RPSBLAST alignment of GI: 254781032 and MMDB domain: 1y13_A_

>1y13_A (A:) PTPS, 6-pyruvoyl tetrahydropterin synthase; structural genomics of pathogenic protozoa consortium, SGPP, structural genomics, PSI; HET: BIO; 2.20A {Plasmodium falciparum}Length = 181
 Score = 98.2 bits (244), Expect = 4e-22
 Identities = 29/157 (18%), Positives = 44/157 (28%), Gaps = 46/157 (29%)

Query: 3   ITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPL 62
            + +F+F  AH +           +HGH+Y V L + G V    G+V DF  +++    +
Sbjct: 27  ESPSFSFNCAHFIAYN---GFRETLHGHNYNVSLKVRGYVRD-DGYVIDFSILKEKVKKV 82

Query: 63  LEKLDHHCLNEIE---ELENPTAENIAIWIWKRLSTSLSI-------------------- 99
             KLDHH +  I            NI I        S                       
Sbjct: 83  CNKLDHHFILPIYSDVLKFENVKNNIKIICEDNSEYSFPERDCIKLPIKHSSTEEIGQYI 142

Query: 100 -------------------LSSVRVYETPMSWVEYQG 117
                                 + V E+P        
Sbjct: 143 LNQLIEEXDVSLLKSRHIHYIEISVSESPTQKAIVHK 179