RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781032|ref|YP_003065445.1| hypothetical protein CLIBASIA_04670 [Candidatus Liberibacter asiaticus str. psy62] (118 letters) >gnl|CDD|144727 pfam01242, PTPS, 6-pyruvoyl tetrahydropterin synthase. 6-Pyruvoyl tetrahydrobiopterin synthase catalyses the conversion of dihydroneopterin triphosphate to 6-pyruvoyl tetrahydropterin, the second of three enzymatic steps in the synthesis of tetrahydrobiopterin from GTP. The functional enzyme is a hexamer of identical subunits. Length = 120 Score = 143 bits (363), Expect = 9e-36 Identities = 60/122 (49%), Positives = 81/122 (66%), Gaps = 8/122 (6%) Query: 2 KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61 IT+ F F+AAHRLP P KC R+HGH+YRVE+ +EG+ +TG V DF +++ Sbjct: 1 TITKRFRFDAAHRLPGYP--GKCSRLHGHNYRVEVTVEGEELDETGMVVDFGELKKILKE 58 Query: 62 LLEKLDHHCLNEIEELE--NPTAENIAIWIWKRLSTSLS----ILSSVRVYETPMSWVEY 115 +LE+LDH LN++ E NPTAENIA +IW RL L+ LS VR++ETP +W EY Sbjct: 59 VLERLDHKLLNDVPEFAGLNPTAENIARYIWDRLKPRLNGGGVRLSKVRLWETPTNWAEY 118 Query: 116 QG 117 +G Sbjct: 119 RG 120 >gnl|CDD|31064 COG0720, COG0720, 6-pyruvoyl-tetrahydropterin synthase [Coenzyme metabolism]. Length = 127 Score = 106 bits (265), Expect = 2e-24 Identities = 56/126 (44%), Positives = 76/126 (60%), Gaps = 11/126 (8%) Query: 1 MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60 IT+ F+F+AAHRLP P KC R+HGH+Y+VE+ +EG+ + G V DF +++ Sbjct: 3 RGITKRFSFDAAHRLPGHPG--KCGRLHGHTYKVEVEIEGEELDEHGMVVDFGELKKAVK 60 Query: 61 PLLEKLDHHCLNEIEEL--ENPTAENIAIWIWKRLSTSLSILSSVR-------VYETPMS 111 +L++LDH LN+IEE ENPTAENIA WI+ RL L + V ETP S Sbjct: 61 EILDELDHKLLNDIEEFDKENPTAENIAKWIFDRLKVVLPDEAETSAEELREYVAETPTS 120 Query: 112 WVEYQG 117 EY+ Sbjct: 121 GAEYRK 126 >gnl|CDD|29761 cd00470, PTPS, 6-pyruvoyl tetrahydropterin synthase (PTPS). Folate derivatives are essential cofactors in the biosynthesis of purines, pyrimidines, and amino acids, as well as formyl-tRNA. Mammalian cells are able to utilize pre-formed folates after uptake by a carrier-mediated active transport system. Most microbes and plants lack this system and must synthesize folates de novo from guanosine triphosphate. One enzyme from this pathway is PTPS which catalyzes the conversion of dihydroneopterin triphosphate to 6-pyruvoyl tetrahydropterin. The functional enzyme is a hexamer of identical subunits.. Length = 135 Score = 100 bits (250), Expect = 9e-23 Identities = 42/131 (32%), Positives = 71/131 (54%), Gaps = 16/131 (12%) Query: 3 ITQAFTFEAAHRLPRVPKT--------HKCH--RMHGHSYRVELVMEGDVDPKTGFVDDF 52 +T+ F+F A HRL P + KC+ HGH+Y+VE+ + G++DP TG V + Sbjct: 4 LTRRFSFSACHRLHSPPLSDEENLEVFGKCNNPNGHGHNYKVEVTVRGEIDPVTGMVMNL 63 Query: 53 FNIEQY-FSPLLEKLDHHCLNEIEE---LENPTAENIAIWIWKRLSTSL--SILSSVRVY 106 ++++ +++ LDH L++ T EN+A++IW L L +L V+V+ Sbjct: 64 TDLKKAIEEAIMKPLDHKNLDDDVPYFADVVSTTENLAVYIWDNLQKVLPVGLLYEVKVH 123 Query: 107 ETPMSWVEYQG 117 ET + V Y+G Sbjct: 124 ETDKNIVVYRG 134 >gnl|CDD|39308 KOG4105, KOG4105, KOG4105, 6-pyruvoyl tetrahydrobiopterin synthase [Coenzyme transport and metabolism]. Length = 141 Score = 68.2 bits (166), Expect = 5e-13 Identities = 40/132 (30%), Positives = 70/132 (53%), Gaps = 17/132 (12%) Query: 3 ITQAFTFEAAHRL--PRVPKTH------KCHRM--HGHSYRVELVMEGDVDPKTGFVDDF 52 + + +F AAHRL ++ KC+ HGH+Y V++ + G++DP TG V + Sbjct: 9 MERRDSFSAAHRLHSEKLSDAENLETFGKCNNSNGHGHNYVVKVTVRGEIDPTTGMVYNL 68 Query: 53 FNIEQYFSPLLEK-LDHHCLN-EIEELEN--PTAENIAIWIWKRLSTSL---SILSSVRV 105 +++ ++ LDH L+ ++E T EN+A++IW L + L S+L V++ Sbjct: 69 AKLKKEMELVIMTRLDHKNLDKDVEYFATTVSTTENVAVYIWDNLKSVLSNPSVLYKVKI 128 Query: 106 YETPMSWVEYQG 117 ETP + Y+G Sbjct: 129 EETPKNIFTYKG 140 >gnl|CDD|29764 cd00651, TFold, Tunnelling fold (T-fold). The five known T-folds are found in five different enzymes with different functions: dihydroneopterin-triphosphate epimerase (DHNTPE), dihydroneopterin aldolase (DHNA) , GTP cyclohydrolase I (GTPCH-1), 6-pyrovoyl tetrahydropterin synthetase (PTPS), and uricase (UO,uroate/urate oxidase). They bind to substrates belonging to the purine or pterin families, and share a fold-related binding site with a glutamate or glutamine residue anchoring the substrate and a lot of conserved interactions. They also share a similar oligomerization mode: several T-folds join together to form a beta(2n)alpha(n) barrel, then two barrels join together in a head-to-head fashion to made up the native enzymes. The functional enzyme is a tetramer for UO, a hexamer for PTPS, an octamer for DHNA/DHNTPE and a decamer for GTPCH-1. The substrate is located in a deep and narrow pocket at the interface between monomers. In PTPS, the active site is located at the interface of three monomers, two from one trimer and one from the other trimer. In GTPCH-1, it is also located at the interface of three subunits, two from one pentamer and one from the other pentamer. There are four equivalent active sites in UO, six in PTPS, eight in DHNA/DHNTPE and ten in GTPCH-1. Each globular multimeric enzyme encloses a tunnel which is lined with charged residues for DHNA and UO, and with basic residues in PTPS. The N and C-terminal ends are located on one side of the T-fold while the residues involved in the catalytic activity are located at the opposite side. In PTPS, UO and DHNA/DHNTPE, the N and C-terminal extremities of the enzyme are located on the exterior side of the functional multimeric enzyme. In GTPCH-1, the extra C-terminal helix places the extremity inside the tunnel.. Length = 122 Score = 30.8 bits (69), Expect = 0.089 Identities = 19/101 (18%), Positives = 33/101 (32%), Gaps = 11/101 (10%) Query: 9 FEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDH 68 RL V ++ V L +G + V + ++ + Sbjct: 9 LLKVTRLGFVTLERTVGQIF--EVDVTLSWDGKKAAASDDVAT----DTVYNTIYRLAKE 62 Query: 69 HCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETP 109 + E +L AE IA I + LS ++ V+V E Sbjct: 63 Y--VEGSQLIERLAEEIAYLIAEHF---LSSVAEVKVEEKK 98 >gnl|CDD|36662 KOG1449, KOG1449, KOG1449, Predicted Rho GTPase-activating protein CdGAPr [Signal transduction mechanisms]. Length = 670 Score = 26.3 bits (57), Expect = 2.2 Identities = 17/78 (21%), Positives = 28/78 (35%), Gaps = 2/78 (2%) Query: 30 HSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEELENPTAENIAIWI 89 + V+ +G P FFN+ S + K L E+ P + A + Sbjct: 132 LVFGVQPTNQGKSSPVLRSWRSFFNLGASLSDCIFKRRFSRLPELP--PPPQGASAAQML 189 Query: 90 WKRLSTSLSILSSVRVYE 107 RL+ + LSS+ Sbjct: 190 TPRLAKYMETLSSLVDSN 207 >gnl|CDD|35161 COG5602, SIN3, Histone deacetylase complex, SIN3 component [Chromatin structure and dynamics]. Length = 1163 Score = 25.8 bits (56), Expect = 2.9 Identities = 13/63 (20%), Positives = 21/63 (33%), Gaps = 1/63 (1%) Query: 37 VMEGDVDPKTGFVDDFFNIEQYFSPLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTS 96 + D K + F + S ++ E+E L NP E + + W S Sbjct: 949 LHPITYDIKYIAKSELFEMNSAASSKRKQDQTKYRLEVESLLNPD-EILFRFCWINKFKS 1007 Query: 97 LSI 99 I Sbjct: 1008 FGI 1010 >gnl|CDD|48605 cd03056, GST_N_4, GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains.. Length = 73 Score = 25.1 bits (55), Expect = 4.3 Identities = 7/34 (20%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Query: 24 CHRMHGHSYRVELVME-GDVDPKTGFVDDFFNIE 56 + G+ Y+V L++ + + V D E Sbjct: 5 GFPLSGNCYKVRLLLALLGIPYEWVEV-DILKGE 37 >gnl|CDD|30565 COG0216, PrfA, Protein chain release factor A [Translation, ribosomal structure and biogenesis]. Length = 363 Score = 25.1 bits (55), Expect = 4.6 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 7/51 (13%) Query: 9 FEA-AHRLPRVPKTHKCHRMHGHSYRV------ELVMEGDVDPKTGFVDDF 52 FE+ HR+ RVP T R+H + V E V E +++PK +D F Sbjct: 180 FESGVHRVQRVPATESQGRIHTSAATVAVLPEVEEVEEIEINPKDLRIDTF 230 >gnl|CDD|146335 pfam03641, Lysine_decarbox, Possible lysine decarboxylase. The members of this family share a highly conserved motif PGGXGTXXE that is probably functionally important. This family includes proteins annotated as lysine decarboxylases, although the evidence for this is not clear. Length = 130 Score = 24.9 bits (55), Expect = 5.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 52 FFNIEQYFSPLLEKLDH 68 N Y+ PLLE +DH Sbjct: 87 LLNPNGYYDPLLEFIDH 103 >gnl|CDD|133466 cd06856, GT_GPT_archaea, UDP-GlcNAc:dolichol-P GlcNAc-1-P transferase (GPT)-like proteins in archaea. Eukaryotic GPT catalyzes the transfer of GlcNAc-1-P from UDP-GlcNAc to dolichol-P to form GlcNAc-P-P-dolichol. The reaction is the first step in the assembly of dolichol-linked oligosaccharide intermediates and is essential for eukaryotic N-linked glycosylation. Evidence for the existence of the N-glycosylation pathway in archaea has emerged and genes responsible for the pathway have been identified. A glycosyl transferase gene Mv1751 in M. voltae encodes for the enzyme that carries out the first step in the pathway, the attachment of GlcNAc to a dolichol lipid carrier in the membrane. A lethal mutation in the alg7 (GPT) gene in Saccharomyces cerevisiae was successfully complemented with Mv1751, the archaea gene, indicating that eukaryotic and archaeal enzymes may use the same substrates and are evolutionarily closer than the bacterial enzyme, which uses a different substrate. Length = 280 Score = 24.5 bits (54), Expect = 6.6 Identities = 6/17 (35%), Positives = 8/17 (47%) Query: 47 GFVDDFFNIEQYFSPLL 63 G +DD + Q LL Sbjct: 55 GLLDDILGLSQSEKVLL 71 >gnl|CDD|110523 pfam01526, Transposase_7, Transposase. This family includes transposases of Tn3, Tn21, Tn1721, Tn2501, Tn3926 transposons from E-coli. The specific binding of the Tn3 transposase to DNA has been demonstrated. Sequence analysis has suggested that the invariant triad of Asp689, Asp765, Glu895 (numbering as in Tn3) may correspond to the D-D-35-E motif previously implicated in the catalysis of numerous transposases. Length = 968 Score = 24.2 bits (53), Expect = 8.4 Identities = 16/52 (30%), Positives = 21/52 (40%), Gaps = 15/52 (28%) Query: 5 QAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIE 56 +A LPRV T EL++E VD TGF D F ++ Sbjct: 564 EALRAALYSMLPRVRLT-------------ELLLE--VDAWTGFSDAFTHLS 600 >gnl|CDD|147088 pfam04754, Transposase_31, Putative transposase, YhgA-like. This family of putative transposases includes the YhgA sequence from Escherichia coli and several prokaryotic homologues. Length = 250 Score = 24.1 bits (53), Expect = 9.6 Identities = 6/31 (19%), Positives = 10/31 (32%) Query: 54 NIEQYFSPLLEKLDHHCLNEIEELENPTAEN 84 + + + +L EEL AE Sbjct: 215 DTSELEEEFIRELAKRVPEHGEELMMTIAEK 245 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.136 0.430 Gapped Lambda K H 0.267 0.0797 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,554,817 Number of extensions: 74302 Number of successful extensions: 188 Number of sequences better than 10.0: 1 Number of HSP's gapped: 177 Number of HSP's successfully gapped: 21 Length of query: 118 Length of database: 6,263,737 Length adjustment: 81 Effective length of query: 37 Effective length of database: 4,513,408 Effective search space: 166996096 Effective search space used: 166996096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (23.3 bits)