RPSBLAST alignment for GI: 254781032 and conserved domain: TIGR00039

>gnl|CDD|161674 TIGR00039, 6PTHBS, 6-pyruvoyl tetrahydropterin synthase/QueD family protein. This model has been downgraded from hypothetical_equivalog to subfamily. The animal enzymes are known to be 6-pyruvoyl tetrahydropterin synthase. The function of the bacterial branch of the sequence lineage had been thought to be the same, but many are now taken to be QueD, and enzyme of queuosine biosynthesis. Queuosine is a hypermodified base in the wobble position of some tRNAs in most species. A new model is built to be the QueD equivalog model. Length = 124
 Score =  100 bits (252), Expect = 7e-23
 Identities = 48/122 (39%), Positives = 74/122 (60%), Gaps = 7/122 (5%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
             I + F+F AAHRLP      KC  +HGHSY+V++ + G+ DPKTG V DF ++++   
Sbjct: 2   FGIHKEFSFSAAHRLPGHEG--KCGNLHGHSYKVDVEVSGERDPKTGMVMDFSDLKKIVK 59

Query: 61  PLLEK-LDHHCLN-EIEELENPTAENIAIWIW---KRLSTSLSILSSVRVYETPMSWVEY 115
            ++++ LDH  LN ++  LENPT+EN+A++I+   K     +  L  V+  ETP     Y
Sbjct: 60  EVIDEPLDHKLLNDDVNYLENPTSENVAVYIFDNLKEYLIPVENLVKVKEEETPAEIRIY 119

Query: 116 QG 117
           +G
Sbjct: 120 RG 121