RPSBLAST alignment of GI: 254781032 and protein with PDBid: 2oba

>2oba_A Probable 6-pyruvoyl tetrahydrobiopterin synthase; tetrahydrobiopterin biosynthesis, PTP synthase, PTPS, lyase; 2.33A {Pseudomonas aeruginosa} Length = 138
 Score =  146 bits (369), Expect = 1e-36
 Identities = 64/117 (54%), Positives = 87/117 (74%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           M++ + FTFE+AHRLP VP+ HKC R+HGHS+RV + +EG+VDP TG++ DF  I+  F 
Sbjct: 21  MELFKEFTFESAHRLPHVPEGHKCGRLHGHSFRVAIHIEGEVDPHTGWIRDFAEIKAIFK 80

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQG 117
           P+ E+LDH+ LN+I  LENPT+EN+  WIW++L   L  LS VRV+ET  S  EY+G
Sbjct: 81  PIYEQLDHNYLNDIPGLENPTSENLCRWIWQQLKPLLPELSKVRVHETCTSGCEYRG 137