RPSBLAST alignment of GI: 254781032 and protein with PDBid: 3lx3

>3lx3_A 6-pyruvoyl tetrahydrobiopterin synthase; PTS, PTP synthase, PTPS, metal-binding, tetrahydrobiopterin biosynthesis, folate biosynthesis; HET: XTN; 1.55A {Plasmodium vivax} PDB: 2a0s_A* 3m0n_A* 3lze_A* Length = 180
 Score = 99.4 bits (247), Expect = 2e-22
 Identities = 27/155 (17%), Positives = 54/155 (34%), Gaps = 46/155 (29%)

Query: 4   TQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFSPLL 63
           +  F+F  AH +           +HGH+Y V L + G++    G+V DF  +++    + 
Sbjct: 27  SPLFSFNCAHFIAF---KGFRETLHGHNYNVSLRLRGNIQG-DGYVIDFSILKEKVRKVC 82

Query: 64  EKLDHHCLNEIE---------------------------------ELENPTAENIAIWIW 90
           ++LDHH +  +                                   +++ + E I ++I 
Sbjct: 83  KQLDHHFILPMYSDVLNIQEVNDNFKITCEDNSEYSFPKRDCVQIPIKHSSTEEIGLYIL 142

Query: 91  KRLSTSLSI---------LSSVRVYETPMSWVEYQ 116
            +L   + +            V V E+P       
Sbjct: 143 NQLIEEIDLPFLKTRSVNYMEVTVSESPSQKATVH 177