQI----PSCFKVEVKESEGNTAIYE 108


>gi|150004623|ref|YP_001299367.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides vulgatus ATCC
           8482]
 gi|212693922|ref|ZP_03302050.1| hypothetical protein BACDOR_03444 [Bacteroides dorei DSM 17855]
 gi|237724016|ref|ZP_04554497.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. D4]
 gi|254883104|ref|ZP_05255814.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. 4_3_47FAA]
 gi|294775145|ref|ZP_06740671.1| putative queuosine biosynthesis protein QueD [Bacteroides vulgatus
           PC510]
 gi|319643624|ref|ZP_07998244.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. 3_1_40A]
 gi|149933047|gb|ABR39745.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides vulgatus ATCC
           8482]
 gi|212663454|gb|EEB24028.1| hypothetical protein BACDOR_03444 [Bacteroides dorei DSM 17855]
 gi|229437680|gb|EEO47757.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides dorei 5_1_36/D4]
 gi|254835897|gb|EET16206.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. 4_3_47FAA]
 gi|294450957|gb|EFG19431.1| putative queuosine biosynthesis protein QueD [Bacteroides vulgatus
           PC510]
 gi|317384793|gb|EFV65752.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. 3_1_40A]
          Length = 110

 Score = 93.7 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 34/114 (29%), Positives = 58/114 (50%), Gaps = 9/114 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + +     A+H L ++    KC  +HGH++ + +    +V  + G V DF +I++     
Sbjct: 4   VIKRMEISASHSL-KLSYRSKCENLHGHNWIITVYCRSEVLNEDGMVVDFTHIKETVM-- 60

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
             +LDH  LNE+    NPTAENIA W+ +++         V V E+  + V Y+
Sbjct: 61  -GRLDHRNLNEVVSF-NPTAENIARWVCEQI----PTCFKVEVRESEGNTVIYE 108


>gi|320104971|ref|YP_004180562.1| preQ(0) biosynthesis protein QueD [Isosphaera pallida ATCC 43644]
 gi|319752253|gb|ADV64013.1| preQ(0) biosynthesis protein QueD [Isosphaera pallida ATCC 43644]
          Length = 154

 Score = 93.7 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 35/133 (26%), Positives = 56/133 (42%), Gaps = 19/133 (14%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++T+   F   HRL       KC  +HGH+ RV + +E       G + DF +I+     
Sbjct: 3   RVTREMKFCYGHRLINYE--GKCRHLHGHNGRVLVTLESPTLDHRGMLIDFADIKAVLQQ 60

Query: 62  LLEKLDHHC--LNEIEEL---------------ENPTAENIAIWIWKRLSTSLSILSSVR 104
            ++    H   L + + L                NPTAENIA  I++R   +   +  V 
Sbjct: 61  WIDDTLDHNMLLCKDDPLVPILRERGERHYVMETNPTAENIARLIFERGREAGLPIVEVT 120

Query: 105 VYETPMSWVEYQG 117
           ++ET      +QG
Sbjct: 121 LWETDTCHASFQG 133


>gi|72018761|ref|XP_795640.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
 gi|115961772|ref|XP_001191663.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
          Length = 149

 Score = 93.7 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 59/110 (53%), Gaps = 9/110 (8%)

Query: 17  RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP-LLEKLDHHCLN- 72
            +    KC+    HGH+Y+VEL + G V P TG V +  +++ Y     L+ LDH  L+ 
Sbjct: 39  NIKLYDKCNNPNGHGHNYKVELTLRGKVYPVTGMVMNISDLKTYMKNGFLDLLDHKNLDK 98

Query: 73  EIEELENP--TAENIAIWIWKRLSTSLSI---LSSVRVYETPMSWVEYQG 117
           ++    +   T ENIAI+IW R++  L     L  V+V+ET  +   Y+G
Sbjct: 99  DVNYFRSNVSTVENIAIFIWDRMAKCLPDPSLLFEVKVHETDKNIAVYRG 148


>gi|77165503|ref|YP_344028.1| 6-pyruvoyl tetrahydropterin synthase [Nitrosococcus oceani ATCC
           19707]
 gi|76883817|gb|ABA58498.1| preQ(0) biosynthesis protein QueD [Nitrosococcus oceani ATCC 19707]
          Length = 99

 Score = 93.7 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 32/95 (33%), Positives = 56/95 (58%), Gaps = 6/95 (6%)

Query: 27  MHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEELE--NPTAEN 84
           MHGH++++E+ +      + G V DF +I++    L  +LDH  LN+I   +  NPTAEN
Sbjct: 1   MHGHNWKLEVEVTAQALDQQGMVMDFKDIKESARELCAQLDHRYLNDISPFDLINPTAEN 60

Query: 85  IAIWIWKRLSTSL----SILSSVRVYETPMSWVEY 115
           +A + ++ LS  L    + +S++ ++ET  + V Y
Sbjct: 61  LAAFFYRGLSKQLNNERARVSAITLWETERACVRY 95


>gi|237708544|ref|ZP_04539025.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. 9_1_42FAA]
 gi|265751293|ref|ZP_06087356.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. 3_1_33FAA]
 gi|229457473|gb|EEO63194.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. 9_1_42FAA]
 gi|263238189|gb|EEZ23639.1| 6-pyruvoyl-tetrahydropterin synthase [Bacteroides sp. 3_1_33FAA]
          Length = 110

 Score = 93.7 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 35/114 (30%), Positives = 60/114 (52%), Gaps = 9/114 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + +     A+H L ++    KC  +HGH++ + +    +V  + G V DF +I++     
Sbjct: 4   VIKRMEISASHSL-KLSYRSKCENLHGHNWIITVYCRSEVLNEDGMVVDFTHIKETV--- 59

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
           + +LDH  LNE+  L NPTAENIA W+ +++         V V E+  + V Y+
Sbjct: 60  MGRLDHQNLNEVVSL-NPTAENIARWVCEQI----PTCFKVEVRESEGNTVIYE 108


>gi|119491071|ref|ZP_01623229.1| hypothetical protein L8106_26177 [Lyngbya sp. PCC 8106]
 gi|119453616|gb|EAW34776.1| hypothetical protein L8106_26177 [Lyngbya sp. PCC 8106]
          Length = 284

 Score = 93.7 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 40/130 (30%), Positives = 64/130 (49%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T +  F AAHRL     +         KC R HGH  +Y +E+ ++G++D +TG + D 
Sbjct: 138 LTVSTHFSAAHRLAHPDLSFEENCEIYGKCARPHGHGHNYHLEVSVKGEIDSRTGMIVDL 197

Query: 53  FNIEQYFSPL-LEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSL----SILSSVR 104
             ++Q      +E  DH  LN +I       PTAENI ++I   L   +    + L  +R
Sbjct: 198 AALQQVIDDYVVEPFDHTFLNKDIAYFAKVVPTAENIVVYIRDLLQNPVRELGAKLHKIR 257

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 258 LIESPNNSCE 267



 Score = 87.9 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 38/129 (29%), Positives = 62/129 (48%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHR--MHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F A+HR             +     R   HGH+Y + + M G    + G V + 
Sbjct: 5   ITRRAEFSASHRYWLPELSETENFERFGPTARAPGHGHNYVLYISMVGQ-LDEYGMVLNL 63

Query: 53  FNIEQYFS-PLLEKLDHHCLNEI-EELEN--PTAENIAIWIWKRLSTSLSILSSVRVYET 108
            +++      +  +LD   LNE+  E +   PT E +A  IW+RL+  L  L++++V+E 
Sbjct: 64  SDVKHVIKAEVTSQLDFSFLNEVWLEFQQTLPTTEYLAQVIWQRLAPHLP-LTNIQVFEH 122

Query: 109 PMSWVEYQG 117
           P  W +YQG
Sbjct: 123 PKLWADYQG 131


>gi|298675036|ref|YP_003726786.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Methanohalobium evestigatum Z-7303]
 gi|298288024|gb|ADI73990.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Methanohalobium evestigatum Z-7303]
          Length = 116

 Score = 93.7 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 40/114 (35%), Positives = 64/114 (56%), Gaps = 7/114 (6%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M++    + + AH LP       C  +HGH+YRVE+V+EG+ +   G V DF ++++   
Sbjct: 4   MRLGIIESIDTAHYLPGHET---CGIVHGHTYRVEVVIEGEKNG--GMVMDFADLKKIVK 58

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVE 114
            +L+  DH  LN I  L  P++EN+   I+ +LS  L +L  VR++E    W E
Sbjct: 59  DILKDYDHTLLNNI--LSYPSSENLCENIYSKLSEKLKMLVKVRIWEGEGKWCE 110


>gi|170029210|ref|XP_001842486.1| 6-pyruvoyl tetrahydrobiopterin synthase [Culex quinquefasciatus]
 gi|167881589|gb|EDS44972.1| 6-pyruvoyl tetrahydrobiopterin synthase [Culex quinquefasciatus]
          Length = 156

 Score = 93.7 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 61/105 (58%), Gaps = 9/105 (8%)

Query: 22  HKCHRM--HGHSYRVELVMEGDVDPKTGFVDDFFNIEQYF-SPLLEKLDHHCLN-EIEEL 77
            KC+    HGH+Y VE+ + G VDPKTG V +  +++QY    +++KLDH  L+ ++   
Sbjct: 16  GKCNNPNGHGHNYNVEVTVRGPVDPKTGMVMNITDLKQYMDQTIMKKLDHLNLDKDVPYF 75

Query: 78  EN--PTAENIAIWIWKRLS---TSLSILSSVRVYETPMSWVEYQG 117
           +N   T EN+A +IW  L        +L  V+++ET  + V Y+G
Sbjct: 76  KNLPSTTENVAFFIWDALKLVMAKPELLYEVKIHETDKNSVVYRG 120


>gi|11498052|ref|NP_069276.1| hypothetical protein AF0440 [Archaeoglobus fulgidus DSM 4304]
 gi|6647938|sp|O29809|QUED_ARCFU RecName: Full=Putative 6-carboxy-5,6,7,8-tetrahydropterin synthase;
           Short=CPH4 synthase; AltName: Full=Archaeosine
           biosynthesis protein queD
 gi|2650193|gb|AAB90801.1| conserved hypothetical protein [Archaeoglobus fulgidus DSM 4304]
          Length = 115

 Score = 93.7 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 41/116 (35%), Positives = 67/116 (57%), Gaps = 6/116 (5%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M I  + +F AAH +P      KC ++HGH+++VE+ + G V  + G V DFF++++  +
Sbjct: 5   MIIGISTSFSAAHSIPGHK---KCGKVHGHNFKVEVEISGKV-KENGMVMDFFDLKRIVN 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            ++ K DH  LNE  ++E PT+ENI + I+  L+     +  VRV E    W E +
Sbjct: 61  EVVAKFDHTLLNE--QIEIPTSENICLRIFSELAEKGLNVRRVRVAENEDKWAEIR 114


>gi|198276624|ref|ZP_03209155.1| hypothetical protein BACPLE_02820 [Bacteroides plebeius DSM 17135]
 gi|198270149|gb|EDY94419.1| hypothetical protein BACPLE_02820 [Bacteroides plebeius DSM 17135]
          Length = 110

 Score = 93.7 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 34/114 (29%), Positives = 59/114 (51%), Gaps = 9/114 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + +     A+H+L ++    KC  +HGH++ + +  + +   + G V DF +I++     
Sbjct: 4   VIKRMEISASHKL-KLSYESKCENLHGHNWIITVYCQAEQLNEDGMVVDFTHIKEVVK-- 60

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
             +LDH  LN++    NPTAENIA WI +R+         V V E+  + V Y+
Sbjct: 61  -GQLDHKNLNDVLP-CNPTAENIARWICERV----PHCVKVEVCESEGNRVIYE 108


>gi|197117705|ref|YP_002138132.1| 6-carboxy-5,6,7,8-tetrahydropterin synthase [Geobacter bemidjiensis
           Bem]
 gi|197087065|gb|ACH38336.1| 6-carboxy-5,6,7,8-tetrahydropterin synthase [Geobacter bemidjiensis
           Bem]
          Length = 122

 Score = 93.7 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 61/122 (50%), Gaps = 8/122 (6%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++T    F AAH L        C  +HGH+++VE+ +  +   K G   DF  +++  +
Sbjct: 2   FRLTIHTAFAAAHNLINY--QGDCENLHGHNWKVEVSVTTNELDKAGLGIDFKILKRETN 59

Query: 61  PLLEKLDHHCLNEIEEL--ENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
            LL+ LDH  LNE+      +P++ENIA +++  L+  L      +  V V+E+  +   
Sbjct: 60  TLLKTLDHKYLNELPPFLEVSPSSENIARYLYHELTKILGSDKVKVEMVTVWESDFAAAS 119

Query: 115 YQ 116
           Y 
Sbjct: 120 YY 121


>gi|307188147|gb|EFN72979.1| 6-pyruvoyl tetrahydrobiopterin synthase [Camponotus floridanus]
          Length = 151

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 36/133 (27%), Positives = 70/133 (52%), Gaps = 18/133 (13%)

Query: 3   ITQAFTFEAAHRL--------PRVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+       HRL               KC+ +  HGH+Y VE+ + G +DP TG V + 
Sbjct: 13  LTRKEHISCCHRLNSPFLNEYDNARVYGKCNNIYGHGHNYTVEVTVRGPIDPSTGMVLNL 72

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELENP---TAENIAIWIWKRLSTSLSI---LSSVR 104
            ++++     +++++DH  ++ ++E   N    T ENIA++I+++L   +S    L  V+
Sbjct: 73  SDLKECMQKVVIDEMDHKNIDKQVEHFTNNTISTTENIAVYIFEQLKKHMSNPKLLYEVK 132

Query: 105 VYETPMSWVEYQG 117
           V+ET  + + ++G
Sbjct: 133 VHETDKNVMYFRG 145


>gi|227539275|ref|ZP_03969324.1| 6-pyruvoyltetrahydropterin synthase [Sphingobacterium spiritivorum
           ATCC 33300]
 gi|300770747|ref|ZP_07080626.1| 6-pyruvoyltetrahydropterin synthase [Sphingobacterium spiritivorum
           ATCC 33861]
 gi|227240957|gb|EEI90972.1| 6-pyruvoyltetrahydropterin synthase [Sphingobacterium spiritivorum
           ATCC 33300]
 gi|300763223|gb|EFK60040.1| 6-pyruvoyltetrahydropterin synthase [Sphingobacterium spiritivorum
           ATCC 33861]
          Length = 137

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 41/133 (30%), Positives = 71/133 (53%), Gaps = 18/133 (13%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCHR--MHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F AAH+L R             KC     HGH+Y + + ++G+V+P+TGF+ D 
Sbjct: 4   ITRRERFSAAHKLYREDWSSEQNENVFGKCSNPNWHGHNYELFVTVKGEVNPETGFLIDL 63

Query: 53  FNIEQYF-SPLLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSLSI----LSSVR 104
             +++     ++EKLDH  +N +++ ++    + E +AI I+  L+         L SV+
Sbjct: 64  KKMKEIILHHIIEKLDHRNVNLDVDFMKGKLASTEYMAIEIFNVLNPLFEEHNVILHSVK 123

Query: 105 VYETPMSWVEYQG 117
           + ET  ++VEY G
Sbjct: 124 LVETENNYVEYFG 136


>gi|227498704|ref|ZP_03928848.1| conserved hypothetical protein [Acidaminococcus sp. D21]
 gi|226904160|gb|EEH90078.1| conserved hypothetical protein [Acidaminococcus sp. D21]
          Length = 109

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 39/114 (34%), Positives = 59/114 (51%), Gaps = 10/114 (8%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +T+      AH L R+P   KC R+HGH++ +E+    +   + G V DF +I+      
Sbjct: 5   VTKRMEVSGAHAL-RLPYESKCTRLHGHNWIIEVTCRREELDENGMVVDFHHIKDVV--- 60

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
            +KLDH  LN I  + NPTAENIA WI  ++       + V V E+  +   Y+
Sbjct: 61  -KKLDHQNLNAILSM-NPTAENIAKWIHDQV----PYCTKVMVQESEGNVAVYE 108


>gi|268563987|ref|XP_002638986.1| C. briggsae CBR-PTPS-1 protein [Caenorhabditis briggsae]
          Length = 137

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 37/129 (28%), Positives = 68/129 (52%), Gaps = 16/129 (12%)

Query: 5   QAFTFEAAHRL--------PRVPKTHKCHR--MHGHSYRVELVMEGDVDPKTGFVDDFFN 54
           +   F AAHRL               KC+    HGH+Y  ++ + G+VDP +G V D   
Sbjct: 8   RVEMFSAAHRLNSENLSVAENKETFGKCNNDNGHGHNYVWKVKLRGEVDPVSGMVYDLAK 67

Query: 55  IEQYFSPLLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSLSI---LSSVRVYET 108
           +++  + +L+ +DH  L+ ++E  +    T+EN+AI+++++L + +S    L    + ET
Sbjct: 68  LKKEMNLVLDTVDHRNLDKDVEFFKTTVSTSENVAIYMYQKLKSVMSNPSVLYKCTIEET 127

Query: 109 PMSWVEYQG 117
           P +   Y+G
Sbjct: 128 PKNVFTYKG 136


>gi|288556798|ref|YP_003428733.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus pseudofirmus OF4]
 gi|288547958|gb|ADC51841.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus pseudofirmus OF4]
          Length = 141

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 38/124 (30%), Positives = 60/124 (48%), Gaps = 12/124 (9%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ +     AAH +        C  +HGH+Y + + + GD    TGF+ +F NI+    
Sbjct: 15  FELNKDMHLAAAHFI-NDESAGACQNIHGHTYFINVTIAGDELDSTGFLINFKNIKTLVH 73

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSL------SILSSVRVYETPMSW 112
               + DH  LNE +E E  +PT E +A+ IW+ + + L           V V ETP S+
Sbjct: 74  K---RYDHSLLNEHKEYEDLDPTTEVVAMQIWETIQSHLDTLSNQPKCIQVLVRETPTSY 130

Query: 113 VEYQ 116
           V Y+
Sbjct: 131 VVYR 134


>gi|193214205|ref|YP_001995404.1| hypothetical protein Ctha_0486 [Chloroherpeton thalassium ATCC
           35110]
 gi|193087682|gb|ACF12957.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Chloroherpeton thalassium ATCC 35110]
          Length = 153

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 41/136 (30%), Positives = 73/136 (53%), Gaps = 21/136 (15%)

Query: 3   ITQAFTFEAAHRLPRVPKTH--------KCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+   F AAHRL     +         +C+ +  HGH+Y +E+ ++G VD  TG+V D 
Sbjct: 17  VTRKVHFSAAHRLFNPEFSDAENELIYDRCNNIYGHGHNYELEVTLKGPVDKATGYVFDL 76

Query: 53  FNIEQYFSPLL-EKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI-------LS 101
             +++  S  +  K+DH  LN ++E L++  P+AE ++I  W  +   LS        L 
Sbjct: 77  KKLDKILSEEILSKVDHKHLNFDVEMLKDMIPSAEVLSIVFWNAIQNRLSELGYTQVALY 136

Query: 102 SVRVYETPMSWVEYQG 117
            V+++E+  ++V Y+G
Sbjct: 137 EVKLFESERNFVRYRG 152


>gi|108805368|ref|YP_645305.1| putative 6-pyruvoyl tetrahydropterin synthase [Rubrobacter
           xylanophilus DSM 9941]
 gi|108766611|gb|ABG05493.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Rubrobacter xylanophilus DSM 9941]
          Length = 125

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 41/122 (33%), Positives = 62/122 (50%), Gaps = 8/122 (6%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           +I  A  FEAAHRL          R+HGH+YR+E ++ G+   + G + D   + +    
Sbjct: 3   EIRVAARFEAAHRLAG--DFGPASRLHGHTYRLEAIVRGERLREDGTLYDIGALREAVDA 60

Query: 62  LLEKLDHHCLNEIEEL--ENPTAENIAIWIWKRLSTSL--SILSS--VRVYETPMSWVEY 115
           L   L +  L+E+  L  +N TAE +A   W+ L+  L    LSS  VRV+E P  +   
Sbjct: 61  LASSLHYRNLDEVPGLAGKNTTAEAVASHCWESLAPGLRGRGLSSLAVRVWENPEVYAAR 120

Query: 116 QG 117
           +G
Sbjct: 121 EG 122


>gi|296124357|ref|YP_003632135.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Planctomyces limnophilus DSM 3776]
 gi|296016697|gb|ADG69936.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Planctomyces limnophilus DSM 3776]
          Length = 136

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 32/133 (24%), Positives = 61/133 (45%), Gaps = 19/133 (14%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYF- 59
            +++    F   HRL     + KC  +HGH+ +  + + G+   + G + DF ++++   
Sbjct: 2   FEVSSEIQFCYGHRLLNY--SGKCRHLHGHNGKAIITLAGESLDERGMLVDFGDLKRTVS 59

Query: 60  SPLLEKLDHHC-LNEIEEL---------------ENPTAENIAIWIWKRLSTSLSILSSV 103
             + + LDH   L E + +               ENPTAENIA  I+++       +  V
Sbjct: 60  QWIDDHLDHRMVLCERDPMVKILRDAGEPLYLIPENPTAENIAKLIYEKTVEVGLPVIQV 119

Query: 104 RVYETPMSWVEYQ 116
            ++ET  ++  Y+
Sbjct: 120 GLWETAKNYAVYR 132


>gi|288818349|ref|YP_003432697.1| 6-pyruvoyl tetrahydrobiopterin synthase [Hydrogenobacter
           thermophilus TK-6]
 gi|288787749|dbj|BAI69496.1| 6-pyruvoyl tetrahydrobiopterin synthase [Hydrogenobacter
           thermophilus TK-6]
 gi|308751942|gb|ADO45425.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Hydrogenobacter thermophilus TK-6]
          Length = 164

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 43/159 (27%), Positives = 71/159 (44%), Gaps = 44/159 (27%)

Query: 2   KITQAFTFEAAHRLPRVPKTH---------------KCHRMHGHSYRVELVMEGDVDPKT 46
           KIT+ F FEA HR+ +   TH               KC  +HGHSY +E+ +  D   + 
Sbjct: 4   KITKVFNFEAGHRVWKQNLTHGRGAELTGRDVPLQNKCVNLHGHSYTLEVTLGSDTLSEQ 63

Query: 47  GFVDDFFNIEQYFSPLLEKLDHHCLNEI-----EELEN----------------PTAENI 85
             V DF++++     L++ +DH  + ++     EEL++                PTAE +
Sbjct: 64  DMVMDFYHVKNALKDLIDTMDHSFIIDVNDPMYEELKSLAEKYGAFKIFPVPFCPTAEAL 123

Query: 86  AIWIWKRLSTSLS--------ILSSVRVYETPMSWVEYQ 116
           A + +  L+  L          + SV ++ET  S  EY+
Sbjct: 124 AKYFYDFLTQKLEQAGLLKDVKVVSVVLWETKTSKAEYR 162


>gi|170756565|ref|YP_001781190.1| putative 6-pyruvoyl tetrahydropterin synthase [Clostridium
           botulinum B1 str. Okra]
 gi|169121777|gb|ACA45613.1| queuosine biosynthesis protein QueD [Clostridium botulinum B1 str.
           Okra]
          Length = 143

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 34/137 (24%), Positives = 60/137 (43%), Gaps = 25/137 (18%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPK----TGFVDDFFNIEQY 58
           +     F++AH L       KC  +HGH ++VE+ ++ +   +     G + DF ++++ 
Sbjct: 4   LKVEHNFDSAHFLAGYE--GKCGNIHGHRWKVEIQVQAESLVQGGQLDGMIIDFGDLKKD 61

Query: 59  FSPLLEKLDHHCLNE-------------------IEELENPTAENIAIWIWKRLSTSLSI 99
              +++  DH  + E                   IE    PTAEN A + +K +      
Sbjct: 62  VKSMVDYHDHALIIEKGTMRGQSLSSLKEDGFRIIEVNFRPTAENFAAFFYKIMKNRGYN 121

Query: 100 LSSVRVYETPMSWVEYQ 116
           + SV VYETP +   Y+
Sbjct: 122 VKSVTVYETPNNSATYE 138


>gi|322418701|ref|YP_004197924.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Geobacter sp. M18]
 gi|320125088|gb|ADW12648.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Geobacter sp. M18]
          Length = 122

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 61/122 (50%), Gaps = 8/122 (6%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++T    F AAH L        C  +HGH+++VE+ +  +   K G   DF  +++  +
Sbjct: 2   FRLTIHTAFAAAHNLINYQGD--CENLHGHNWKVEVSITTNELDKAGLGIDFKILKRETN 59

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
            LL+ LDH  LNE+      +P++ENIA ++++ L+         +  V V+E+  +   
Sbjct: 60  DLLKTLDHKYLNELAPFASISPSSENIARYLYRELTKIFGSDKVKVEMVTVWESDFAAAT 119

Query: 115 YQ 116
           Y 
Sbjct: 120 YY 121


>gi|284118229|ref|ZP_06386762.1| conserved hypothetical protein [Candidatus Poribacteria sp. WGA-A3]
 gi|283829465|gb|EFC33835.1| conserved hypothetical protein [Candidatus Poribacteria sp. WGA-A3]
          Length = 143

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 37/129 (28%), Positives = 61/129 (47%), Gaps = 15/129 (11%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+ + F AAHRL               KC+    HGH Y V + + G++DP+TG V D 
Sbjct: 7   VTRQYRFCAAHRLHTDALSDDVNRKVYDKCNNPNGHGHDYTVFVTVTGELDPQTGEVTDI 66

Query: 53  FNIEQYFS-PLLEKLDHHCLNEIEELEN--PTAENIAIWIWKRLSTSLS--ILSSVRVYE 107
             ++   +  ++E+ DH  LN     +    T EN+  +IW  L   +    L  + + E
Sbjct: 67  HALDGLVNRKIVERFDHRHLNHDPAFQQLVTTGENLVKFIWDELVDDIPGGRLEKIGLIE 126

Query: 108 TPMSWVEYQ 116
           T  ++ EY+
Sbjct: 127 TRDNYFEYR 135


>gi|256827914|ref|YP_003156642.1| hypothetical protein Dbac_0097 [Desulfomicrobium baculatum DSM
           4028]
 gi|256577090|gb|ACU88226.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfomicrobium baculatum DSM 4028]
          Length = 130

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 35/121 (28%), Positives = 66/121 (54%), Gaps = 9/121 (7%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDV-DPKTGFVDDFFNIEQYFS 60
           ++  +  F ++H+L       KC  MHGH++ VE+ + G+  DPK G + DF  +++   
Sbjct: 7   RLRVSSDFSSSHQLRHYE--GKCENMHGHNFTVEVDVVGESLDPKLGILMDFKALKRLLK 64

Query: 61  PLLEKLDHHCLNEIEEL--ENPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
            + ++LDH  LN++ +   +NP++E +A +++ R+   L+     L+ V V E   S   
Sbjct: 65  EVTDELDHRHLNDLPDFAEQNPSSELLARFVFLRMKNLLAPYPVRLTEVMVSEKASSRAY 124

Query: 115 Y 115
           Y
Sbjct: 125 Y 125


>gi|298492472|ref|YP_003722649.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           ['Nostoc azollae' 0708]
 gi|298234390|gb|ADI65526.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           ['Nostoc azollae' 0708]
          Length = 129

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 57/121 (47%), Gaps = 12/121 (9%)

Query: 6   AFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVM------EGDVDPKTGFVDDFFNIEQYF 59
            FTF++AH +        C RMHGH+YRV++          +  P    V DF ++    
Sbjct: 9   EFTFDSAHYIKDY--NGPCGRMHGHTYRVKIEAKSSQLNSSEYCPHPVMVADFRSLRWAK 66

Query: 60  SPLLE-KLDHHCLNEIEELE-NPTAENIAIWIWKRLSTSLSILSSVR--VYETPMSWVEY 115
             + +  LDH  LNE+   E   TAE IA +I+      L     ++  V ETP SW EY
Sbjct: 67  KDVTKGGLDHCVLNEVLPPEYETTAEMIAKYIYAETKKRLPQDVKLKVAVSETPNSWAEY 126

Query: 116 Q 116
           +
Sbjct: 127 E 127


>gi|221113649|ref|XP_002156810.1| PREDICTED: similar to AGAP008730-PA [Hydra magnipapillata]
          Length = 152

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 34/132 (25%), Positives = 64/132 (48%), Gaps = 17/132 (12%)

Query: 3   ITQAFTFEAAHRLP--------RVPKTHKCHR--MHGHSYRVELVMEGDVDPKTGFVDDF 52
           +T++     +HRL          +    KC+    HGH+Y++++ + G +  +TG V + 
Sbjct: 15  LTRSEFVSCSHRLHSCLLSEEENLKIYGKCNNKNGHGHNYKIKVTLYGPIKEETGMVMNL 74

Query: 53  FNIEQYFS-PLLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLS---TSLSILSSVRV 105
             +  Y    +++ LDH  L+ ++   +N   TAEN+ ++IW  L        +L  V+V
Sbjct: 75  TTLRDYMKVCVVDALDHKNLDMDVPWFKNKVSTAENLVVFIWNSLKLVMDEPQLLYEVKV 134

Query: 106 YETPMSWVEYQG 117
            ET  +   Y+G
Sbjct: 135 QETDKNVAFYRG 146


>gi|52425911|ref|YP_089048.1| hypothetical protein MS1856 [Mannheimia succiniciproducens MBEL55E]
 gi|52307963|gb|AAU38463.1| unknown [Mannheimia succiniciproducens MBEL55E]
          Length = 142

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 34/142 (23%), Positives = 71/142 (50%), Gaps = 28/142 (19%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKT----GFVDDFFNIE 56
            K+++ F+F+ AH L       KC  +HGH+Y++++ +      ++    G V DF +++
Sbjct: 2   FKVSKEFSFDMAHILDG--HDGKCQNLHGHTYKLQVEVMSAQLHQSGAKKGMVVDFSDLK 59

Query: 57  QYFSPLL-EKLDHHCLNE------------IEELEN--------PTAENIAIWIWKRLS- 94
                 + + +DH  + +            + EL++         TAE ++ +I+ RL  
Sbjct: 60  TVVKKFILDPMDHAFIYDNTSERECKIARLLVELDSKTFGIPVRTTAEEMSRFIFNRLKH 119

Query: 95  TSLSILSSVRVYETPMSWVEYQ 116
            +   +S++R++ETP S+ EY+
Sbjct: 120 DAGLPVSAIRLWETPTSFCEYR 141


>gi|325299597|ref|YP_004259514.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Bacteroides salanitronis DSM 18170]
 gi|324319150|gb|ADY37041.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Bacteroides salanitronis DSM 18170]
          Length = 110

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 33/114 (28%), Positives = 54/114 (47%), Gaps = 9/114 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + +     A+H L  +P   KC  +HGH++ + +        + G V DF  I++     
Sbjct: 4   VIKRMEISASHSLT-LPYPSKCENLHGHNWIITVYCRSKELNEYGMVVDFSQIKEVVQ-- 60

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
              LDH  LN++    NPTAENIA W+ +++         V V E+  + V Y+
Sbjct: 61  -GALDHRHLNDVLPF-NPTAENIARWVCEQV----PYCFKVEVRESEGNTVIYE 108


>gi|145219888|ref|YP_001130597.1| putative 6-pyruvoyl tetrahydropterin synthase [Prosthecochloris
           vibrioformis DSM 265]
 gi|145206052|gb|ABP37095.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Chlorobium phaeovibrioides DSM 265]
          Length = 157

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 41/136 (30%), Positives = 64/136 (47%), Gaps = 21/136 (15%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHR--MHGHSYRVELVMEGDVDPKTGFVDDF 52
           +T+   F AAHRL     +         KC     HGH+Y +E+ + G +DP TGF+ D 
Sbjct: 21  VTRTIEFNAAHRLFNPEFSDEKNREIYGKCANAHGHGHNYLLEITLGGIMDPDTGFLFDL 80

Query: 53  FNIEQYFSPL-LEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI-------LS 101
             ++       + + DH  LN ++ EL +  PT E +A+ IW  L             L 
Sbjct: 81  KELKGILEEEVMARFDHRHLNHDVPELNDLVPTTEVLAVLIWDILEQRFQNIDNREISLQ 140

Query: 102 SVRVYETPMSWVEYQG 117
           +V+++ET  + V Y G
Sbjct: 141 AVKIHETGKNSVSYLG 156


>gi|284054112|ref|ZP_06384322.1| putative 6-pyruvoyl tetrahydropterin synthase [Arthrospira
           platensis str. Paraca]
          Length = 290

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 40/130 (30%), Positives = 62/130 (47%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRV--------PKTHKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T +  F AAHRL               KC R HGH  +Y +E+ + G +DP+TG + D 
Sbjct: 138 LTISTHFSAAHRLAHPLLNDEDNSKIYGKCARPHGHGHNYHLEVTIRGQIDPRTGMIADL 197

Query: 53  FNI-EQYFSPLLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSI----LSSVR 104
             + +     ++E  DH  LN +I       PTAENIA++I   L   +      L  ++
Sbjct: 198 GAVQKAIDDYVVEPFDHTFLNKDIPYFAKVVPTAENIAVYIRDLLQNPIDELGANLHKIK 257

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 258 LIESPNNSCE 267



 Score = 80.2 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 37/129 (28%), Positives = 59/129 (45%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHR----------MHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F A+HR      +   +            HGH+Y + + M G+   + G V + 
Sbjct: 5   ITRRAQFSASHRYWLPELSEAENFAKFGQTARAPGHGHNYVLYVSMVGE-LDEYGMVLNL 63

Query: 53  FNIEQYFS-PLLEKLDHHCLNEIEELEN---PTAENIAIWIWKRLSTSLSILSSVRVYET 108
            N++      + E LD   LNE         PT E +A  IW RL+  L  L++++++E 
Sbjct: 64  SNVKHTIRSEVTEPLDFSFLNEAWPEFQHTLPTTEFLAYLIWHRLAPHLP-LTNIQLFEH 122

Query: 109 PMSWVEYQG 117
           P  W +YQG
Sbjct: 123 PQLWADYQG 131


>gi|52079922|ref|YP_078713.1| 6-pyruvoyl tetrahydropterin synthase QueD [Bacillus licheniformis
           ATCC 14580]
 gi|52785293|ref|YP_091122.1| YkvK [Bacillus licheniformis ATCC 14580]
 gi|319646261|ref|ZP_08000491.1| YkvK protein [Bacillus sp. BT1B_CT2]
 gi|52003133|gb|AAU23075.1| 6-pyruvoyl tetrahydropterin synthase QueD [Bacillus licheniformis
           ATCC 14580]
 gi|52347795|gb|AAU40429.1| YkvK [Bacillus licheniformis ATCC 14580]
 gi|317392011|gb|EFV72808.1| YkvK protein [Bacillus sp. BT1B_CT2]
          Length = 146

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 36/128 (28%), Positives = 60/128 (46%), Gaps = 16/128 (12%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++ +     AAH +PR      C R+HGH+Y + + + GD    +GF+ +F  I++   
Sbjct: 15  FELNKDMQMSAAHFIPR-EDAGACSRVHGHTYTINITIAGDELNASGFLVNFSTIKKLIH 73

Query: 61  PLLEKLDHHCLNEIEELEN------PTAENIAIWIWKRLSTSLSIL------SSVRVYET 108
               + DH  LN+ +E         P+ E +A  I+ ++   L  L        V V ET
Sbjct: 74  ---GEYDHTLLNDHQEFSGESADRIPSTEVVAKTIYDKVEAYLKDLNNRPHCVQVFVRET 130

Query: 109 PMSWVEYQ 116
           P S+V Y+
Sbjct: 131 PTSYVVYR 138


>gi|119356805|ref|YP_911449.1| putative 6-pyruvoyl tetrahydropterin synthase [Chlorobium
           phaeobacteroides DSM 266]
 gi|119354154|gb|ABL65025.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Chlorobium phaeobacteroides DSM 266]
          Length = 152

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 42/138 (30%), Positives = 66/138 (47%), Gaps = 21/138 (15%)

Query: 1   MKITQAFTFEAAHRLPRVPKT--------HKCHR--MHGHSYRVELVMEGDVDPKTGFVD 50
           + +T+   F AAHRL     +         KC     HGH+Y +E+ + G +DP+TGF+ 
Sbjct: 14  IYVTRTIGFNAAHRLFNPDFSDQENHKIYGKCSNEHGHGHNYELEITLYGTIDPQTGFLF 73

Query: 51  DFFNIEQYFSPL-LEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSLSI------- 99
           D   ++        E+ DH  LN ++ E+++   T E +A+ IW  L   L         
Sbjct: 74  DLKQLKSILEEEITERFDHKHLNFDVREMQDCVPTTELLAVVIWDILDLRLQQFNNREIT 133

Query: 100 LSSVRVYETPMSWVEYQG 117
           L  V++YET  + V Y G
Sbjct: 134 LYEVKIYETGKNAVRYLG 151


>gi|298531021|ref|ZP_07018422.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509044|gb|EFI32949.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Desulfonatronospira thiodismutans ASO3-1]
          Length = 128

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 38/114 (33%), Positives = 64/114 (56%), Gaps = 9/114 (7%)

Query: 9   FEAAHRLPRVPKTHKCHRMHGHSYRVELVMEG-DVDPKTGFVDDFFNIEQYFSPLLEKLD 67
           F ++H+L       KC  +HGH+++V++ + G +VDP TG + DF  ++     +LE+LD
Sbjct: 14  FSSSHQLRNY--GGKCESLHGHNFQVQVQVCGKEVDPDTGMLMDFKELKNTLLAVLEELD 71

Query: 68  HHCLNEIEELE--NPTAENIAIWIWKRLSTSLSI----LSSVRVYETPMSWVEY 115
           H  LN++   +  NP++EN+A ++++ L  SL      L  V V E   S   Y
Sbjct: 72  HKHLNDLPHFKETNPSSENLACFVYQGLKKSLGNRGVYLDWVMVAEKDSSRAYY 125


>gi|209526965|ref|ZP_03275482.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Arthrospira maxima CS-328]
 gi|209492567|gb|EDZ92905.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Arthrospira maxima CS-328]
          Length = 290

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/130 (30%), Positives = 62/130 (47%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRV--------PKTHKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T +  F AAHRL               KC R HGH  +Y +E+ + G +DP+TG + D 
Sbjct: 138 LTISTHFSAAHRLAHPLLSDEDNSKIYGKCARPHGHGHNYHLEVTIRGQIDPRTGMIADL 197

Query: 53  FNI-EQYFSPLLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSI----LSSVR 104
             + +     ++E  DH  LN +I       PTAENIA++I   L   +      L  ++
Sbjct: 198 GAVQKAIDDYVVEPFDHTFLNKDIPYFAKVVPTAENIAVYIRDLLQNPIDELGAHLHKIK 257

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 258 LIESPNNSCE 267



 Score = 79.8 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 38/129 (29%), Positives = 62/129 (48%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHR----------MHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F A+HR      +   +            HGH+Y + + M G+   + G V + 
Sbjct: 5   ITRRAQFSASHRYWLPELSEAENFAKFGQTARAPGHGHNYVLYVSMVGE-LDEYGMVLNL 63

Query: 53  FNIEQYFS-PLLEKLDHHCLNEI-EELEN--PTAENIAIWIWKRLSTSLSILSSVRVYET 108
            N++      + E LD   LNE   E ++  PT E +A  IW RL+  L  L++++++E 
Sbjct: 64  SNVKHTIRSEVTEPLDFSFLNEAWLEFQDTLPTTEFLAYLIWHRLAPHLP-LTNIQLFEH 122

Query: 109 PMSWVEYQG 117
           P  W +YQG
Sbjct: 123 PQLWADYQG 131


>gi|319779039|ref|YP_004129952.1| Queuosine biosynthesis QueD, PTPS-I [Taylorella equigenitalis MCE9]
 gi|317109063|gb|ADU91809.1| Queuosine biosynthesis QueD, PTPS-I [Taylorella equigenitalis MCE9]
          Length = 143

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/138 (28%), Positives = 65/138 (47%), Gaps = 26/138 (18%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEG---DVDPKTGFVDDFFNIEQ 57
           MK+ + F F+ AH L       KC  +HGH+YR+E+ + G   +  PK G V DF +++ 
Sbjct: 1   MKVVKTFNFDIAHLLDG--HDGKCKNLHGHTYRLEVEVAGPVIEDGPKKGMVIDFADLKS 58

Query: 58  YFSP-LLEKLDHHCLNE-------------------IEELE-NPTAENIAIWIWKRLSTS 96
                ++ ++DH  L +                       +   TAENI+  I+  L   
Sbjct: 59  VVDDLIIARMDHAFLYDSTNERETAIAQLLEGWNMKTYPFKHRTTAENISRHIFDLLRER 118

Query: 97  LSILSSVRVYETPMSWVE 114
           L  ++ VR++ETP S+ E
Sbjct: 119 LEGVNRVRLWETPSSYSE 136


>gi|193212942|ref|YP_001998895.1| hypothetical protein Cpar_1292 [Chlorobaculum parvum NCIB 8327]
 gi|193086419|gb|ACF11695.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Chlorobaculum parvum NCIB 8327]
          Length = 149

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 41/138 (29%), Positives = 69/138 (50%), Gaps = 21/138 (15%)

Query: 1   MKITQAFTFEAAHRLPRVPKT--------HKCH--RMHGHSYRVELVMEGDVDPKTGFVD 50
           + +T+   F AAHRL     +         KC     HGH+Y +E+ + G ++ KTG++ 
Sbjct: 11  IYVTRTIEFNAAHRLFNPELSEEENRSLYGKCSGKYGHGHNYLLEITLSGPINRKTGYLF 70

Query: 51  DFFNIEQYFSPLL-EKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI------- 99
           D   ++      +  + DH  +N E++EL+N  PT E +A+ +W  L T L         
Sbjct: 71  DLKKLKTILEEEIVTRFDHRHMNFEVKELQNHVPTTEILAVVVWDILETRLETITKQEVS 130

Query: 100 LSSVRVYETPMSWVEYQG 117
           L  V+++ET  + V Y+G
Sbjct: 131 LHEVKIHETGKNSVTYRG 148


>gi|213963058|ref|ZP_03391317.1| 6-pyruvoyl tetrahydrobiopterin synthase [Capnocytophaga sputigena
           Capno]
 gi|213954399|gb|EEB65722.1| 6-pyruvoyl tetrahydrobiopterin synthase [Capnocytophaga sputigena
           Capno]
          Length = 150

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 38/144 (26%), Positives = 64/144 (44%), Gaps = 30/144 (20%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDP-----KTGFVDDFFNI 55
           ++IT+ F FEA H L       KC  +HGHSY++ + + G+        K G V DF ++
Sbjct: 2   IRITKKFDFEAGHALFGYD--GKCKNLHGHSYKLYVTVIGEPINNPHNVKNGMVIDFGDL 59

Query: 56  EQYFSPL-LEKLDHHC-LNEIEELE------------------NPTAENIAIWIWKRLST 95
           ++      ++  DH    NE+   +                   PT+EN+     +R++ 
Sbjct: 60  KRIVQEQIIDAFDHAMVFNELSPHKALADELRAKGHRIITVPYQPTSENLVTDFAQRIAY 119

Query: 96  SLSI---LSSVRVYETPMSWVEYQ 116
            L     L S+R+ ET  S+ E+ 
Sbjct: 120 QLPAGVTLFSIRLCETESSYAEWF 143


>gi|189460363|ref|ZP_03009148.1| hypothetical protein BACCOP_01000 [Bacteroides coprocola DSM 17136]
 gi|189432915|gb|EDV01900.1| hypothetical protein BACCOP_01000 [Bacteroides coprocola DSM 17136]
          Length = 110

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 34/114 (29%), Positives = 56/114 (49%), Gaps = 9/114 (7%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           + +     A+H L ++    KC ++HGH++ + +        + G V DF +I+Q     
Sbjct: 4   VIKRMEISASHSL-KLSYPSKCEKLHGHNWIITVYCRSKELDENGMVVDFTHIKQAVEK- 61

Query: 63  LEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQ 116
             +LDH+ LN+I    NPTAENIA WI  ++         V V E+  +   Y+
Sbjct: 62  --QLDHNNLNDILPF-NPTAENIACWICNQV----PHCFKVEVKESEGNTAIYE 108


>gi|309355494|emb|CAP38866.2| CBR-PTPS-1 protein [Caenorhabditis briggsae AF16]
          Length = 132

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 37/129 (28%), Positives = 68/129 (52%), Gaps = 16/129 (12%)

Query: 5   QAFTFEAAHRL--------PRVPKTHKCHR--MHGHSYRVELVMEGDVDPKTGFVDDFFN 54
           +   F AAHRL               KC+    HGH+Y  ++ + G+VDP +G V D   
Sbjct: 3   RVEMFSAAHRLNSENLSVAENKETFGKCNNDNGHGHNYVWKVKLRGEVDPVSGMVYDLAK 62

Query: 55  IEQYFSPLLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSLSI---LSSVRVYET 108
           +++  + +L+ +DH  L+ ++E  +    T+EN+AI+++++L + +S    L    + ET
Sbjct: 63  LKKEMNLVLDTVDHRNLDKDVEFFKTTVSTSENVAIYMYQKLKSVMSNPSVLYKCTIEET 122

Query: 109 PMSWVEYQG 117
           P +   Y+G
Sbjct: 123 PKNVFTYKG 131


>gi|291569670|dbj|BAI91942.1| 6-pyruvoyl tetrahydropterin synthase homolog [Arthrospira platensis
           NIES-39]
          Length = 290

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/130 (30%), Positives = 63/130 (48%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRV--------PKTHKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T +  F AAHRL               KC R HGH  +Y +E+ + G +DP+TG + D 
Sbjct: 138 LTISTHFSAAHRLAHPLLNDEDNSKIYGKCARPHGHGHNYHLEVTIRGQIDPRTGMIADL 197

Query: 53  FNI-EQYFSPLLEKLDHHCLN-EIEELE--NPTAENIAIWIWKRLSTSLSI----LSSVR 104
             + +     ++E  DH  LN +I       PTAENIA++I + L   +      L  ++
Sbjct: 198 GAVQKAIDDYVVEPFDHTFLNKDIPYFAKVVPTAENIAVYIRELLQNPIDELGANLHKIK 257

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 258 LIESPNNSCE 267



 Score = 79.8 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 37/129 (28%), Positives = 59/129 (45%), Gaps = 16/129 (12%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHR----------MHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F A+HR      +   +            HGH+Y + + M G+   + G V + 
Sbjct: 5   ITRRAQFSASHRYWLPELSEAENFAKFGQTARAPGHGHNYVLYVSMVGE-LDEYGMVLNL 63

Query: 53  FNIEQYFS-PLLEKLDHHCLNEIEELEN---PTAENIAIWIWKRLSTSLSILSSVRVYET 108
            N++      + E LD   LNE         PT E +A  IW RL+  L  L++++++E 
Sbjct: 64  SNVKHTIRSEVTEPLDFSFLNEAWPEFQHTLPTTEFLAYLIWHRLAPHLP-LTNIQLFEH 122

Query: 109 PMSWVEYQG 117
           P  W +YQG
Sbjct: 123 PQLWADYQG 131


>gi|160893108|ref|ZP_02073896.1| hypothetical protein CLOL250_00654 [Clostridium sp. L2-50]
 gi|156865191|gb|EDO58622.1| hypothetical protein CLOL250_00654 [Clostridium sp. L2-50]
          Length = 139

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 33/131 (25%), Positives = 57/131 (43%), Gaps = 25/131 (19%)

Query: 8   TFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVD----PKTGFVDDFFNIEQYFSPLL 63
           +F++AH L       KC  +HGH + VE+ + G+         G V DF ++++      
Sbjct: 9   SFDSAHFLAGYE--GKCRNLHGHRWTVEVEVGGEKLMQDGQTRGMVVDFGDLKKDLREKT 66

Query: 64  EKLDHHCLNEIEELE-------------------NPTAENIAIWIWKRLSTSLSILSSVR 104
           E++DH  + E   L+                    PTAEN+A + ++ ++     +    
Sbjct: 67  EEMDHCLIMEKGTLKEKTMEALAEEQFRIIELPMRPTAENLAKYFYEYMADKGYQVIRTT 126

Query: 105 VYETPMSWVEY 115
           VYETP +   Y
Sbjct: 127 VYETPTNAATY 137


>gi|205373222|ref|ZP_03226026.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus coahuilensis
           m4-4]
          Length = 147

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 34/127 (26%), Positives = 59/127 (46%), Gaps = 16/127 (12%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ + F F AAH +P       C R+HGH+Y   + + GD    +GF+ +F ++++    
Sbjct: 16  ELNKDFHFSAAHYVPH-EDAGVCQRIHGHTYFCNVTIAGDSLDDSGFLINFKDVKKLIH- 73

Query: 62  LLEKLDHHCLNEIEELEN------PTAENIAIWIWKRLSTSL------SILSSVRVYETP 109
             ++ DH  LN+     +      PT E +A  I+  +   L           V + ETP
Sbjct: 74  --DRFDHTILNDDNRFHDEVSDRFPTTEVVAREIYLVIQEHLNSLKNKPTCIQVFLRETP 131

Query: 110 MSWVEYQ 116
            S+V Y+
Sbjct: 132 TSYVVYR 138


>gi|312111880|ref|YP_003990196.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Geobacillus sp. Y4.1MC1]
 gi|311216981|gb|ADP75585.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Geobacillus sp. Y4.1MC1]
          Length = 144

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/128 (31%), Positives = 61/128 (47%), Gaps = 17/128 (13%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ +     AAH +P   K  KC  MHGH Y V + + GD     GF+ +F  +++    
Sbjct: 16  ELNKDMHIAAAHFIPH-EKAGKCANMHGHIYTVNITVAGDELDDAGFLVNFQELKKLIH- 73

Query: 62  LLEKLDHHCLNEIEELEN-------PTAENIAIWIWKRLSTSL------SILSSVRVYET 108
             +KLDH  +NE ++  N       PT+E IA  I++ +   L           V V ET
Sbjct: 74  --DKLDHTLMNEHQDWFNEQNSNDFPTSEVIARKIYETVQAHLDTLPNKPKCLQVFVRET 131

Query: 109 PMSWVEYQ 116
           P S+V Y+
Sbjct: 132 PTSYVVYR 139


>gi|315645650|ref|ZP_07898774.1| 6-pyruvoyl tetrahydrobiopterin synthase [Paenibacillus vortex V453]
 gi|315279128|gb|EFU42438.1| 6-pyruvoyl tetrahydrobiopterin synthase [Paenibacillus vortex V453]
          Length = 206

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/96 (33%), Positives = 53/96 (55%), Gaps = 4/96 (4%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
           +++ FTF+AAH L       KC  +HGH+Y+V   + G    + G   DF +I+  +   
Sbjct: 35  VSKEFTFDAAHHLHCYE--GKCKNLHGHTYKVVFGISGIP-NEVGITVDFGDIKDCWKTD 91

Query: 63  LEKL-DHHCLNEIEELENPTAENIAIWIWKRLSTSL 97
           +E   DH  LNE     N TAEN+ +W+++++  +L
Sbjct: 92  IEPYLDHRYLNETLPPMNTTAENMVVWLFEKMEDAL 127


>gi|284054128|ref|ZP_06384338.1| putative 6-pyruvoyl tetrahydropterin synthase [Arthrospira
           platensis str. Paraca]
 gi|291571435|dbj|BAI93707.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 130

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 57/125 (45%), Gaps = 12/125 (9%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELV------MEGDVDPKTGFVDDFFNI 55
           K+T  FTF++AH +        C R+HGH+Y+V +          +  P    V DF ++
Sbjct: 5   KLTTEFTFDSAHYIKDY--NGPCGRLHGHTYKVRVEATSNQLHSSEFCPHPVMVADFRSL 62

Query: 56  EQYFSPLLE-KLDHHCLNEI-EELENPTAENIAIWIWKRLSTSLSI--LSSVRVYETPMS 111
                 + +  LDH  LNEI       TAE IA +I+      +       V V ET  S
Sbjct: 63  RWAKKDVSKGGLDHGLLNEILPPNYETTAEMIAKFIYDETKKRVPEGVQLKVMVSETANS 122

Query: 112 WVEYQ 116
           WVEY+
Sbjct: 123 WVEYE 127


>gi|298250152|ref|ZP_06973956.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Ktedonobacter racemifer DSM 44963]
 gi|297548156|gb|EFH82023.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Ktedonobacter racemifer DSM 44963]
          Length = 151

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 41/139 (29%), Positives = 65/139 (46%), Gaps = 30/139 (21%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPK-----TGFVDDFFNIEQ 57
           +T+ F FEA+H LP      KC R HGHSYR+E+ + G +         G V DF ++++
Sbjct: 7   VTREFNFEASHHLPN--HRGKCRRPHGHSYRLEVSLRGPIIEAPGESSDGMVMDFEDLKE 64

Query: 58  YFSPLLEK-------------------LDHHCLNEIEELENPTAENIAIWIWKRLST--- 95
             +  + +                   +DH+ LN +  +   TAEN+  WIW  L +   
Sbjct: 65  IVNHCIIESLSDSVPRGPEAIPVEKGGMDHNDLNALTGIR-TTAENLVHWIWDALVSGGV 123

Query: 96  SLSILSSVRVYETPMSWVE 114
              +L  VR++ET   + E
Sbjct: 124 REELLYRVRLWETAKGYAE 142


>gi|167757162|ref|ZP_02429289.1| hypothetical protein CLORAM_02712 [Clostridium ramosum DSM 1402]
 gi|167703337|gb|EDS17916.1| hypothetical protein CLORAM_02712 [Clostridium ramosum DSM 1402]
          Length = 162

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 35/135 (25%), Positives = 62/135 (45%), Gaps = 26/135 (19%)

Query: 6   AFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTG----FVDDFFNIEQYFSP 61
             +F++AH L       KC  +HGH ++V   ++ +   +       V DF ++++    
Sbjct: 29  EQSFDSAHFLAGY--HGKCANIHGHRWKVIATIKSEKLLEDPQNKGMVTDFGDLKKDLKI 86

Query: 62  LLEKLDHHCLNEIEEL----------EN---------PTAENIAIWIWKRLSTSLSILSS 102
           + +  DH  + E   L          EN         PTAEN+A +I++ LS +  ++  
Sbjct: 87  IADSFDHALIIETGSLSEKLYQALIDENFKIINLPFRPTAENLAKYIYEALSKNY-LVDC 145

Query: 103 VRVYETPMSWVEYQG 117
           + VYETP +   Y+G
Sbjct: 146 LDVYETPNNCASYRG 160


>gi|68249736|ref|YP_248848.1| 6-pyruvoyl tetrahydrobiopterin synthase [Haemophilus influenzae
           86-028NP]
 gi|68057935|gb|AAX88188.1| predicted 6-pyruvoyl-tetrahydropterin synthase [Haemophilus
           influenzae 86-028NP]
          Length = 141

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/141 (28%), Positives = 68/141 (48%), Gaps = 27/141 (19%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEG---DVDPKTGFVDDFFNIEQ 57
            KI++ F+F+ AH L       KC  +HGH+Y++++ + G   +   K   V DF +++ 
Sbjct: 2   FKISKEFSFDMAHLLDG--HDGKCQNLHGHTYKLQVEISGDLYESGAKKAMVIDFSDLKS 59

Query: 58  YFSPLL-EKLDHHCLNE--------IEELEN------------PTAENIAIWIWKRLS-T 95
               ++ + +DH  + +        I  L               TAE IA +I+ RL   
Sbjct: 60  IVKKVILDPMDHAFIYDQTNERESQIATLLQKLNSKTFGVPFRTTAEEIARFIFNRLKHD 119

Query: 96  SLSILSSVRVYETPMSWVEYQ 116
               +SS+R++ETP S+ EYQ
Sbjct: 120 EQLSISSIRLWETPASFCEYQ 140


>gi|209527765|ref|ZP_03276259.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Arthrospira maxima CS-328]
 gi|209491798|gb|EDZ92159.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Arthrospira maxima CS-328]
          Length = 130

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 57/125 (45%), Gaps = 12/125 (9%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVD------PKTGFVDDFFNI 55
           K+T  FTF++AH +        C R+HGH+Y+V +    +        P    V DF ++
Sbjct: 5   KLTTEFTFDSAHYIKDY--NGPCGRLHGHTYKVRVEATSNQLHGSEFCPHPVMVADFRSL 62

Query: 56  EQYFSPLLE-KLDHHCLNEI-EELENPTAENIAIWIWKRLSTSLSI--LSSVRVYETPMS 111
                 + +  LDH  LNEI       TAE IA +I+      +       V V ET  S
Sbjct: 63  RWAKKDVSKGGLDHGLLNEILPPNYETTAEMIAKFIYDETKKRVPEGVQLKVMVSETANS 122

Query: 112 WVEYQ 116
           WVEY+
Sbjct: 123 WVEYE 127


>gi|167747134|ref|ZP_02419261.1| hypothetical protein ANACAC_01847 [Anaerostipes caccae DSM 14662]
 gi|167654094|gb|EDR98223.1| hypothetical protein ANACAC_01847 [Anaerostipes caccae DSM 14662]
          Length = 139

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/137 (23%), Positives = 59/137 (43%), Gaps = 25/137 (18%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTG----FVDDFFNIEQ 57
           ++    +F++AH L       KC  +HGH +++ + ++ +   + G     V DF  ++ 
Sbjct: 3   QLNTHASFDSAHFLAGYE--GKCRNLHGHRWKLSVTIQKEKVEEQGQTRGMVVDFGELKD 60

Query: 58  YFSPLLEKLDHHCLNEIEELE-------------------NPTAENIAIWIWKRLSTSLS 98
               + ++ DH  + E + L+                    PTAEN A + + R+     
Sbjct: 61  KVKEIADEFDHALIMEKDTLKAKTIEALREEEFRIIEVKFRPTAENFARYFYDRIKQDGY 120

Query: 99  ILSSVRVYETPMSWVEY 115
            +S V VYETP +   Y
Sbjct: 121 DVSFVEVYETPNNCAIY 137


>gi|308498425|ref|XP_003111399.1| CRE-PTPS-1 protein [Caenorhabditis remanei]
 gi|308240947|gb|EFO84899.1| CRE-PTPS-1 protein [Caenorhabditis remanei]
          Length = 137

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 37/129 (28%), Positives = 66/129 (51%), Gaps = 16/129 (12%)

Query: 5   QAFTFEAAHRLP--------RVPKTHKCH--RMHGHSYRVELVMEGDVDPKTGFVDDFFN 54
           +   F A HRL               KC+    HGH+Y  ++ + G+VDP  G V D   
Sbjct: 8   RVEMFSACHRLHSKELSDAENKETFGKCNHVNGHGHNYVWKVKLRGEVDPVNGMVYDLAK 67

Query: 55  IEQYFSPLLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSLSI---LSSVRVYET 108
           +++  + +L+ +DH  L+ ++E  +    T+EN+AI++++ L + +S    L  V + ET
Sbjct: 68  LKKEMNLVLDTVDHRNLDVDVEFFKTTVSTSENVAIYMYETLKSVMSNPSVLYKVTIEET 127

Query: 109 PMSWVEYQG 117
           P +   Y+G
Sbjct: 128 PKNVFTYKG 136


>gi|187478512|ref|YP_786536.1| hypothetical protein BAV2020 [Bordetella avium 197N]
 gi|115423098|emb|CAJ49629.1| conserved hypothetical protein [Bordetella avium 197N]
          Length = 148

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 43/146 (29%), Positives = 64/146 (43%), Gaps = 33/146 (22%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDP-----KTGFVDDFFNIEQ 57
           +T+   F+A HR+P      +C  +HGH Y +E+ + GDV        TG V DF  I+ 
Sbjct: 4   VTRKLEFDAGHRIP--DHRSQCRNLHGHRYVLEITLSGDVVEAPGQSDTGMVMDFSEIKH 61

Query: 58  Y-FSPLLEKLDHHCLNE------------IEELEN------PTAENIAIWIWKRLSTSLS 98
              + +++  DH  L              +   +       PTAEN+A  I+ RL+    
Sbjct: 62  IAKTHIVDVWDHAFLVYEGDTAVREFLATLPGHKTVVLDRIPTAENLAAIIFARLAPHYQ 121

Query: 99  -------ILSSVRVYETPMSWVEYQG 117
                   LS VR+YETP  W +  G
Sbjct: 122 SAYGNALRLSRVRLYETPNCWADCDG 147


>gi|260914429|ref|ZP_05920898.1| queuosine biosynthesis protein QueD [Pasteurella dagmatis ATCC
           43325]
 gi|260631530|gb|EEX49712.1| queuosine biosynthesis protein QueD [Pasteurella dagmatis ATCC
           43325]
          Length = 141

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/142 (28%), Positives = 71/142 (50%), Gaps = 29/142 (20%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGD---VDPKTGFVDDFFNIEQ 57
            KI + F+F+ AH L       KC  +HGH+Y++++ + G+     PK G V DF +++ 
Sbjct: 2   FKIVKEFSFDMAHMLDG--HDGKCKNLHGHTYKLQVEICGELHQSGPKKGMVIDFSDLKA 59

Query: 58  YFSPLL-EKLDHHCL------------NEIEELEN--------PTAENIAIWIWKRLS-- 94
                + E +DH  +            N ++ L++         TAE +A +I+  L   
Sbjct: 60  IVKKRILEPMDHAFIYDCTSERESKVANLLQSLDSKTFSLPTRTTAEEMARFIFNCLKYE 119

Query: 95  TSLSILSSVRVYETPMSWVEYQ 116
             L  +S++R++ETP S+ EY+
Sbjct: 120 EHLP-VSAIRLWETPSSFCEYE 140


>gi|163783119|ref|ZP_02178114.1| hypothetical protein HG1285_01050 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881799|gb|EDP75308.1| hypothetical protein HG1285_01050 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 163

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 41/159 (25%), Positives = 68/159 (42%), Gaps = 43/159 (27%)

Query: 2   KITQAFTFEAAHRLPRVPKT--------------HKCHRMHGHSYRVELVMEGDVDPKTG 47
           +I++ F FEA HR+ +   T              +KC  +HGHSY +E+ +  D   +  
Sbjct: 4   EISKTFRFEAGHRVWKQNLTYGRGAEFTRGEVPQNKCVNLHGHSYILEVTVGSDTLSEQD 63

Query: 48  FVDDFFNIEQYFSPLLEKLDHHCLNEI-----EELEN----------------PTAENIA 86
            V DF++I+     L++ +DH  + +      EEL                  PTAE +A
Sbjct: 64  MVMDFYHIKNALKGLIDTIDHSFIIDTGDPMYEELREVAEKFGAMKVFPVDFCPTAEALA 123

Query: 87  IWIWKRLSTSLSI--------LSSVRVYETPMSWVEYQG 117
            + +  L+  L          +  V ++ET  S  EY+G
Sbjct: 124 KFFYDFLTEKLKEAGLLGEVRVVKVVLWETATSKAEYRG 162


>gi|91773248|ref|YP_565940.1| putative 6-pyruvoyl tetrahydropterin synthase [Methanococcoides
           burtonii DSM 6242]
 gi|91712263|gb|ABE52190.1| 6-pyruvoyl tetrahydrobiopterin synthase [Methanococcoides burtonii
           DSM 6242]
          Length = 116

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 39/118 (33%), Positives = 65/118 (55%), Gaps = 6/118 (5%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M++      ++AH LP   +   C  +HGH+Y++E+V+EG+   + G V DF+ I++   
Sbjct: 4   MRLGIIEYIDSAHYLP---EHETCGIVHGHTYKIEVVLEGEK-QENGMVMDFYIIKKIVK 59

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQGF 118
            +L+  DH  LN++     P+AENI   +  +L   L +  SV+V+E    W E  GF
Sbjct: 60  EILKTYDHKLLNDVLPF--PSAENICEHMHGQLFEQLGLPVSVKVWEGHGKWCELNGF 115


>gi|253701564|ref|YP_003022753.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Geobacter sp. M21]
 gi|251776414|gb|ACT18995.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Geobacter sp. M21]
          Length = 122

 Score = 91.8 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 60/122 (49%), Gaps = 8/122 (6%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
            ++T    F AAH L        C  +HGH+++VE+ +  +   K G   DF  +++  +
Sbjct: 2   FRLTIHTAFAAAHNLINYQGD--CENLHGHNWKVEVSVTTNELDKAGLGIDFKILKRETN 59

Query: 61  PLLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVE 114
            LL+ LDH  LNE+      +P++ENIA +++  L+         +  V V+E+  +   
Sbjct: 60  TLLKTLDHKYLNELPPFSEVSPSSENIARYLYHELTRIFGSDKVKVEMVTVWESDFAAAS 119

Query: 115 YQ 116
           Y 
Sbjct: 120 YY 121


>gi|78188351|ref|YP_378689.1| 6-pyruvoyltetrahydropterin synthase [Chlorobium chlorochromatii
           CaD3]
 gi|78170550|gb|ABB27646.1| 6-pyruvoyltetrahydropterin synthase [Chlorobium chlorochromatii
           CaD3]
          Length = 148

 Score = 91.8 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 40/137 (29%), Positives = 66/137 (48%), Gaps = 20/137 (14%)

Query: 1   MKITQAFTFEAAHRLPRVPKT--------HKCHRMHGH--SYRVELVMEGDVDPKTGFVD 50
           + ++++  F AAHRL     T         KC+  HGH  +Y + + + G ++ +TGF+ 
Sbjct: 11  IYVSRSIEFNAAHRLCNPTLTEEENCAIYGKCNNPHGHGHNYLLTITLSGTINRQTGFLF 70

Query: 51  DFFNIEQYFSPLL-EKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSLS------IL 100
           D   ++      + E+ DH  LN ++ EL N   T E +A+ IW  L+   +       L
Sbjct: 71  DLKALKAILEEEIVERFDHKHLNYDVPELSNCIPTTEILAVLIWDILAQRFTTINPAITL 130

Query: 101 SSVRVYETPMSWVEYQG 117
             V +YET  + V Y G
Sbjct: 131 HEVHLYETGKNAVRYYG 147


>gi|295401300|ref|ZP_06811272.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Geobacillus thermoglucosidasius C56-YS93]
 gi|294976707|gb|EFG52313.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Geobacillus thermoglucosidasius C56-YS93]
          Length = 144

 Score = 91.8 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 40/128 (31%), Positives = 60/128 (46%), Gaps = 17/128 (13%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ +     AAH +P   K  KC  MHGH Y V + + GD     GF+ +F  +++    
Sbjct: 16  ELNKDMHIAAAHFIPH-EKAGKCANMHGHIYTVNITVAGDELDDAGFLVNFQELKKLIH- 73

Query: 62  LLEKLDHHCLNEIEELEN-------PTAENIAIWIWKRLSTSL------SILSSVRVYET 108
              KLDH  +NE ++  N       PT+E IA  I++ +   L           V V ET
Sbjct: 74  --GKLDHTLMNEHQDWFNEQNSNDFPTSEVIARKIYETVQAHLDTLPNKPKCLQVFVRET 131

Query: 109 PMSWVEYQ 116
           P S+V Y+
Sbjct: 132 PTSYVVYR 139


>gi|332374022|gb|AEE62152.1| unknown [Dendroctonus ponderosae]
          Length = 144

 Score = 91.8 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 35/131 (26%), Positives = 68/131 (51%), Gaps = 17/131 (12%)

Query: 4   TQAFTFEAAHRLP--------RVPKTHKCH--RMHGHSYRVELVMEGDVDPKTGFVDDFF 53
           T+  T  A HRL               KC+    HGH+Y +++ + G++D  TG + +  
Sbjct: 13  TRRITLSACHRLHSPYLSDEMNQEVFGKCNHPNGHGHNYIIKVTLFGEIDKTTGMLMNLT 72

Query: 54  NIEQYFS-PLLEKLDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSLSI---LSSVRVY 106
           ++++Y    +++ +DH  ++ +IE  ++   T EN+A++ WKR+   +     L  V ++
Sbjct: 73  HLKKYMEAAIMKPMDHKNIDKDIEYFKDKPSTTENVAVYCWKRMQEIMDHPEWLHEVEIH 132

Query: 107 ETPMSWVEYQG 117
           ET  + V Y+G
Sbjct: 133 ETENNIVRYRG 143


>gi|15605809|ref|NP_213186.1| hypothetical protein aq_269 [Aquifex aeolicus VF5]
 gi|6647907|sp|O66626|QUED_AQUAE RecName: Full=6-carboxy-5,6,7,8-tetrahydropterin synthase;
           Short=CPH4 synthase; AltName: Full=Queuosine
           biosynthesis protein queD
 gi|2982977|gb|AAC06591.1| hypothetical protein aq_269 [Aquifex aeolicus VF5]
          Length = 162

 Score = 91.8 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 39/157 (24%), Positives = 69/157 (43%), Gaps = 42/157 (26%)

Query: 2   KITQAFTFEAAHRLPRVPKT-------------HKCHRMHGHSYRVELVMEGDVDPKTGF 48
           +I++ F FEA HR+ +   T             +KC  +HGHSY +E+ +  D   +   
Sbjct: 4   EISKTFRFEAGHRVWKQNLTYGRGAQFTKEKPVNKCVNLHGHSYVLEVTVGSDTLSEQDM 63

Query: 49  VDDFFNIEQYFSPLLEKLDHHCLNEI-----EELEN----------------PTAENIAI 87
           V DF++++     L+E++DH  + ++      EL++                PTAE +A 
Sbjct: 64  VMDFYHVKNALKGLIEEIDHSFIIDVNDPMYPELKDVAEKYGAMKIFPVEFCPTAEALAK 123

Query: 88  WIWKRLSTSLSI--------LSSVRVYETPMSWVEYQ 116
           + +  L   L          +  V ++ET  S  EY+
Sbjct: 124 FFYDFLKKRLEEAGLLGEVKVVKVVLWETATSKAEYK 160


>gi|291231827|ref|XP_002735873.1| PREDICTED: 6-pyruvoyltetrahydropterin synthase-like [Saccoglossus
           kowalevskii]
          Length = 136

 Score = 91.4 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 37/109 (33%), Positives = 64/109 (58%), Gaps = 8/109 (7%)

Query: 17  RVPKTHKCHRM--HGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLL-EKLDHHCLN- 72
                  C+    HGH+Y+VE++++G+VDP TG V +  ++++Y    + +++DH  L+ 
Sbjct: 27  NRELYGLCNNPNGHGHNYKVEVIVKGEVDPVTGMVMNISDLKKYIKKHVLDEMDHKHLDL 86

Query: 73  EIEELENP--TAENIAIWIWKRLSTSLSI--LSSVRVYETPMSWVEYQG 117
           ++   +N   TAENIAI+IW +L   L    L  V+V+ET  +   Y+G
Sbjct: 87  DVAHFKNTPSTAENIAIFIWDQLKNCLPEGLLYEVKVHETDKNVAFYRG 135


>gi|253999152|ref|YP_003051215.1| hypothetical protein Msip34_1443 [Methylovorus sp. SIP3-4]
 gi|313201254|ref|YP_004039912.1| hypothetical protein MPQ_1518 [Methylovorus sp. MP688]
 gi|253985831|gb|ACT50688.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Methylovorus sp. SIP3-4]
 gi|312440570|gb|ADQ84676.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Methylovorus sp. MP688]
          Length = 146

 Score = 91.4 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 42/145 (28%), Positives = 64/145 (44%), Gaps = 33/145 (22%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVD-----PKTGFVDDFFNI 55
           M+IT    F+A HR+P      +C  +HGH Y +E+ + GD+         G V DF ++
Sbjct: 1   MQITTRLEFDAGHRIP--CHKSQCRNLHGHRYAMEITLSGDIIQQDGSSDNGMVMDFSDV 58

Query: 56  EQYFSPL-LEKLDHHC---------LNEIEELEN---------PTAENIAIWIWKRLSTS 96
           +       ++  DH           LN +  L N         PTAEN+A   ++ L++ 
Sbjct: 59  KAIARESVVDVWDHAFLVYKGDADVLNFLNSLPNHKTVVMESVPTAENMAAEAFRILNSR 118

Query: 97  LS-------ILSSVRVYETPMSWVE 114
                     L  VR+YETP SW +
Sbjct: 119 YQDVYGNHLKLERVRLYETPNSWAD 143


>gi|294787823|ref|ZP_06753067.1| queuosine biosynthesis protein QueD [Simonsiella muelleri ATCC
           29453]
 gi|294484116|gb|EFG31799.1| queuosine biosynthesis protein QueD [Simonsiella muelleri ATCC
           29453]
          Length = 139

 Score = 91.4 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 39/139 (28%), Positives = 66/139 (47%), Gaps = 27/139 (19%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEG---DVDPKTGFVDDFFNIEQ 57
            K  + FTF+ AH L       KC  +HGH+Y +++ + G   +   K G V DF +++ 
Sbjct: 2   FKTAKEFTFDMAHMLDG--HDGKCQNLHGHTYILQVEISGSLKESGAKKGMVMDFSDLKN 59

Query: 58  YFSPLL-EKLDHHCLNE--------IEELENP------------TAENIAIWIWKRLSTS 96
                + +K+DH  + +        + +L N             TAE +A  I++ L   
Sbjct: 60  IVKTHILDKMDHAFIYDTSSQRETQVADLLNQLNSKTYGINTRSTAEEMARHIFQILQEH 119

Query: 97  LSILSSVRVYETPMSWVEY 115
           +  +S VR++ETP S+ EY
Sbjct: 120 IP-ISLVRLWETPSSYCEY 137


>gi|328869562|gb|EGG17940.1| 6-pyruvoyltetrahydropterin synthase [Dictyostelium fasciculatum]
          Length = 129

 Score = 91.4 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 41/118 (34%), Positives = 65/118 (55%), Gaps = 12/118 (10%)

Query: 12  AHRLPRVPKT--------HKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYF-SPL 62
           +HRL     T         KC   HGH+Y +E+ ++G VDPKTG   +   ++    + +
Sbjct: 11  SHRLYSHELTLEENKQIYGKCINQHGHNYVLEVSVKGAVDPKTGMFINITELKSIIATEV 70

Query: 63  LEKLDHHCLNEIEELEN--PTAENIAIWIWKRLSTSL-SILSSVRVYETPMSWVEYQG 117
           L+ LDH  L ++E L+    T EN+A+WIW  L   L ++L  V++ ET  ++V Y+G
Sbjct: 71  LDILDHRTLEDLEPLKGIVTTTENVAVWIWGALHKKLGNLLFEVKIEETEKNFVIYRG 128


>gi|319897343|ref|YP_004135539.1| 6-pyruvoyl-tetrahydropterin synthase [Haemophilus influenzae F3031]
 gi|317432848|emb|CBY81213.1| predicted 6-pyruvoyl-tetrahydropterin synthase [Haemophilus
           influenzae F3031]
          Length = 141

 Score = 91.4 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 40/141 (28%), Positives = 67/141 (47%), Gaps = 27/141 (19%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGD---VDPKTGFVDDFFNIEQ 57
            KI++ F+F+ AH L       KC  +HGH+Y++++ + GD      K   V DF +++ 
Sbjct: 2   FKISKEFSFDMAHLLDG--HDGKCQNLHGHTYKLQVEISGDLYKSGAKKAMVIDFSDLKS 59

Query: 58  YFSPLL-EKLDHHCLNE--------IEELEN------------PTAENIAIWIWKRLS-T 95
               ++ + +DH  + +        I  L               TAE IA +I+ RL   
Sbjct: 60  IVKKVILDPMDHAFIYDQTNERESQIASLLQKLNSKTFGVPFRTTAEEIARFIFNRLKHE 119

Query: 96  SLSILSSVRVYETPMSWVEYQ 116
               +SS+R++ET  S+ EYQ
Sbjct: 120 EQLSISSIRLWETSTSFCEYQ 140


>gi|291550954|emb|CBL27216.1| preQ(0) biosynthesis protein QueD [Ruminococcus torques L2-14]
          Length = 140

 Score = 91.4 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 36/134 (26%), Positives = 57/134 (42%), Gaps = 25/134 (18%)

Query: 6   AFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPK----TGFVDDFFNIEQYFSP 61
             +F+AAH L +     KC  +HGH + V   ++     +     G V DF N+++    
Sbjct: 7   KASFDAAHFLWKYE--GKCRNIHGHRWNVVAKIKSQELEQEGQTRGMVVDFGNLKKDLKK 64

Query: 62  LLEKLDHHCLNEIEELE-------------------NPTAENIAIWIWKRLSTSLSILSS 102
           L +  DH  + E+  L+                    PTAEN A + +K L+     +  
Sbjct: 65  LCDSFDHSLIYEVGSLKAETVAALQNEDFHLEKVSFRPTAENFAYYFYKELTELGYEVHC 124

Query: 103 VRVYETPMSWVEYQ 116
           V VYETP +   Y+
Sbjct: 125 VEVYETPNNCAVYE 138


>gi|149179804|ref|ZP_01858309.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus sp. SG-1]
 gi|148851996|gb|EDL66141.1| 6-pyruvoyl tetrahydrobiopterin synthase [Bacillus sp. SG-1]
          Length = 144

 Score = 91.0 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 35/126 (27%), Positives = 61/126 (48%), Gaps = 15/126 (11%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ + F F AAH +P      KC ++HGH+Y   + + GD   ++GF+ +F  I++    
Sbjct: 16  ELNKDFQFAAAHFIPS-EGAGKCQKVHGHTYFANITIGGDTLDESGFLINFSTIKKLIH- 73

Query: 62  LLEKLDHHCLNEIEEL-EN----PTAENIAIWIWKRLSTSL------SILSSVRVYETPM 110
             ++ DH  LN+     EN    PT E +A  I+  +   L      +    V + ETP 
Sbjct: 74  --DRFDHTMLNDDPLFSENPERFPTTEVMAELIYVLIQNYLDKQGNHAQCLQVFLRETPT 131

Query: 111 SWVEYQ 116
           S+  ++
Sbjct: 132 SYCIFR 137


>gi|268609641|ref|ZP_06143368.1| 6-pyruvoyl tetrahydrobiopterin synthase [Ruminococcus flavefaciens
           FD-1]
          Length = 165

 Score = 91.0 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 36/133 (27%), Positives = 58/133 (43%), Gaps = 25/133 (18%)

Query: 7   FTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDP----KTGFVDDFFNIEQYFSPL 62
            +F++AH L       KC  +HGH ++VE+ + G        K G + DF ++++    +
Sbjct: 34  ASFDSAHFLAGY--QGKCANIHGHRWKVEVSICGGSLQQEGTKRGMLIDFSDLKKAVHDM 91

Query: 63  LEKLDHHCLNEIEELE-------------------NPTAENIAIWIWKRLSTSLSILSSV 103
            +  DH  + E   L+                    PTAEN A    + L+     +SSV
Sbjct: 92  ADSFDHALIYETGSLKETTIAAMNDEGFHIIEVPFRPTAENFAKHFHELLTAKGLHISSV 151

Query: 104 RVYETPMSWVEYQ 116
            VYETP +   Y+
Sbjct: 152 TVYETPDNCAVYE 164


>gi|239826406|ref|YP_002949030.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Geobacillus sp. WCH70]
 gi|239806699|gb|ACS23764.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Geobacillus sp. WCH70]
          Length = 144

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 40/128 (31%), Positives = 60/128 (46%), Gaps = 17/128 (13%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ +     AAH +P   K  KC  MHGH Y V + + GD     GF+ +F  +++    
Sbjct: 16  ELNKDMHIAAAHFIPH-EKAGKCANMHGHIYTVNITVAGDELDDAGFLVNFQELKKLIH- 73

Query: 62  LLEKLDHHCLNEIEELEN-------PTAENIAIWIWKRLSTSL------SILSSVRVYET 108
              KLDH  +NE ++  N       PT+E IA  I++ +   L           V V ET
Sbjct: 74  --GKLDHSLMNEHQDWFNDQNSNDFPTSEVIARKIYETVQAYLDTMPNKPKCLQVFVRET 131

Query: 109 PMSWVEYQ 116
           P S+V Y+
Sbjct: 132 PTSYVVYR 139


>gi|146339024|ref|YP_001204072.1| putative 6-pyruvoyltetrahydropterin synthase [Bradyrhizobium sp.
           ORS278]
 gi|146191830|emb|CAL75835.1| putative 6-pyruvoyltetrahydropterin synthase [Bradyrhizobium sp.
           ORS278]
          Length = 118

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 41/115 (35%), Positives = 62/115 (53%), Gaps = 2/115 (1%)

Query: 4   TQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLL 63
           T++FTFEAAH L           +HGHS+R E+ + G  DP TG V DF  + Q    + 
Sbjct: 2   TKSFTFEAAHALAHTTLGEVSQEIHGHSFRAEVTVRGTPDPTTGMVVDFGLLTQRLGEIQ 61

Query: 64  EKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYE-TPMSWVEYQG 117
             LDH  LN IE +  PT EN++ +I++R+ + +  ++ V V+  +      Y G
Sbjct: 62  ATLDHKFLNRIEAIGLPTLENLSRFIYERVRS-IGHVTKVAVHRDSCRETCTYFG 115


>gi|159902663|ref|YP_001550007.1| 6-pyruvoyl tetrahydropterin synthase [Prochlorococcus marinus str.
           MIT 9211]
 gi|159887839|gb|ABX08053.1| 6-pyruvoyl tetrahydropterin synthase [Prochlorococcus marinus str.
           MIT 9211]
          Length = 296

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 42/130 (32%), Positives = 63/130 (48%), Gaps = 18/130 (13%)

Query: 3   ITQAFTFEAAHRLPRVPKT--------HKCHRMHGH--SYRVELVMEGDVDPKTGFVDDF 52
           +T    F AAHRL R   +         KC R HGH  +Y V++ ++G +D +TG + D 
Sbjct: 156 LTIQKHFAAAHRLAREELSPNENEVIYGKCARPHGHGHNYLVDITVKGAIDSRTGMICDL 215

Query: 53  FNIEQYFSP-LLEKLDHHCLN-EIEELENP--TAENIAIWIWKRLSTSLSI----LSSVR 104
             +++     ++E  DH  LN +I        TAENIA+ I  RL   +      L  VR
Sbjct: 216 SALQKLVDDLVIEPFDHTFLNKDIPFFAKCVPTAENIALHIADRLVEPIKEIGATLHKVR 275

Query: 105 VYETPMSWVE 114
           + E+P +  E
Sbjct: 276 LQESPNNAAE 285



 Score = 78.7 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 55/134 (41%), Gaps = 21/134 (15%)

Query: 3   ITQAFTFEAAHRLPRVPK--------THKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52
           IT+   F ++HR                 C     HGH+Y + + M G++D   G V + 
Sbjct: 18  ITRRACFSSSHRYWLPELSDDDNASCFGNCALAPGHGHNYELIVSMAGELDSD-GMVLNL 76

Query: 53  FNIEQYF-SPLLEKLDHHCLNEI-EELE-------NPTAENIAIWIWKRLSTSLSILSSV 103
             ++      +   LD   LNE   E +        PT E +   IW RL   L I+ S+
Sbjct: 77  SEVKHAIRQEVTNHLDFRFLNETWPEFDISTSEGCLPTTEALVRIIWNRLQPHLPIV-SL 135

Query: 104 RVYETPMSWVEYQG 117
           R+YE    W +Y G
Sbjct: 136 RLYEQKSLWADYSG 149


>gi|119899408|ref|YP_934621.1| 6-pyruvoyltetrahydropterin synthase [Azoarcus sp. BH72]
 gi|119671821|emb|CAL95735.1| 6-pyruvoyltetrahydropterin synthase [Azoarcus sp. BH72]
          Length = 151

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 37/145 (25%), Positives = 62/145 (42%), Gaps = 33/145 (22%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPK-----TGFVDDFFNI 55
           M+IT+   F+A HR+P      +C  +HGH Y +E+ + G++         G V DF  +
Sbjct: 1   MRITRRLEFDAGHRIP--DHASQCRHLHGHRYAIEVTLSGEIIDAAGQPVNGMVMDFGEV 58

Query: 56  EQYFSPLL-EKLDHHCL---------NEIEELEN---------PTAENIAIWIWKRLSTS 96
           ++  +  +    DH  L         + +  +           PTAEN+A   ++ L   
Sbjct: 59  KRLAAEHIVSVWDHAFLVYRGDTQVADFLASMPGHKTVVLDVVPTAENLAALAFRILDPV 118

Query: 97  LS-------ILSSVRVYETPMSWVE 114
            +        L  VR+YETP  W +
Sbjct: 119 YADSYGNHLRLERVRLYETPNCWAD 143


>gi|294102397|ref|YP_003554255.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Aminobacterium colombiense DSM 12261]
 gi|293617377|gb|ADE57531.1| 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
           [Aminobacterium colombiense DSM 12261]
          Length = 122

 Score = 91.0 bits (225), Expect =