BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254781032|ref|YP_003065445.1| hypothetical protein
CLIBASIA_04670 [Candidatus Liberibacter asiaticus str. psy62]
         (118 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254781032|ref|YP_003065445.1| hypothetical protein CLIBASIA_04670 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 118

 Score =  250 bits (638), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 118/118 (100%), Positives = 118/118 (100%)

Query: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60
           MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS
Sbjct: 1   MKITQAFTFEAAHRLPRVPKTHKCHRMHGHSYRVELVMEGDVDPKTGFVDDFFNIEQYFS 60

Query: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQGF 118
           PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQGF
Sbjct: 61  PLLEKLDHHCLNEIEELENPTAENIAIWIWKRLSTSLSILSSVRVYETPMSWVEYQGF 118


>gi|254780874|ref|YP_003065287.1| peptide chain release factor 1 [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 357

 Score = 25.0 bits (53), Expect = 0.41,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 4/39 (10%)

Query: 9   FEAA-HRLPRVPKTHKCHRMHGHSYRVELVMEG---DVD 43
           FE+  HR+ RVP T    R+H  +  V ++ E    DVD
Sbjct: 178 FESGVHRVQRVPATEASGRVHTSAATVAVLPEAAEIDVD 216


>gi|254780589|ref|YP_003065002.1| hypothetical protein CLIBASIA_02380 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 239

 Score = 21.9 bits (45), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 9/28 (32%), Positives = 19/28 (67%)

Query: 68 HHCLNEIEELENPTAENIAIWIWKRLST 95
          HH  + I++ E+P +EN+ I + K+ ++
Sbjct: 20 HHSRSLIDKAEHPLSENLIISMQKKRTS 47


>gi|254780350|ref|YP_003064763.1| hypothetical protein CLIBASIA_01175 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 431

 Score = 21.6 bits (44), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 7/16 (43%), Positives = 10/16 (62%)

Query: 33  RVELVMEGDVDPKTGF 48
           R  L++ GD+DP  G 
Sbjct: 115 RERLIISGDLDPSKGL 130


>gi|254780143|ref|YP_003064556.1| DNA-directed RNA polymerase subunit beta [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 1386

 Score = 21.6 bits (44), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 8/13 (61%), Positives = 10/13 (76%)

Query: 38  MEGDVDPKTGFVD 50
           +EGD+DP T  VD
Sbjct: 748 VEGDLDPSTSGVD 760


>gi|254780487|ref|YP_003064900.1| dithiobiotin synthetase [Candidatus Liberibacter asiaticus str.
          psy62]
          Length = 217

 Score = 20.4 bits (41), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 6/13 (46%), Positives = 10/13 (76%)

Query: 10 EAAHRLPRVPKTH 22
          +  HR+ R+PK+H
Sbjct: 46 KTIHRIGRIPKSH 58


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.322    0.136    0.430 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 78,881
Number of Sequences: 1233
Number of extensions: 3022
Number of successful extensions: 8
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of query: 118
length of database: 328,796
effective HSP length: 64
effective length of query: 54
effective length of database: 249,884
effective search space: 13493736
effective search space used: 13493736
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 33 (17.3 bits)