RPSBLAST alignment of GI: 254781032 and MMDB domain: 2oba_A_

>2oba_A (A:) Probable 6-pyruvoyl tetrahydrobiopterin synthase; tetrahydrobiopterin biosynthesis, PTP synthase, PTPS, lyase; 2.33A {Pseudomonas aeruginosa}Length = 138
 Score =  146 bits (370), Expect = 9e-37
 Identities = 63/116 (54%), Positives = 86/116 (74%)

Query: 2   KITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSP 61
           ++ + FTFE+AHRLP VP+ HKC R+HGHS+RV + +EG+VDP TG++ DF  I+  F P
Sbjct: 22  ELFKEFTFESAHRLPHVPEGHKCGRLHGHSFRVAIHIEGEVDPHTGWIRDFAEIKAIFKP 81

Query: 62  LLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           + E+LDH+ LN+I  LENPT+EN+  WIW++L   L  LS VRV+ET  S  EY+G
Sbjct: 82  IYEQLDHNYLNDIPGLENPTSENLCRWIWQQLKPLLPELSKVRVHETCTSGCEYRG 137