BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781033|ref|YP_003065446.1| HemY domain-containing protein
[Candidatus Liberibacter asiaticus str. psy62]
         (492 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781033|ref|YP_003065446.1| HemY domain-containing protein [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040710|gb|ACT57506.1| HemY domain-containing protein [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 492

 Score = 1014 bits (2622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/492 (100%), Positives = 492/492 (100%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA
Sbjct: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY
Sbjct: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA
Sbjct: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKG 240
           LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKG
Sbjct: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKG 240

Query: 241 DMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYT 300
           DMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYT
Sbjct: 241 DMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYT 300

Query: 301 HLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEI 360
           HLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEI
Sbjct: 301 HLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEI 360

Query: 361 FLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEW 420
           FLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEW
Sbjct: 361 FLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEW 420

Query: 421 KIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDSTIHPLDPH 480
           KIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDSTIHPLDPH
Sbjct: 421 KIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDSTIHPLDPH 480

Query: 481 IRQPDDPGIKEQ 492
           IRQPDDPGIKEQ
Sbjct: 481 IRQPDDPGIKEQ 492


>gi|315122373|ref|YP_004062862.1| HemY domain-containing protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495775|gb|ADR52374.1| HemY domain-containing protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 487

 Score =  587 bits (1514), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 290/480 (60%), Positives = 368/480 (76%), Gaps = 4/480 (0%)

Query: 14  VICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLF 73
           +ICSFI +S+YP+D+ +TWGNR+Y+TSPFV+LSI+Y  +F ++L+  +SRFFLSCP+ + 
Sbjct: 1   MICSFIAISYYPDDIYVTWGNRIYQTSPFVMLSIVYILIFTFMLISKISRFFLSCPSTIA 60

Query: 74  HMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAE 133
           ++ HKRNY KGYK L  GL+SI A NIPLARKM SY+S +H FHNE L +LLE QIAL+E
Sbjct: 61  NIFHKRNYAKGYKELSAGLISITAQNIPLARKMFSYLSHRHIFHNESLFHLLEAQIALSE 120

Query: 134 RQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEA 193
           ++++IA EK EMMLQIP TREFA+Y+LY E  RIGDL SAQ YA KAL ISP   W  EA
Sbjct: 121 KKHHIAREKFEMMLQIPETREFAIYNLYCEFYRIGDLKSAQCYAKKALKISPYISWGIEA 180

Query: 194 VVQQYVLAKEWSRAITFLNQKKK--NAKEWNRNRAILLIARSLENADKGDMIASYHDAIE 251
           ++Q Y L KEWS+AI FLN+ KK  N + +N ++AILL ARSLENA+KGD++ASY+DA+ 
Sbjct: 181 MLQYYALEKEWSKAIDFLNKNKKYENIETYNHHQAILLTARSLENAEKGDVVASYNDAMV 240

Query: 252 SLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKL 311
            LKLC +SIMASICAAK+LI QNKK KA V+LEKIW++NPHPEIA IYT +LS N   ++
Sbjct: 241 VLKLCKHSIMASICAAKALILQNKKNKAAVVLEKIWEINPHPEIAYIYTIILSNNATERM 300

Query: 312 KRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQAN 371
            RAL+LE INK+++ESL+ V+KI+LE G+I QA  KAMLA K  PRK IFLLLA+IE+A+
Sbjct: 301 NRALKLEAINKKNIESLITVAKISLETGNIQQAQTKAMLAAKANPRKGIFLLLAKIERAS 360

Query: 372 SHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEWKIPTKSPEYIS 431
           S+N DKILYWTQ AL+  PDPLWISDDGY SS WLPLSP SK LC FEWK+P K PEY +
Sbjct: 361 SNNLDKILYWTQRALYTEPDPLWISDDGYCSSTWLPLSPTSKKLCRFEWKVPAKIPEYTT 420

Query: 432 SEN-INFSLEMAYPADDLQSMLNNGKKNHLPSI-KKVSSFEDSTIHPLDPHIRQPDDPGI 489
           +++ I++     +     ++  N   KN  PSI +     ++  I  LDP IRQPDDPG+
Sbjct: 421 NKDLISYDESETFMTHLQETKRNKNIKNPYPSIHQDYHHPKNRNILSLDPSIRQPDDPGV 480


>gi|150398166|ref|YP_001328633.1| HemY domain-containing protein [Sinorhizobium medicae WSM419]
 gi|150029681|gb|ABR61798.1| HemY domain protein [Sinorhizobium medicae WSM419]
          Length = 551

 Score =  279 bits (714), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 171/540 (31%), Positives = 274/540 (50%), Gaps = 52/540 (9%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++ +  ++  +   F  ++  P ++S+ W  +L   S     S+L     A ++   
Sbjct: 1   MIRILFFVLLVLCLALGFAWLADRPGELSLIWQGQLIEMSLLRAASLLISVFAAVLIAVW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R   S P  +      R  D+GY+AL TGL++  A +  LARKM +      +   E 
Sbjct: 61  LLRTIWSSPHTVTRYFRARKRDRGYQALSTGLIAAGAGDANLARKMTARTRSLISSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L++LLE Q +L E +Y+ A +K E+M   P TRE  +  LY E+ R+G   +A+ YA +A
Sbjct: 121 LIHLLEAQTSLIEGKYDDARKKFELMADDPETRELGLRGLYLEAKRLGANEAARHYAERA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLEN 236
            + +P  PW T A +     A++W  AI  L+Q +       KE +R +A+LL AR++E 
Sbjct: 181 AEKAPHLPWATLATLDHRSQARQWDEAIRLLDQSRAANVLERKEADRKKAVLLTARAMEQ 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            +  D  ++  DA  +LKL D+ + A++ AAK+L  ++  RK   ILEK+WK++PHPEIA
Sbjct: 241 LE-ADPKSARDDARAALKLDDSLVPAALVAAKALFREDNLRKGASILEKMWKLDPHPEIA 299

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
            +Y      ++ + +LKRA RLE +   +  SL  V++ ALE   +  A  KA  A +I 
Sbjct: 300 RLYVRARGGDSALDRLKRAKRLETLRGNNAVSLATVAEAALEARELALARTKAEAAARID 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+ IFLLLA IE+A++ +  +I YW   AL +  DP W + DG  S  WLP+SP++  L
Sbjct: 360 PRESIFLLLADIEEADTGDEGRIRYWMSQALRSPRDPAWTA-DGVTSPSWLPVSPVTGRL 418

Query: 416 CYFEWKIPTKS-------------------------PEYISSENINFSLEMAYPADDLQS 450
             FEWK P                            P   +      +++ A PA+ +++
Sbjct: 419 DAFEWKAPPARLPAATEEGYLNPDAAIRSLPPVATVPRPATEPETESAVDAAPPAERVEA 478

Query: 451 ------------------MLNNGKKNHLPSIKKVSSFEDSTIHPLDPHI-RQPDDPGIKE 491
                               +  +K  +P++   +  +DS   P DP   R PDDPG++E
Sbjct: 479 EPEKAITVPDPNETVAPPAGDPNRKEPVPAVASPAKGKDSEEAP-DPFFGRPPDDPGVRE 537


>gi|86359488|ref|YP_471380.1| hypothetical protein RHE_CH03907 [Rhizobium etli CFN 42]
 gi|86283590|gb|ABC92653.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 535

 Score =  270 bits (690), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 156/428 (36%), Positives = 240/428 (56%), Gaps = 7/428 (1%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RL+ +   + L+   F   +  P D+S+ W  ++Y+T   V +S +   + A ++++ 
Sbjct: 1   MIRLVVFALFVLLLAYGFSWFADRPGDLSLIWEGQIYQTKLIVAVSAIIALIAAVMIVWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
             R   + P  +      R  D+GY+AL TGL++  A N  LARKM +          E 
Sbjct: 61  FVRLIWTSPHSVTRYFRARKRDRGYQALSTGLIAAGAGNALLARKMAARSRGLIRADQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q AL E +++ A  K E M   P TRE  +  LY E+ R+G   +A++YA KA
Sbjct: 121 LINLLEAQAALIEGRHDEARAKFEAMANDPETRELGLRGLYLEARRLGANEAARQYAEKA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLEN 236
            D +P  PW  +A ++    A  W  AI  L Q+K        E NR  A+LL AR+ E 
Sbjct: 181 ADNAPYLPWAAQATLEYRSQAGRWDDAIRLLEQQKAARVVEKAEANRLLAVLLTARAAEK 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            + G+   +  DA+++LKL  + + A++ AAK+L  +   RKA  ILE+ WK  PHPEI 
Sbjct: 241 LE-GNPAGARDDALQALKLAVDLVPAALIAAKALFREGGLRKAASILEQAWKSAPHPEIG 299

Query: 297 NIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             Y    S ++T+ +LKRA RLE +   +VESL++V++ AL+     +A +KA  A +I 
Sbjct: 300 QTYVRARSGDSTLDRLKRAERLEALRPNNVESLLVVAQAALDAQEFAKARSKAEAAARIE 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  FLLLA IE+A + +  ++ +W   AL A  DP W++ DG++S  WLP+SP++  +
Sbjct: 360 PREAAFLLLADIEEAETGDQGRVRHWLAQALKAPRDPAWVA-DGFVSDKWLPVSPVTGRI 418

Query: 416 CYFEWKIP 423
             FEWK P
Sbjct: 419 DAFEWKAP 426


>gi|222087479|ref|YP_002546016.1| hypothetical protein Arad_4359 [Agrobacterium radiobacter K84]
 gi|221724927|gb|ACM28083.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 532

 Score =  266 bits (680), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 163/447 (36%), Positives = 250/447 (55%), Gaps = 7/447 (1%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RL+ +  ++  +   F  ++  P D+S+ W  +LY+T   V   IL   + A ++++ 
Sbjct: 1   MIRLLIFALLVLALGYGFSWLADRPGDLSLVWEGQLYQTKLIVAAGILIALVAATMIVWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
             R   + P  +      R  D+GY+AL TGL++  A N  LARKM +          E 
Sbjct: 61  FIRLIWNSPHSVTRYFRARKRDRGYQALSTGLIAAGAGNALLARKMAARTRGLIRADQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q AL E +++ A +K E+M   P TRE  +  LY E+ R+G   +A++YA KA
Sbjct: 121 LINLLEAQAALIEGKHDEARQKFELMANDPETRELGLRGLYLEAKRLGANEAARQYAEKA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKK----KNAKEWNRNRAILLIARSLEN 236
            D +P  PW  +A ++    A  W  AI  L+Q+K     + +  NR RA+LL AR+ + 
Sbjct: 181 ADHAPYLPWAAQATLEYRSQAGNWDDAIKLLDQQKVAHVVDKETANRQRAVLLTARANDK 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            +  D   +  DA+ +LKL  + + A++ AAK+L  ++K RKA  +LE++WK  PHPEI 
Sbjct: 241 LES-DPAGARDDALAALKLSADFVPAALTAAKALFREDKVRKAASMLEQVWKAKPHPEIG 299

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             Y    S ++V  +LKRA RLE I   +VE+L++ +K AL+     +A AKA  A +I 
Sbjct: 300 KAYVRARSGDSVTDRLKRAERLEAIRPNNVEALLVTAKAALDAHDFAKARAKAEAAARID 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
            R+  FLLLA IE+A +++  ++ +W   AL A  DP W++ DG++S  WLPLSPI+  L
Sbjct: 360 AREGAFLLLADIEEAETNDQGRVRHWMAQALRAPRDPAWVA-DGFVSDKWLPLSPITGRL 418

Query: 416 CYFEWKIPTKSPEYISSENINFSLEMA 442
             FEWK P    E    E    S++ A
Sbjct: 419 DAFEWKAPFGQIEGPLEEGTAVSVDAA 445


>gi|15966835|ref|NP_387188.1| hypothetical protein SMc03234 [Sinorhizobium meliloti 1021]
 gi|307301663|ref|ZP_07581422.1| HemY domain protein [Sinorhizobium meliloti BL225C]
 gi|307316313|ref|ZP_07595757.1| HemY domain protein [Sinorhizobium meliloti AK83]
 gi|15076107|emb|CAC47661.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306898153|gb|EFN28895.1| HemY domain protein [Sinorhizobium meliloti AK83]
 gi|306903361|gb|EFN33950.1| HemY domain protein [Sinorhizobium meliloti BL225C]
          Length = 545

 Score =  266 bits (679), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 149/428 (34%), Positives = 237/428 (55%), Gaps = 7/428 (1%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++ +  ++  +   F  ++  P ++S+ W  +L   S     SIL     A +++  
Sbjct: 1   MIRILFFVLLVLCLALGFAWLADRPGELSLIWQGQLIEMSLMRAASILISLFAAVLIVVW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R     P  +      R  D+GY+AL TGL++  A +  LARKM +      +   E 
Sbjct: 61  LLRTIWLSPHTVTRYFRSRKRDRGYQALSTGLIAAGAGDANLARKMAARTRNLISSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L++LLE Q AL E +Y+ A +K E M   P TRE  +  LY E+ R+G   +A++YA +A
Sbjct: 121 LIHLLEAQTALIEGKYDDARKKFEAMADDPETRELGLRGLYLEAKRLGANEAARQYAERA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLEN 236
            + +P  PW T A +     A++W  AI  L+Q +        E +R +A+LL AR++E 
Sbjct: 181 SEKAPHLPWATLATLDHRSQARQWDEAIRLLDQSRAAHVLEKNEADRKKAVLLTARAMER 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D  D  ++  DA  +LKL D  + A++ AAK+L  +   RK   ILE++WK++PHP+IA
Sbjct: 241 LD-ADPKSARDDAQAALKLDDRLVPAALVAAKALFREENLRKGASILERMWKLDPHPDIA 299

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
            +Y      ++ + +LKRA +LE +   +  +L  V++ AL+   +  A  KA  A ++ 
Sbjct: 300 RLYVRARGGDSALDRLKRAKKLESLRSNNAVALATVAEAALDARELALARTKAEAAARLE 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+ IFLLLA IE+A++ +  +I +W   AL +  DP W + DG  S VWLP+SP+S  L
Sbjct: 360 PRESIFLLLADIEEADTGDEGRIRHWMAQALKSPRDPAWTA-DGVTSPVWLPVSPVSGRL 418

Query: 416 CYFEWKIP 423
             FEWK P
Sbjct: 419 DAFEWKAP 426


>gi|159185310|ref|NP_355592.2| hypothetical protein Atu2656 [Agrobacterium tumefaciens str. C58]
 gi|159140568|gb|AAK88377.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 538

 Score =  261 bits (668), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 152/428 (35%), Positives = 237/428 (55%), Gaps = 7/428 (1%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++ +  ++  +   F  ++  P  +SI W  +L   S  V  SI+   + A +L++ 
Sbjct: 1   MIRILTFAVIVLALGFGFSWLADRPGALSIVWQGQLIEMSLMVAASIIAALVAAVMLIWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V     + P         R  D+GY+AL TGL++  A N  LARKM +      +   E 
Sbjct: 61  VVNAVWTSPNAARRYFRARKRDRGYQALSTGLIAAGAGNAILARKMTARTQGLLSADQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L++LL+ Q  L E +Y+ A  K E M + P TRE  +  LY E+ R G   +AQ+YA  A
Sbjct: 121 LIHLLDAQADLIEGKYDEARRKFEAMARDPETRELGLRGLYIEARRQGAYEAAQQYAEDA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLIARSLEN 236
            + +P  PW  +A ++      +W  AI  L+Q+K  +     E  R +A+LL A++ E 
Sbjct: 181 AEKAPYLPWAAQATLENRCRNGQWDDAIRLLDQQKAASVIERGEAERLKAVLLTAKAGEK 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            +  D +++  DA  +LKL    + A++ AAKS + ++  RKA  +LE +WK  PHP+IA
Sbjct: 241 LES-DPVSAREDAKHALKLAKGLVPAALIAAKSYLREDNLRKAATVLEPVWKNEPHPQIA 299

Query: 297 NIYTHLLSENT-VGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
            +Y    S +T + +LKRA RLE +   ++ESL  V++ AL+     +A AKA  A +I 
Sbjct: 300 QLYVRARSGDTAIDRLKRAERLESLKPNNIESLFAVAQAALDAKEFAKARAKAEAAARIE 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+ IFLL+A IE+A + +  ++ YW   AL A  DP W++ DG +S  WLP+SP++  L
Sbjct: 360 PRESIFLLMADIEEAETGDQGRVRYWMAQALRAPRDPAWVA-DGIVSEKWLPVSPVTGRL 418

Query: 416 CYFEWKIP 423
             FEWK P
Sbjct: 419 DAFEWKAP 426


>gi|325294024|ref|YP_004279888.1| HemY domain protein [Agrobacterium sp. H13-3]
 gi|325061877|gb|ADY65568.1| HemY domain protein [Agrobacterium sp. H13-3]
          Length = 535

 Score =  260 bits (664), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 151/428 (35%), Positives = 237/428 (55%), Gaps = 7/428 (1%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R++ +  ++  +   F  ++  P  +SI W  +L   S  V  SI+   + A +L++ 
Sbjct: 1   MTRILTFVLIVLALGFGFSWLADRPGVLSIVWQGQLIEMSLMVAASIVAALVAAVMLVWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V     + P         R  D+GY+AL TGL++  A N  LARKM +      +   E 
Sbjct: 61  VVNAIWTSPNAARRYFRARKRDRGYQALSTGLIAAGAGNAILARKMTARTQGLLSADQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L++LL+ Q  L E +Y+ A  K E M + P TRE  +  LY E+ R G   +AQ+YA  A
Sbjct: 121 LIHLLDAQADLIEGKYDEARRKFEAMARDPETRELGLRGLYIEARRQGAHEAAQQYAEDA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLIARSLEN 236
            + +P  PW  +A ++      EW  AI  L+Q+K        E  R +A+LL A++ E 
Sbjct: 181 AEKAPYLPWAAQATLETRCRNGEWDDAIRLLDQQKAAGVIQRGEAERLKAVLLTAKAGEK 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            +  D + +  DA ++LKL  + + A++ AAKS + ++  RKA  ++E +WK +PH +IA
Sbjct: 241 LES-DPVGAREDAKQALKLAKSLVPAALIAAKSYLREDNLRKAAAVMEPVWKNDPHSQIA 299

Query: 297 NIYTHLLSENT-VGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           ++Y    S +T + +LKRA RLE +   ++ESL  V++ AL+     +A AKA  A +I 
Sbjct: 300 DLYVRARSGDTAIDRLKRAERLESLKPNNIESLFAVAQAALDAKEFAKARAKAEAAARIE 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+ IFLL+A IE+A + +  ++ YW   AL A  DP+W++ DG  S  WLP+SP++  L
Sbjct: 360 PRESIFLLMADIEEAETGDQGRVRYWMAQALRAPRDPVWVA-DGVTSEKWLPVSPVTGRL 418

Query: 416 CYFEWKIP 423
             FEWK P
Sbjct: 419 DAFEWKAP 426


>gi|327188880|gb|EGE56072.1| hypothetical conserved membrane protein [Rhizobium etli CNPAF512]
          Length = 580

 Score =  255 bits (652), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 154/412 (37%), Positives = 231/412 (56%), Gaps = 7/412 (1%)

Query: 17  SFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHML 76
            F   +  P D+S+ W  ++Y+T   V +S +   + A ++++   R   + P  +    
Sbjct: 62  GFSWFADRPGDLSLIWEGQIYQTKLIVAVSAIIALIAAVMIVWWFVRLIWTSPHSVTRYF 121

Query: 77  HKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQY 136
             R  D+GY+AL TGL++  A N  LARKM +          E L+ LLE Q AL E ++
Sbjct: 122 RARKRDRGYQALSTGLIAAGAGNALLARKMAARSRGLIRADQEPLINLLEAQAALIEGRH 181

Query: 137 NIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQ 196
           + A  K E M   P TRE  +  LY E+ R+G   +A++YA KA D +P  PW  +A ++
Sbjct: 182 DEARAKFEAMANDPETRELGLRGLYLEARRLGANEAARQYAEKAADNAPYLPWAAQATLE 241

Query: 197 QYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLENADKGDMIASYHDAIES 252
               A  W  AI  L Q+K        E NR  A+LL AR+ E  + GD   +  DA+++
Sbjct: 242 YRSQAGHWDDAIRLLEQQKAARVVEKAEANRLHAVLLTARAAEKLE-GDPAGARDDALQA 300

Query: 253 LKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLS-ENTVGKL 311
           LKL  + + A++ AAK+L  +   RKA  ILE+ WK  PHPEI   Y    S ++T+ +L
Sbjct: 301 LKLAADLVPAALIAAKALFREGGLRKAASILEQAWKSKPHPEIGQTYVKARSGDSTLDRL 360

Query: 312 KRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQAN 371
           KRA RLE +   +VESL++V++ AL+     +A AKA  A +I PR+  FLLLA IE+A 
Sbjct: 361 KRAERLEALRPNNVESLLVVAQAALDTQEFAKARAKAEAAARIEPREAAFLLLADIEEAE 420

Query: 372 SHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEWKIP 423
           + +  ++ +W   AL A  DP W++ DG++S  WLP+SP++  +  FEWK P
Sbjct: 421 TGDQGRVRHWLAQALKAPRDPAWVA-DGFVSDKWLPVSPVTGRIDAFEWKAP 471


>gi|241206707|ref|YP_002977803.1| HemY domain protein [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240860597|gb|ACS58264.1| HemY domain protein [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 544

 Score =  254 bits (650), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 156/428 (36%), Positives = 237/428 (55%), Gaps = 7/428 (1%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++RL+ +   + L+   F  ++  P D+S+ W  R+Y+T   V  S +   + A ++ + 
Sbjct: 2   LIRLVVFALFVLLLAYGFSWLADRPGDLSLIWEGRIYQTKLIVAASAIIALVAAVMIAWW 61

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
             R   + P  +      R  D+GY+AL TGL++  A N  LARKM +          E 
Sbjct: 62  FVRLVWTSPHSVTRYFRARKRDRGYQALSTGLIAAGAGNALLARKMAARSRGLIRADQEP 121

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q AL E +++ A  K E M   P TRE  +  LY E+ R+G   +A++YA KA
Sbjct: 122 LINLLEAQAALIEGRHDEARAKFEAMANDPETRELGLRGLYLEARRLGANEAARQYAEKA 181

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLEN 236
            D +P  PW  +A ++    A  W  AI  L Q+K        E NR  A+LL AR+ E 
Sbjct: 182 ADNAPYLPWAAQATLEYRSQAGRWDDAIRLLEQQKAARVVEKAEANRLHAVLLTARAGEK 241

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            +  +   +  DA+++LKL  + I A++ AAK+L  +   RKA  ILE+ WK  PHPEI 
Sbjct: 242 LES-NPTGARDDALQALKLAADFIPAALIAAKALFREGGVRKAASILEQAWKSAPHPEIG 300

Query: 297 NIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             Y    S ++T+ +LKRA RLE     +VESL++V++ AL+     +A AKA  A ++ 
Sbjct: 301 QAYVRARSGDSTLDRLKRAERLEGQRPNNVESLLVVAQAALDAQEFAKARAKAEAAARMQ 360

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  +LLLA IE+A + +  ++ +W   AL A  DP W++ DG++S  WLP+SP++  L
Sbjct: 361 PREAAYLLLADIEEAETGDQGRVRHWLAQALKAPRDPAWVA-DGFVSDKWLPVSPVTGRL 419

Query: 416 CYFEWKIP 423
             FEWK P
Sbjct: 420 DAFEWKAP 427


>gi|116254227|ref|YP_770065.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115258875|emb|CAK09983.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 542

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 155/428 (36%), Positives = 236/428 (55%), Gaps = 7/428 (1%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++RL+ +   + L+   F  ++  P D+S+ W  ++Y+T   V  S +   + A ++ + 
Sbjct: 2   LIRLVVFALFVLLLAYGFSWLADRPGDLSLIWEGQIYQTKLIVAASAIIALVAAVMIAWW 61

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
             R   + P  +      R  D+GY+AL TGL++  A N  LARKM +          E 
Sbjct: 62  FVRLVWTSPHSVTRYFRARKRDRGYQALSTGLIAAGAGNALLARKMAARSRGLIRADQEP 121

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q AL E +++ A  K E M   P TRE  +  LY E+ R+G   +A++YA KA
Sbjct: 122 LINLLEAQAALIEGRHDEARAKFEAMANDPETRELGLRGLYLEARRLGANEAARQYAEKA 181

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLEN 236
            D +P  PW  +A ++    A  W  AI  L Q+K        E NR  A+LL AR+ E 
Sbjct: 182 ADNAPYLPWAAQATLEYRSQAGRWDDAIRLLEQQKAARVVEKAEANRLHAVLLTARAGEK 241

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            +  +   +  DA+++LKL  + I A++ AAK+L  +   RKA  ILE+ WK  PHPEI 
Sbjct: 242 LES-NPTGARDDALQALKLAADFIPAALIAAKALFREGGVRKAASILEQAWKSAPHPEIG 300

Query: 297 NIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             Y    S ++T+ +LKRA RLE     +VESL++V++ AL+     +A AKA  A  + 
Sbjct: 301 QAYVRARSGDSTLDRLKRAERLEGQRPNNVESLLVVAQAALDAQEFAKARAKAEAAAHMQ 360

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  +LLLA IE+A + +  ++ +W   AL A  DP W++ DG++S  WLP+SP++  L
Sbjct: 361 PREAAYLLLADIEEAETGDQGRVRHWLAQALKAPRDPAWVA-DGFVSDKWLPVSPVTGRL 419

Query: 416 CYFEWKIP 423
             FEWK P
Sbjct: 420 DAFEWKAP 427


>gi|227823721|ref|YP_002827694.1| hypthetical protein contains N-terminal HemY domain [Sinorhizobium
           fredii NGR234]
 gi|227342723|gb|ACP26941.1| hypthetical protein contains N-terminal HemY domain [Sinorhizobium
           fredii NGR234]
          Length = 541

 Score =  251 bits (641), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 164/448 (36%), Positives = 248/448 (55%), Gaps = 13/448 (2%)

Query: 4   LIRYFFVISLVIC---SFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++R  F I LV+     F  ++  P ++S+ W  +L   S     +IL   LFA IL+ A
Sbjct: 1   MVRILFFILLVLALALGFAWLADRPGELSLIWQGQLIEMSLMRAATIL-ISLFAAILIVA 59

Query: 61  -VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
            + R     P  +      R  D+GY+AL TGL++  A +  LARKM        +   E
Sbjct: 60  WLIRTLWLSPHTVTRYFRARKRDRGYQALSTGLIAAGAGDAALARKMAGRTRGLISADQE 119

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATK 179
            L++LLE Q AL E +Y+ A +K E+M   P TRE  +  LY E+ R+G   +A++YA +
Sbjct: 120 PLIHLLEAQTALIEGKYDDARKKFELMADDPETRELGLRGLYLEAKRLGANEAARQYAER 179

Query: 180 ALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLE 235
           A + +P   W T A + Q   A +W  AI  L+Q +     + KE NR +A+LL AR+  
Sbjct: 180 AAEKAPHLSWATLATLDQRSQAGQWDEAIRLLDQSRTANVLDKKEANRKKAVLLTARATG 239

Query: 236 NADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEI 295
             +  D  A+  DA+ +LKL D  + A++ AAK+L  ++  RK   +LEK+WK +PHPE+
Sbjct: 240 KLE-ADPKAARDDALAALKLDDRLVPAALTAAKALFREDNLRKGASVLEKVWKQDPHPEL 298

Query: 296 ANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKI 354
           A +Y      ++ V +LKRA RLE +   +  SL  V++ ALE   +  A +KA  A ++
Sbjct: 299 ARLYVRARGGDSAVDRLKRAKRLETLRGNNAVSLATVAEAALEARELALARSKAEAAARL 358

Query: 355 APRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKT 414
           AP + IFLL+A IE+A++ +  +I +W   AL +  DP W + DG  S  WLP+SP+S  
Sbjct: 359 APSESIFLLIADIEEADTGDEGRIRHWMAQALRSPRDPAWTA-DGVTSPTWLPVSPVSGR 417

Query: 415 LCYFEWKIPTKSPEYISSENINFSLEMA 442
           L  FEWK P  SP   ++E    S++ A
Sbjct: 418 LDAFEWKEPP-SPLAGTTEEGRVSVDEA 444


>gi|190893756|ref|YP_001980298.1| hypothetical protein [Rhizobium etli CIAT 652]
 gi|190699035|gb|ACE93120.1| hypothetical conserved membrane protein [Rhizobium etli CIAT 652]
          Length = 535

 Score =  251 bits (641), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 152/412 (36%), Positives = 230/412 (55%), Gaps = 7/412 (1%)

Query: 17  SFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHML 76
            F   +  P D+S+ W  ++Y+T   V +S +   + A ++ +   R   + P  +    
Sbjct: 17  GFSWFADRPGDLSLIWEGQIYQTKLIVAVSAIIALIAAVMIGWWFVRLIWTSPHSVTRYF 76

Query: 77  HKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQY 136
             R  D+GY+AL TGL++  A N  LARKM +          E L+ LLE Q AL E ++
Sbjct: 77  RARKRDRGYQALSTGLIAAGAGNALLARKMAARSRGLIRADQEPLINLLEAQAALIEGRH 136

Query: 137 NIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQ 196
           + A  K E M   P TRE  +  LY E+ R+G   +A++YA KA D +P  PW  +A ++
Sbjct: 137 DEARAKFEAMANDPETRELGLRGLYLEARRLGANEAARQYAEKAADNAPYLPWAAQATLE 196

Query: 197 QYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLENADKGDMIASYHDAIES 252
               A  W  AI  L Q+K        E NR  A+LL AR+ E  + G+   +  DA+++
Sbjct: 197 YRSQAGHWDDAIRLLEQQKAARVVEKAEANRLHAVLLTARAAEKLE-GNPAGARDDALQA 255

Query: 253 LKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLS-ENTVGKL 311
           LKL  + + A++ AAK+L  +   RKA  ILE+ WK  PHPE+   Y    S ++T+ +L
Sbjct: 256 LKLAADFVPAALIAAKALFREGGLRKAASILEQAWKSAPHPEVGQTYVRARSGDSTLDRL 315

Query: 312 KRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQAN 371
           KRA RLE +   +VESL++V++ AL+     +A AKA  A +I PR+  FLLLA IE+A 
Sbjct: 316 KRAERLEALRPNNVESLLVVAQAALDAQEFAKARAKAEAAARIEPREAAFLLLADIEEAE 375

Query: 372 SHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEWKIP 423
           + +  ++ +W   AL A  DP W++ DG++S  WLP+SP++  +  FEWK P
Sbjct: 376 TGDQGRVRHWLAQALKAPRDPAWVA-DGFVSDKWLPVSPVTGRIDAFEWKAP 426


>gi|209551274|ref|YP_002283191.1| HemY domain protein [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209537030|gb|ACI56965.1| HemY domain protein [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 536

 Score =  250 bits (638), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 157/428 (36%), Positives = 238/428 (55%), Gaps = 7/428 (1%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++RL+ +   + L+   F  ++  P D+S+ W  ++Y+T   V  S +   + A ++ + 
Sbjct: 2   LIRLVAFALFVLLLAYGFSWLADRPGDLSLIWEGQIYQTKLIVAASAIIALIAAVMIAWW 61

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
             R   + P  +      R  D+GY+AL TGL++  A N  LARKM +          E 
Sbjct: 62  FVRLVWTSPHSVTRYFRARKRDRGYQALSTGLIAAGAGNALLARKMAARSRGLIRADQEP 121

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q AL E +Y+ A  K E M   P TRE  +  LY E+ R+G   +A++YA KA
Sbjct: 122 LISLLEAQAALIEGRYDEARAKFEAMANDPETRELGLRGLYLEARRLGANEAARQYAEKA 181

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLEN 236
            D +P  PW  +A ++    A  W  AI  L Q+K        + NR  A+LL AR+ E 
Sbjct: 182 ADNAPYLPWAAQATLEYRSQAGRWDDAIRLLEQQKAARVVEKADANRLHAVLLTARAGEK 241

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            + G+   +  DA ++LKL  + I A++ AAK+L  +   RKA  ILE+ WK  PHPEI 
Sbjct: 242 LE-GNPAGARDDAQQALKLAADFIPAALVAAKALFREGGVRKAASILEQAWKSAPHPEIG 300

Query: 297 NIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             Y    S ++T+ +LKRA RLE +   +VESL++V++ AL+     +A AKA  A ++ 
Sbjct: 301 QAYVRARSGDSTLDRLKRAERLEGLRPNNVESLLVVAQAALDAQEFAKARAKAEAAARMQ 360

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  FLLLA IE+A + +  ++ +W   AL A  DP W++ DG++S  WLP+SP++  L
Sbjct: 361 PREAAFLLLADIEEAETGDQGRVRHWLAQALKAPRDPAWVA-DGFVSDKWLPVSPVTGRL 419

Query: 416 CYFEWKIP 423
             FEWK P
Sbjct: 420 DAFEWKAP 427


>gi|163757398|ref|ZP_02164487.1| hypothetical protein HPDFL43_18347 [Hoeflea phototrophica DFL-43]
 gi|162284900|gb|EDQ35182.1| hypothetical protein HPDFL43_18347 [Hoeflea phototrophica DFL-43]
          Length = 631

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 142/437 (32%), Positives = 234/437 (53%), Gaps = 13/437 (2%)

Query: 4   LIRYFFVISLVIC---SFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           +IR  F ++LV+     F  ++  P D+SI W +R    S    ++++   + A ++ + 
Sbjct: 2   MIRLLFFVALVLVLGFGFAWLADRPGDLSIVWQDRRIEMSLMTAVTVMVSLVAAVMITWW 61

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R     P ++         D+GY+AL TGL++  A +   ARKM+       +   E 
Sbjct: 62  LIRTIWLSPRLVSRYFRANKRDRGYQALSTGLLAAGAGDAMTARKMNKRSRGLLSADQEP 121

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L++LL+VQ AL E + + A ++ E + + P TR   +  LY E+ R G   +A  YA KA
Sbjct: 122 LIHLLDVQTALIEGRNDDARKQFEALAEDPETRLLGLRGLYLEAQRQGATEAAHHYAEKA 181

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLEN 236
            +++P  PW   A +       +W  A+  L+ +++     A E +R +A+LL AR+ + 
Sbjct: 182 AELAPHLPWAGAAALSFRTQEGKWDEALRLLDTQRQAGTLEALEADRKKAVLLTARARDR 241

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D  D + S  DA+ +LK+      A++ A K+L+  +  RKA  ILE  WKVNPHPEIA
Sbjct: 242 LD-ADPLRSRDDALAALKVAPGFAPAAVIATKALLRNDNLRKAARILESAWKVNPHPEIA 300

Query: 297 NIYTHL-LSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y    + +    +LKRA RLE++   + ++   V++ ALE    D A  KA  + ++ 
Sbjct: 301 DAYVRARIGDTAADRLKRAERLEKLKPLNAQAYDTVARAALEARRFDLARQKAEASARLL 360

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           P + I+LLLA IE+A + +  ++ +W   A+ A  DP W + DGY+S  W P+SP++  L
Sbjct: 361 PCEGIYLLLADIEEAETGDEGRVRHWLSQAVRAPRDPAWTA-DGYVSETWEPVSPVTGKL 419

Query: 416 CYFEWKIPTK---SPEY 429
             FEWK+P +    P Y
Sbjct: 420 DAFEWKVPVEQLSGPRY 436


>gi|222150058|ref|YP_002551015.1| hypothetical protein Avi_4148 [Agrobacterium vitis S4]
 gi|221737040|gb|ACM38003.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 526

 Score =  238 bits (608), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 149/432 (34%), Positives = 241/432 (55%), Gaps = 15/432 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTS----PFVILSILYFFLFAWI 56
           M+R+I Y  ++  +   F  ++  P ++ I W  +L   S      +I++I+   +  W 
Sbjct: 1   MIRIIVYILIVLALGFGFSWLADRPGELQIVWQGQLIEMSLTAAATMIVAIVAVVMIGWW 60

Query: 57  LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTF 116
           L+    R   + P  +      R  D+GY+A+ TGL++  A N  LAR+M +        
Sbjct: 61  LV----RTLWTSPHSMRRYFRARKRDRGYQAISTGLIAAGAGNAALARRMSARARGLVRA 116

Query: 117 HNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRY 176
             E L+ +LE Q AL E +++ A    E M+  P TRE  +  LY E+ R+G   +A++Y
Sbjct: 117 DQEPLIMVLEAQAALIEGKHDDARRIYEQMVADPETRELGLRGLYVEATRLGAHEAARQY 176

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLIAR 232
           A KA + +P  PW  +A ++       W+ AI  L+Q++        E +R +A+LL A+
Sbjct: 177 AEKAAEDAPYLPWAAKAALEYRCQTSAWNEAIHLLDQQRVAGVLARAEADRLKAVLLTAK 236

Query: 233 SLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPH 292
           +++  D GD  A+  +A+ +LKL  + + AS+ AA++L+ ++  RKA  +LE  WK+ PH
Sbjct: 237 AMDQLD-GDPAAARDNAMNALKLAKDLVPASVTAARALLREDNLRKAGSVLETAWKLAPH 295

Query: 293 PEIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLA 351
           P+IA++Y      +  V +LKRA RLE++   +V SL++V+++ALE     +A AKA  A
Sbjct: 296 PDIASLYVRARGGDGAVDRLKRAERLEQVKPNNVYSLLVVAEMALEARDFTKARAKAEAA 355

Query: 352 MKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPI 411
            ++   + +FLLLA IE A + +  +I YW   AL A  DP W++ DG +S  WLP SP+
Sbjct: 356 ARMQASERVFLLLADIEDAETGDQARIRYWMAQALKAPRDPSWVA-DGQVSEKWLPYSPV 414

Query: 412 SKTLCYFEWKIP 423
           S  L  FEWKIP
Sbjct: 415 SGRLDAFEWKIP 426


>gi|90421076|ref|ZP_01228979.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90334711|gb|EAS48488.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 541

 Score =  235 bits (600), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 133/430 (30%), Positives = 221/430 (51%), Gaps = 8/430 (1%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ +  V+      F  ++  P  V+  W  +   TS  V L  L   +FA +L+  
Sbjct: 1   MLRILAFLLVVLAAGIGFAWLADNPGSVTFVWQGQQVGTSLMVFLIGLGVLIFAVLLVVW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R F   P  + +       D+GYKAL +G+++  A +  LAR+M     +      E 
Sbjct: 61  LVRAFFKTPGAIGNWWSTSRRDRGYKALSSGIIAAGAGDAVLARRMTKRSDKLLGTRREP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+  L+ Q A+ E  +  A    E M + P TR  A+  L+ E+ R+GD ++A+ YA +A
Sbjct: 121 LIRFLDAQTAMIEGDHARARSAFEQMERDPETRLLALRGLFLEAERVGDESAARHYAERA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLEN 236
           + I+P  PW   AV++   LA +W  A+  L+ +K     +  E  R RA+LL A+++  
Sbjct: 181 VRIAPHVPWAGGAVLESKCLAGDWDGALAILDAQKNTRLVDRDESKRMRAVLLTAKAMTL 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
           +++ D   +    +E+ KL  +   A++ AA++L      R+   +LE  W   PHP+IA
Sbjct: 241 SER-DPAGAKTAGLEAQKLAPDLPPAALVAAEALFRLGDLRRGSKVLETSWISQPHPDIA 299

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             Y H    ++   +LKRA +L  ++    E+ + +++ AL+ G  D A   AM A    
Sbjct: 300 EAYVHARPGDSPEDRLKRARKLHGLHS-GAEAEMSLARAALDAGEFDLARKSAMAAADAE 358

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  +LLLA IE+A +    ++  W   A+ A  DP W + DG +S  W P+SP++  L
Sbjct: 359 PRESTYLLLADIEEAQTGEVGRVREWLGRAIRAPRDPAWTA-DGVVSRNWAPISPVTGRL 417

Query: 416 CYFEWKIPTK 425
             FEWK+P +
Sbjct: 418 DAFEWKVPVE 427


>gi|218672801|ref|ZP_03522470.1| hypothetical protein RetlG_14767 [Rhizobium etli GR56]
          Length = 382

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 132/367 (35%), Positives = 201/367 (54%), Gaps = 6/367 (1%)

Query: 17  SFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHML 76
            F   +  P D+S+ W  ++Y+T   V +S +   + A ++++   R   + P  +    
Sbjct: 17  GFSWFADRPGDLSLIWEGQIYQTKLIVAVSAIIALIAAVMIVWWFVRLIWTSPHSVTRYF 76

Query: 77  HKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQY 136
             R  D+GY+AL TGL++  A N  LARKM +          E L+ LLE Q AL E ++
Sbjct: 77  RARKRDRGYQALSTGLIAAGAGNALLARKMAARSRGLIRADQEPLINLLEAQAALIEGRH 136

Query: 137 NIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQ 196
           + A  K E M   P TRE  +  LY E+ R+G   +A++YA KA D +P  PW  +A ++
Sbjct: 137 DEARAKFEAMANDPETRELGLRGLYLEARRLGANEAARQYAEKAADNAPYLPWAAQATLE 196

Query: 197 QYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLENADKGDMIASYHDAIES 252
               A  W  AI  L Q+K        E NR  A+LL AR+ E  + G+   +  DA+++
Sbjct: 197 YRSQAGRWDDAIRLLEQQKAARVVEKTEANRLHAVLLTARAGEKLE-GNPAGARDDALQA 255

Query: 253 LKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLS-ENTVGKL 311
           LKL  + + A++ AAK+L  +   RKA  ILE+ WK  PHPEI   Y    S ++T+ +L
Sbjct: 256 LKLAADFVPAALIAAKALFREGGLRKAASILEQAWKSAPHPEIGQTYVRARSGDSTLDRL 315

Query: 312 KRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQAN 371
           KRA RLE +   +VESL++V++ AL+     +A  KA  A +I PR+  FLLLA IE+A 
Sbjct: 316 KRAERLEALRPNNVESLLVVAQAALDAQEFAKARTKAEAAARIEPREAAFLLLADIEEAE 375

Query: 372 SHNTDKI 378
           + +  ++
Sbjct: 376 TGDQGRV 382


>gi|218662368|ref|ZP_03518298.1| hypothetical conserved membrane protein [Rhizobium etli IE4771]
          Length = 428

 Score =  209 bits (531), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 121/311 (38%), Positives = 181/311 (58%), Gaps = 7/311 (2%)

Query: 118 NEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYA 177
            E L+    +++ L E +++ A  K E M   P TRE  +  LY E+ R+G   +A++YA
Sbjct: 11  QEPLINCSRLRVRLMEGRHDEARAKFEAMANDPETRELGLRGLYLEARRLGANEAARQYA 70

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARS 233
            KA D +P  PW  +A ++    A  W  AI  L Q+K        E NR  A+LL AR+
Sbjct: 71  EKAADNAPYLPWAAQATLEYRSQAGNWDDAIRLLEQQKAARVVEKTEANRLHAVLLTARA 130

Query: 234 LENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHP 293
            E  + G+   +  DA+++LKL    + A++ AAK+L  +N  RKA  ILE+ WK  PHP
Sbjct: 131 GERLE-GNPAGARDDALQALKLAAGLVPAALIAAKALFRENGLRKAASILEQAWKSAPHP 189

Query: 294 EIANIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAM 352
           EI   Y    S ++T+ +LKRA RLE +   +VESL++V++ AL+     +A AKA  A 
Sbjct: 190 EIGQTYVRARSGDSTLDRLKRAERLEALRPNNVESLLVVAQAALDAQEFAKARAKAEAAA 249

Query: 353 KIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPIS 412
           +I PR+  FLLLA IE+A + +  ++ +W   AL A  DP W++ DG++S  WLP+SP++
Sbjct: 250 RIEPREAAFLLLADIEEAETGDQGRVRHWLAQALKAPRDPAWVA-DGFVSDKWLPVSPVT 308

Query: 413 KTLCYFEWKIP 423
             +  FEWK P
Sbjct: 309 GRIDAFEWKAP 319


>gi|153008313|ref|YP_001369528.1| HemY domain-containing protein [Ochrobactrum anthropi ATCC 49188]
 gi|151560201|gb|ABS13699.1| HemY domain protein [Ochrobactrum anthropi ATCC 49188]
          Length = 553

 Score =  200 bits (508), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 131/428 (30%), Positives = 226/428 (52%), Gaps = 7/428 (1%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ YF V++ +   F  ++  P ++ +T+    Y       ++ +   + A ++L+ 
Sbjct: 1   MLRVLFYFVVVAALGFGFAWLADRPGELDVTFAGNHYNVPLITAVAGIVAIVAAMLILWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L      R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 61  LVKSIIQSPYTLRRHFRARKRDRGYQSLSTGLIAAGAGDAEAARRMTKQAGKLLSSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M+  P TR   +  LY E+ R+G L++A+ YA +A
Sbjct: 121 LIKLLEAQTAMLEGRTEDARKGFEAMVDDPETRLLGLRGLYIEAQRVGALDAARHYAAEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK---NAKE-WNRNRAILLIARSLEN 236
              +P   W + A++ Q     +W  A+  ++ +K+   ++K+   + RA LL A+++  
Sbjct: 181 ASQAPQLEWASSAMMGQLCAEGDWDAALKLVDARKQALAHSKDVVKKERAALLTAKAMAV 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
           AD  D   +   A+E+ KL  + + A++ AA++L S    RK   ILE  WK  PHP+IA
Sbjct: 241 ADV-DHAQAKALALEANKLTPDLVPAAVVAARALFSDGDMRKGSKILEAAWKRFPHPDIA 299

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A   ++ +
Sbjct: 300 STYVYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGDYRLARDNAEQVLRAS 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+S  W P+SP++  L
Sbjct: 360 PRESAYLLLADIEEAETGDQGKVREWLARAVKAPRDPAWTA-DGYVSEQWSPVSPVTGRL 418

Query: 416 CYFEWKIP 423
             FEWK+P
Sbjct: 419 NSFEWKVP 426


>gi|13473574|ref|NP_105142.1| hypothetical protein mll4218 [Mesorhizobium loti MAFF303099]
 gi|14024324|dbj|BAB50928.1| mll4218 [Mesorhizobium loti MAFF303099]
          Length = 531

 Score =  199 bits (507), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 149/523 (28%), Positives = 260/523 (49%), Gaps = 42/523 (8%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RL+ +  V+  +   F  ++  P D+ +T+    Y+ S  V    +   + A ++L+ 
Sbjct: 1   MIRLLAFLIVVFALGLGFAWLADRPGDMVVTFNGYQYQVSLMVAAVAIVAVVAAVMILWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R   + P  +      R  D+GY+AL TG+++  A +  LARK     ++      E 
Sbjct: 61  LIRSLWNSPYTISRYFRVRRRDRGYQALSTGMIAAGAGDGALARKKTKEAAKLIRSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L++LLE Q +L E  +  A +K E ML  P  R   +  LY E+ R+GD N+A+ YA +A
Sbjct: 121 LIHLLEAQASLLEGDHEGARQKFESMLDDPEMRLLGLRGLYLEAERLGDRNAARHYAGRA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILLIARSLEN 236
             ++P   W  E+ +++     +W  A+  ++ +K   +      NR RA+LL A++   
Sbjct: 181 AAVAPQLAWAAESTLEELTARGDWDGALKLVDAQKSTRQIERDAANRRRAVLLTAKAQSL 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
           AD  D  A+   A+E+ KL  +   A++ AA +L  QN  RK   ILE  W+  PHPEIA
Sbjct: 241 ADS-DPNAARTAALEANKLQPDFAPAAVAAAAALFKQNDVRKGSKILETAWRAEPHPEIA 299

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
            +YTH    + V  +L RA +L+E+ K   ES + V++ AL+      A ++A  A+++ 
Sbjct: 300 ELYTHARPGDAVLDRLNRAKKLQEMKKNHAESSMTVARAALDAQDFSTARSEAEAAIRMD 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
            R+  +LLLA IE+A + +  K+      A+ A  DP W++ DG +S  W P+SP++  L
Sbjct: 360 RREGAYLLLADIEEAETGDQGKVRQLLSKAVRAPRDPAWVA-DGVVSERWAPVSPVTGRL 418

Query: 416 CYFEWKIPTKS-PEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDST- 473
             FEW+ P +   + I S +   ++ +      ++++     +  + +I+ V++  ++T 
Sbjct: 419 DAFEWRAPMERLGQLIDSRDEGTTVPV------IEALAKPASEKPIDAIEPVAAGSETTG 472

Query: 474 ---------------------------IHPLDPHIRQPDDPGI 489
                                      + P +   R PDDPG+
Sbjct: 473 KGTDRSEDQVTPVTAAAFAAVPADAEAVEPAEELTRLPDDPGV 515


>gi|304392696|ref|ZP_07374636.1| HemY domain-containing protein [Ahrensia sp. R2A130]
 gi|303295326|gb|EFL89686.1| HemY domain-containing protein [Ahrensia sp. R2A130]
          Length = 674

 Score =  197 bits (500), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 129/432 (29%), Positives = 218/432 (50%), Gaps = 13/432 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITW----GNRLYRTSPFVILSILYFFLFAWI 56
           MLRL  +F ++  +   F   +  P  +++ W    G         V + +L   LFA I
Sbjct: 1   MLRLAVFFLILFAIAAGFAWFADNPGTITLQWPWLNGGEPLAVDLLVAIVVLAVVLFAAI 60

Query: 57  LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTF 116
           +L+++    L+ P         R  DKGY+AL  GL++  A N PLAR++    S+    
Sbjct: 61  VLWSIIAAILTSPKTFGRWREGRRRDKGYEALSRGLVAANAGNAPLARRLTKECSKH--L 118

Query: 117 HNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRY 176
            +E LV LL+ Q AL E  ++ A      ML+   TR   +  LY E+ + G+  +A  +
Sbjct: 119 DDEPLVALLDAQTALLEDDHDCARRCYTTMLEKDETRLLGLRGLYLEAEKEGEGEAAGHF 178

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIAR 232
           A +A+  +P  PW T+A+++     K W  A+  L+  +     +   +N  +A +L A 
Sbjct: 179 AREAVKANPGTPWATQAMLRSQTATKNWEEALKTLDLNRSAGVYDKDAYNGRKAAILTAL 238

Query: 233 SLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPH 292
           +++  D     A  H A+ + KL      A++ AA+  +  N  RKA  +LE  WK  PH
Sbjct: 239 AMDEEDASPEKARSH-ALAAHKLAPTLAPAAVVAARMSVRLNDMRKAAKVLETSWKAEPH 297

Query: 293 PEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLA 351
           PEIA+ Y HL + ++V  +LKRA  L+     S++  + ++++A++ G  + A      A
Sbjct: 298 PEIADAYIHLRNGDSVLDRLKRAQTLDGKRSNSIDGQLAIAQVAIDAGEYETARDALEAA 357

Query: 352 MKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPI 411
            +I P +   LL+A +E+A + +  ++  W   A+HA  D  W++ DG  +  W+P SP+
Sbjct: 358 FRITPTERACLLMADLEEAQNEDMGRVREWLSRAVHAPRDKAWVA-DGVAAEEWMPASPV 416

Query: 412 SKTLCYFEWKIP 423
           +  +  FEWK P
Sbjct: 417 TGEINAFEWKQP 428


>gi|110635528|ref|YP_675736.1| HemY-like [Mesorhizobium sp. BNC1]
 gi|110286512|gb|ABG64571.1| HemY-like protein [Chelativorans sp. BNC1]
          Length = 533

 Score =  196 bits (498), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 129/428 (30%), Positives = 236/428 (55%), Gaps = 7/428 (1%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R++ +  ++ L+   F  ++  P ++++T+G   Y+ +  +   +L   + A ++L+ 
Sbjct: 1   MFRILLFLVIVMLLGLGFAWLADRPGELAVTFGGYQYQVTLMMAAVLLVAAIAAVMILWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R   + P  +      R  D+GY+AL TGL++  A +  LAR+M    ++  +   E 
Sbjct: 61  IVRGIWTSPYTVRRYFRARRRDRGYQALSTGLIAAGAGDAGLARRMGQQAAKLISSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L++LL+ Q A+ E  +  A  K + M   P TR   +  LY E+ R G+  +A+ YA +A
Sbjct: 121 LIHLLDAQAAMLEGNHEAARAKFQAMADDPETRLLGLRGLYLEAERHGEREAARHYADEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWN----RNRAILLIARSLEN 236
             I+P   W  +A ++      +W  A+  L+++K ++KE      R RA+LL A+++  
Sbjct: 181 TKIAPQLGWAADATLEAKADEGDWQGALALLDKQKPSSKEERAALARKRAVLLTAQAMAQ 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            +  +  A+   A+E+ +L  + + A++ AA++L  Q+  R+   +LE +W  +PHPE+A
Sbjct: 241 LNM-NPAAAKTAALEAHRLQPDFVPAAVTAARALFRQDDLRRGAKVLEAVWAKSPHPEVA 299

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           +IY H    ++T  +L RA +L  +   + ES++ V++ AL+ G   +A   A  A+++ 
Sbjct: 300 DIYVHARPGDSTHDRLTRAKKLRRLKPNNAESVLAVARAALDAGEYGEAREAAEAAVRLD 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  FLLLA IE+A   +  ++ YW   A+ A  DP W++ DGY++  W P SP++  L
Sbjct: 360 PREGAFLLLADIEEAERGDQGRVRYWLAKAVRAPRDPAWVA-DGYVAERWAPASPVTGRL 418

Query: 416 CYFEWKIP 423
             FEW+ P
Sbjct: 419 DAFEWRAP 426


>gi|254717951|ref|ZP_05179762.1| hypothetical protein Bru83_00095 [Brucella sp. 83/13]
 gi|306838961|ref|ZP_07471785.1| HemY domain protein [Brucella sp. NF 2653]
 gi|306405964|gb|EFM62219.1| HemY domain protein [Brucella sp. NF 2653]
          Length = 537

 Score =  194 bits (493), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 127/433 (29%), Positives = 223/433 (51%), Gaps = 17/433 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 1   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 61  LVKSLVQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 121 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK---NAKE-WNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++   + K+   + RA LL A+++  
Sbjct: 181 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 240

Query: 237 ADKGDMIASYHD-----AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
            D      ++H       +E+ KL  + + A++ AA++L +  + RK   ILE  WK  P
Sbjct: 241 LD------THHAHAKAIVLEANKLAPDLVPAAVIAARALFADGEIRKGSKILEAAWKRFP 294

Query: 292 HPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           HP+IA  Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A  
Sbjct: 295 HPDIAATYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQ 354

Query: 351 AMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSP 410
            ++ APR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP
Sbjct: 355 VLRAAPRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSP 413

Query: 411 ISKTLCYFEWKIP 423
           ++  L  FEWK+P
Sbjct: 414 VTGRLNSFEWKVP 426


>gi|265982894|ref|ZP_06095629.1| HemY domain-containing protein [Brucella sp. 83/13]
 gi|264661486|gb|EEZ31747.1| HemY domain-containing protein [Brucella sp. 83/13]
          Length = 539

 Score =  194 bits (492), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 127/433 (29%), Positives = 223/433 (51%), Gaps = 17/433 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 3   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 62

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 63  LVKSLVQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 122

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 123 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 182

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK---NAKE-WNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++   + K+   + RA LL A+++  
Sbjct: 183 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 242

Query: 237 ADKGDMIASYHD-----AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
            D      ++H       +E+ KL  + + A++ AA++L +  + RK   ILE  WK  P
Sbjct: 243 LD------THHAHAKAIVLEANKLAPDLVPAAVIAARALFADGEIRKGSKILEAAWKRFP 296

Query: 292 HPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           HP+IA  Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A  
Sbjct: 297 HPDIAATYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQ 356

Query: 351 AMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSP 410
            ++ APR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP
Sbjct: 357 VLRAAPRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSP 415

Query: 411 ISKTLCYFEWKIP 423
           ++  L  FEWK+P
Sbjct: 416 VTGRLNSFEWKVP 428


>gi|240851346|ref|YP_002972749.1| hypothetical DNA-binding protein [Bartonella grahamii as4aup]
 gi|240268469|gb|ACS52057.1| hypothetical DNA-binding protein [Bartonella grahamii as4aup]
          Length = 519

 Score =  194 bits (492), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 147/518 (28%), Positives = 255/518 (49%), Gaps = 38/518 (7%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R+  Y FV+ ++  +F  V+++     +T+ +  +  S   +LS+L       +LL+ 
Sbjct: 1   MIRVFIYTFVVCILGLAFAWVANHNGIFVLTFLHFRFSASLLTVLSVLILLFVTLVLLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +  FF S P+ L + L+KR+  +GY+AL  G+++  A +  +A+KM + V++      E 
Sbjct: 61  LLSFFFSLPSALSNYLYKRHKKRGYEALSKGILATFAGDSMVAQKMEAQVAKYLAGKQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           LV LL+ Q    +     A    E M +  +T+   +Y L+ E+ +     +AQ+YA +A
Sbjct: 121 LVKLLQAQTLSLQNNSVRAIGLYEGMRKEDSTKLVGLYGLFCEAMKSKAYEAAQQYAEEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK-------NAKEWNRNRAILLIARS 233
           L +SP   W  +AV+ +     +W +A+    + +K          E    + +LL  ++
Sbjct: 181 LTLSPALLWAHQAVLDRLSTEGKWDKALAIFERAQKALPRSVRATPERQHIQVLLLSGQA 240

Query: 234 LENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHP 293
           L   D    + +    +++ KL  + +   + AA  L   N+ RKA+ ++   W+ +PHP
Sbjct: 241 LSLFDT-HPVQAREAILKAHKLAPDFVPIIVIAADILYKLNETRKADKMIIAAWQKDPHP 299

Query: 294 EIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMK 353
           ++A +Y     E  +G+LKRA  L   NK++ ES  +++K AL+ G    A  +A  A++
Sbjct: 300 DLAALYLE-REEGAIGRLKRARTLASYNKDAFESAFLIAKAALDAGETAIAREQAKKALQ 358

Query: 354 IAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISK 413
             PR+ ++LLLA IE+A  +N   +  W   AL A  DP+W+  DG + S W  +SPIS 
Sbjct: 359 YHPRESVYLLLADIEEAQGNNQGAVRQWLSLALRAERDPVWMC-DGSIFSSWSAVSPISG 417

Query: 414 TLCYFEWKIPTKSP----------------EYISSENINFS---LEMAYPADDLQSMLNN 454
            L  FEWK P   P                EY++ ++       LE   P DD  S+L+N
Sbjct: 418 RLGGFEWKAPPCMPSLTLEADNIVPKKQDKEYVTGKSDGVEDKKLEKLTPIDD--SLLHN 475

Query: 455 GKKNHLPSIKKVSSFEDSTIHPLDPHIRQPDDPGIKEQ 492
            +      ++K    E         H+   DDPG+K +
Sbjct: 476 VQ------VEKQDIKEQDVKMFSQTHL-NVDDPGVKTE 506


>gi|260464236|ref|ZP_05812429.1| HemY domain protein [Mesorhizobium opportunistum WSM2075]
 gi|259030039|gb|EEW31322.1| HemY domain protein [Mesorhizobium opportunistum WSM2075]
          Length = 533

 Score =  192 bits (488), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 135/428 (31%), Positives = 224/428 (52%), Gaps = 7/428 (1%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RL+ +  V+  +   F  ++  P D+ IT+    Y+ S  V    +   + A ++ + 
Sbjct: 1   MIRLLAFLVVVFALGLGFAWLADRPGDMVITFNGYQYQVSLMVAAVAVVAVVAAVMIAWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +   + P  +      R  D+GY+AL TG+++  A +  LARK     ++      E 
Sbjct: 61  LVKSLWNSPYTISRYFRVRRRDRGYQALSTGMIAAGAGDGALARKKTKEAAKLIRSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L++LLE Q +L E  +  A +K E ML  P  R   +  LY E+  +GD N+A+ YA +A
Sbjct: 121 LIHLLEAQASLLEGDHEGARQKFESMLDDPEMRLLGLRGLYLEAESLGDRNAARHYAGRA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILLIARSLEN 236
             ++P   W  E+ +++     +W  A+  ++ +K   +      NR RA+LL A++   
Sbjct: 181 AVMAPQLAWAAESTLEELTARGDWDGALKLVDAQKSTRQIERDAANRRRAVLLTAKAQSL 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
           AD  D  A+   A+E+ KL  +   A++ AA +L  QN  RK   ILE  WK  PHPE+A
Sbjct: 241 ADS-DPNAARTAALEANKLRPDFAPAAVAAAAALFKQNDVRKGSKILETAWKAEPHPEVA 299

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
            +YTH    + V  +L RA +L+E+ K   ES + V++ AL+      A  +A  A+++ 
Sbjct: 300 ELYTHARPGDAVLDRLNRAKKLQEMKKNHAESSMTVARAALDAMDFSTARREAEAAIRMD 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
            R+  +LLLA IE+A + +  K+      A+ A  DP W++ DG +S  W P+SP++  L
Sbjct: 360 RREGAYLLLADIEEAETGDQGKVRQLLSKAVRAPRDPAWVA-DGVVSERWAPVSPVTGRL 418

Query: 416 CYFEWKIP 423
             FEW+ P
Sbjct: 419 DAFEWRAP 426


>gi|307942605|ref|ZP_07657953.1| HemY domain-containing protein [Roseibium sp. TrichSKD4]
 gi|307774244|gb|EFO33457.1| HemY domain-containing protein [Roseibium sp. TrichSKD4]
          Length = 656

 Score =  188 bits (477), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 120/430 (27%), Positives = 218/430 (50%), Gaps = 13/430 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++ +F ++  V      ++  P  VSI+W   ++   P V+  +L   L A++ +  
Sbjct: 1   MIRVLVFFALLFAVALGAARMADLPGVVSISWDGYVWEQPPVVVAVVLASLLAAFLFVVW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V R  L+ P +      +R  DKGY++L  GL+++   N  LAR+ H+  + +  F +E 
Sbjct: 61  VIRVILNSPKIATRFFRQRRKDKGYQSLSQGLIALGTGNAKLARR-HALDADKF-FSDEP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
              LL  Q A    +   A ++ E ML  P TR   ++ L+ E+ + G+  +A+ YA +A
Sbjct: 119 ATKLLLAQTAQLAGKDEEARKRFEDMLADPQTRSLGLHGLFIEAEKQGEPAAARHYAEEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQ----KKKNAKEWNRNRAILLI--ARSL 234
           +   P   W   AV+    +A +W +A+  L +    K  + K + R RA++L   AR L
Sbjct: 179 VKAVPGLEWAGNAVLGYQAVASDWEQALQSLERNYSAKLLDKKSYRRQRAVILTAHARQL 238

Query: 235 ENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPE 294
           E+ D      ++ +A E+  L  N + A+  AA+    +   RKA  +LE  W++ PHPE
Sbjct: 239 EDQDPDK---AFANAKEAHGLAQNLVPAATIAARLATRRGDIRKASKMLETTWRLAPHPE 295

Query: 295 IANIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMK 353
           +A+ Y H+ S ++ + +LKR   L      +    + +++ A+E    D+A  +    ++
Sbjct: 296 LADAYAHVRSGDSAIDRLKRVKALAGQRTNTAVGALAIARAAMEAREFDEAREQMKKVLR 355

Query: 354 IAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISK 413
             P +  F+++A++E+    N  ++  W   A++A  D  WI+ DG + + W  +SP++ 
Sbjct: 356 SEPTRGAFMMMAEVEELEHGNRGRMREWLAKAVNAPLDKAWIA-DGVVQAEWAAVSPVTG 414

Query: 414 TLCYFEWKIP 423
            L  FEW  P
Sbjct: 415 QLDAFEWATP 424


>gi|114705598|ref|ZP_01438501.1| hypothetical protein FP2506_14069 [Fulvimarina pelagi HTCC2506]
 gi|114538444|gb|EAU41565.1| hypothetical protein FP2506_14069 [Fulvimarina pelagi HTCC2506]
          Length = 522

 Score =  188 bits (477), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 125/435 (28%), Positives = 221/435 (50%), Gaps = 17/435 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFA-----W 55
           M  ++ +F +I  +   F  ++  P  V+  W  +    S  + L+     + A     W
Sbjct: 1   MWGILTFFILILALYLGFGWLADNPGSVTFVWQEQTVEFSMILFLAAAAAVIVASVLVVW 60

Query: 56  ILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHT 115
           +    V++ F   P ++      R + KG+  L  G+++  A N  LAR+M      +  
Sbjct: 61  L----VAKLF-QAPGLISSWNSSRRHSKGHNYLSRGVLAAGAGNATLARQMIKKSEGRIG 115

Query: 116 FHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQR 175
             +  ++  L+ Q AL E  +  A      M + P T+  A+  LY E+ R+GD ++ + 
Sbjct: 116 KDDRAILGFLDAQTALIEGDHQRAVAIFRDMEEDPNTKLLALRGLYLEAKRVGDESAQEY 175

Query: 176 YATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIA 231
           YA +AL I+P+ PW  EAV+++   +++W  A+  L  ++       K+  R RAILL A
Sbjct: 176 YAERALRIAPNLPWAAEAVLERKSSSRDWDGALRVLEAQRSIDMLGDKDAKRIRAILLTA 235

Query: 232 RSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
           ++ + AD  D  A+   A  + K+  + + A++ AA +    N  R+A   LE  W   P
Sbjct: 236 KAKDQAD-ADPKAARSSARSAQKIAPDFVPAALVAAAAATRLNDSRRATRYLETTWVNAP 294

Query: 292 HPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           HPEIA+ Y H  + ++   +L+RA +L+ + ++  ES + V++ AL+ G  D A + A+ 
Sbjct: 295 HPEIADAYVHAKAGDSAKDRLRRAQKLKGLYEKHPESDIAVARAALDAGEHDLARSSALD 354

Query: 351 AMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSP 410
           A +  P + ++LLLA IE+  S    ++  W   A+ A  DP+W++ DG +   W P+SP
Sbjct: 355 AAQKRPTESVYLLLADIEEEQSGEVGRVREWLAKAITAPRDPVWMA-DGVILDEWQPVSP 413

Query: 411 ISKTLCYFEWKIPTK 425
           +++ L   EWK P +
Sbjct: 414 VTRKLGVVEWKSPVE 428


>gi|161619801|ref|YP_001593688.1| HemY domain-containing protein [Brucella canis ATCC 23365]
 gi|161336612|gb|ABX62917.1| HemY domain protein [Brucella canis ATCC 23365]
          Length = 523

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 129/433 (29%), Positives = 227/433 (52%), Gaps = 17/433 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 1   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +Q + + E 
Sbjct: 61  LVKSLVQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKQLSSYQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 121 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK---NAKE-WNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++   + K+   + RA LL A+++  
Sbjct: 181 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 240

Query: 237 ADKGDMIASYHD-----AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
            D      ++H      A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  P
Sbjct: 241 LD------THHTHAKAIALEANKLAPDLVPAAVVAARALFADGEIRKGSKILEAAWKRFP 294

Query: 292 HPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           HP+IA+ Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A  
Sbjct: 295 HPDIASTYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQ 354

Query: 351 AMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSP 410
            ++ APR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP
Sbjct: 355 VLRAAPRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSP 413

Query: 411 ISKTLCYFEWKIP 423
           ++  L  FEWK+P
Sbjct: 414 VTGRLNSFEWKVP 426


>gi|260567627|ref|ZP_05838097.1| HemY domain-containing protein [Brucella suis bv. 4 str. 40]
 gi|260157145|gb|EEW92225.1| HemY domain-containing protein [Brucella suis bv. 4 str. 40]
          Length = 523

 Score =  187 bits (475), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 129/433 (29%), Positives = 226/433 (52%), Gaps = 17/433 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 1   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +Q +   E 
Sbjct: 61  LVKSLVQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKQLSSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 121 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK---NAKE-WNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++   + K+   + RA LL A+++  
Sbjct: 181 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 240

Query: 237 ADKGDMIASYHD-----AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
            D      ++H      A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  P
Sbjct: 241 LD------THHTHAKAIALEANKLAPDLVPAAVVAARALFADGEIRKGSKILEAAWKRFP 294

Query: 292 HPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           HP+IA+ Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A  
Sbjct: 295 HPDIASTYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQ 354

Query: 351 AMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSP 410
            ++ APR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP
Sbjct: 355 VLRAAPRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSP 413

Query: 411 ISKTLCYFEWKIP 423
           ++  L  FEWK+P
Sbjct: 414 VTGRLNSFEWKVP 426


>gi|319780790|ref|YP_004140266.1| HemY domain protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317166678|gb|ADV10216.1| HemY domain protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 534

 Score =  187 bits (474), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 156/520 (30%), Positives = 257/520 (49%), Gaps = 33/520 (6%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RL+ +  V+  +   F  ++  P D+ +T+    Y+ S  V    +   + A ++L+ 
Sbjct: 1   MIRLLAFLIVVFALGLGFAWLADRPGDMVVTFNGYQYQVSLMVAAVAVVAVVAAVMILWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +   + P  +      R  D+GY+AL TG+++  A +  LARK     ++      E 
Sbjct: 61  LLKALWNSPYTISRYFRVRRRDRGYQALSTGMIAAGAGDGALARKKTKEAAKLIRSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L++LLE Q +L E  +  A +K E ML  P  R   +  LY E+ R+GD N+A+ YA +A
Sbjct: 121 LIHLLEAQASLLEGDHEGARQKFESMLDDPEMRLLGLRGLYLEAERLGDRNAARHYAGRA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILLIARSLEN 236
             ++P   W  E+ +++     +W  A+  ++ +K   +      NR RA+LL A++   
Sbjct: 181 AAVAPQLAWAAESTLEELTARGDWDGALKLVDAQKATRQIERDAANRRRAVLLTAKAQAL 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
           AD  D  A+   AIE+ KL  +   A++ AA +L  QN  RK   ILE  WK  PHPEIA
Sbjct: 241 ADS-DPAAARTAAIEANKLRPDFAPAAVAAAAALFKQNDVRKGSKILEAAWKAEPHPEIA 299

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
            +YTH    + V  +L RA +L+E+ K   ES + V++ AL+      A  +A  A+++ 
Sbjct: 300 ELYTHARPGDAVLDRLNRAKKLQEMKKNHAESSMTVARAALDAQDFATARREAEAAIRMD 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
            R+  +LLLA IE+A + +  K+      A+ A  DP W++ DG +S  W P+SPI+  L
Sbjct: 360 RREGAYLLLADIEEAETGDQGKVRQLLSRAVRAPRDPAWVA-DGVVSERWAPVSPITGRL 418

Query: 416 CYFEWKIPTKS-PEYISSENINFSL------EMAYPA---------DDLQSMLNNGKK-- 457
             FEW+ P +   + I S +   +        +A P          DD     + GK+  
Sbjct: 419 DAFEWRAPMERLGQLIDSHDDAPAGAAPVIEALAKPTSEKRPIEVIDDAGGETSAGKQAE 478

Query: 458 ----NHLPSIKKVS----SFEDSTIHPLDPHIRQPDDPGI 489
               +H+  I   +      +   + P +   R PDDPG+
Sbjct: 479 SREEDHVRPITAAAFAAVPSDAEGVEPAEELARLPDDPGV 518


>gi|256370285|ref|YP_003107796.1| hypothetical protein BMI_I1905 [Brucella microti CCM 4915]
 gi|256000448|gb|ACU48847.1| hypothetical protein BMI_I1905 [Brucella microti CCM 4915]
          Length = 523

 Score =  186 bits (471), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 129/433 (29%), Positives = 226/433 (52%), Gaps = 17/433 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 1   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P ML   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 61  LVKSLVQSPYMLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 121 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK---NAKE-WNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++   + K+   + RA LL A+++  
Sbjct: 181 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 240

Query: 237 ADKGDMIASYHD-----AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
            D      ++H      A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  P
Sbjct: 241 LD------THHAHAKAIALEANKLAPDLVPAAVVAARALFADGEIRKGSKILEAAWKRFP 294

Query: 292 HPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           HP+IA+ Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A  
Sbjct: 295 HPDIASTYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQ 354

Query: 351 AMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSP 410
            ++ APR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP
Sbjct: 355 VLRAAPRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSP 413

Query: 411 ISKTLCYFEWKIP 423
           ++  L  FEWK+P
Sbjct: 414 VTGRLNSFEWKVP 426


>gi|328542000|ref|YP_004302109.1| HemY N-terminal domain protein [polymorphum gilvum SL003B-26A1]
 gi|326411750|gb|ADZ68813.1| HemY N-terminal domain protein [Polymorphum gilvum SL003B-26A1]
          Length = 597

 Score =  185 bits (470), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 126/444 (28%), Positives = 217/444 (48%), Gaps = 9/444 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R + +F V+  V   F  ++  P  VS++W   ++   P V   ++   L   +L F 
Sbjct: 1   MIRALVFFAVLFAVAFGFAWMADLPGVVSVSWQGYVWEQPPVVAAVLIGLALVLVLLAFW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +    L  P +    L +R  DKGY+AL  GL+++   N   AR+      +      E 
Sbjct: 61  LVGAILRSPRIARRFLRRRRRDKGYEALSHGLIALGTGNAKRARRYGQDADK--LLRGES 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
              LL  Q A    Q++ A ++ E ML+ P TR   ++ L+ E+ R  +  +A+ YA +A
Sbjct: 119 AARLLLAQAAQMSGQHDEARQRFEAMLKDPETRALGLHGLFIEAERQNEPIAARHYAEEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQ----KKKNAKEWNRNRAILLIARSLEN 236
               P   W   AV+    +A +W  AI  L +    +  + K + R+RA+LL AR+LE 
Sbjct: 179 ARAVPGLDWAGRAVLGYQAVAGDWEAAIATLERNYAARLVDKKTYRRHRAVLLAARALEL 238

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D GD   +   A E+  L  + + A++ AA+    +   RKA  I+E  W+++PHP++A
Sbjct: 239 ED-GDPETALTLAKEAHGLALDLVPAAVVAARLATRKGDVRKAAKIVEATWRLSPHPDLA 297

Query: 297 NIYTHL-LSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y H  + +  + +L R   L      + E  + V++ ALE     +A  +    ++  
Sbjct: 298 DAYAHARIGDAALDRLARVRTLAAQRAHTAEGALAVARAALEAREFGEAREQLKRVLRSE 357

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           P +  F+L+A++E+A   +  ++  W   A+ A  D  W++ DG +   W P+SP++  L
Sbjct: 358 PTRGAFVLMAELEEAEHGDRGRVREWLARAVRAPLDKAWVA-DGVVREAWAPVSPVTGRL 416

Query: 416 CYFEWKIPTKSPEYISSENINFSL 439
             FEW  PT  PE    E ++ +L
Sbjct: 417 DAFEWTTPTGLPETPLVEALDDAL 440


>gi|118592001|ref|ZP_01549395.1| hypothetical protein SIAM614_25032 [Stappia aggregata IAM 12614]
 gi|118435297|gb|EAV41944.1| hypothetical protein SIAM614_25032 [Stappia aggregata IAM 12614]
          Length = 669

 Score =  184 bits (467), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 115/437 (26%), Positives = 216/437 (49%), Gaps = 18/437 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITW---------GNRLYRTSPFVILSILYFF 51
           M+R++ +F ++  V   F  ++  P  + I+W         G  ++  SP ++      F
Sbjct: 1   MIRVLFFFALLFAVALGFAWMADLPGTIQISWPVYENGQQVGTDIWEQSPVIVGLAAAVF 60

Query: 52  LFAWILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVS 111
           L  ++++    R  L  P +      +R  DKGY AL  GL+++   N  LAR+    + 
Sbjct: 61  LAVFLVIVWAIRVVLKSPQIASRFFRRRRKDKGYNALSQGLIALGTGNAKLARRY--ALD 118

Query: 112 QQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLN 171
                 +E    LL  Q A    + + A ++ E ML+ PAT+   ++ L+ E+ R  +  
Sbjct: 119 ADKLLDDEPAAKLLLAQTAQLAGKDDEARQRFEAMLEDPATKALGLHGLFIEAERHKEPV 178

Query: 172 SAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQ----KKKNAKEWNRNRAI 227
           +A+ YA +A   SP   W  +AV+    +A  W  A+  L +    K  + K + R RA+
Sbjct: 179 AARHYAEEAAKTSPGLEWAGKAVLGYQAVAHHWDEALKTLERNYAAKMLDKKTYRRQRAV 238

Query: 228 LLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIW 287
           +L A +++  D G+   +Y  A E+  L  + + A++  ++    +   RKA  +LE  W
Sbjct: 239 ILTALAMKLED-GEPERAYSLAKEAHGLALDLVPAAVLTSRLATRRGDIRKASKVLEATW 297

Query: 288 KVNPHPEIANIYTHL-LSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHA 346
           ++ PHP++A  Y H+   ++ V +LKR   L      + E  + +++ A+E    ++A  
Sbjct: 298 RLFPHPDLAETYAHVRTGDSAVDRLKRVKSLSAQRANTPEGALAIARAAMEAREFEEARQ 357

Query: 347 KAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWL 406
           +    ++  P ++ FLL+A++E+A + +  +   W   A+ A  D +W++ DG +S+ W 
Sbjct: 358 QLKKVLQSEPTRQAFLLMAEVEEAENGDRGRTRDWLARAVSAPLDKVWMA-DGIISAEWQ 416

Query: 407 PLSPISKTLCYFEWKIP 423
           P+SP++  L  F+W  P
Sbjct: 417 PVSPVTGKLDAFQWATP 433


>gi|225853321|ref|YP_002733554.1| HemY domain-containing protein [Brucella melitensis ATCC 23457]
 gi|256045493|ref|ZP_05448376.1| hypothetical protein Bmelb1R_13396 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256112219|ref|ZP_05453140.1| hypothetical protein Bmelb3E_05957 [Brucella melitensis bv. 3 str.
           Ether]
 gi|260562802|ref|ZP_05833288.1| HemY domain-containing protein [Brucella melitensis bv. 1 str. 16M]
 gi|225641686|gb|ACO01600.1| HemY domain protein [Brucella melitensis ATCC 23457]
 gi|260152818|gb|EEW87910.1| HemY domain-containing protein [Brucella melitensis bv. 1 str. 16M]
 gi|326409884|gb|ADZ66949.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326539598|gb|ADZ87813.1| HemY domain protein [Brucella melitensis M5-90]
          Length = 523

 Score =  184 bits (467), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 128/433 (29%), Positives = 225/433 (51%), Gaps = 17/433 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 1   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 61  LVKSLVQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 121 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK---NAKE-WNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++   + K+   + RA LL A+++  
Sbjct: 181 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 240

Query: 237 ADKGDMIASYHD-----AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
            D      ++H      A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  P
Sbjct: 241 LD------THHAHAKAIALEANKLAPDLVPAAVVAARALFADGEIRKGSKILEAAWKRFP 294

Query: 292 HPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           HP+IA+ Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A  
Sbjct: 295 HPDIASTYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQ 354

Query: 351 AMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSP 410
            ++ APR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP
Sbjct: 355 VLRAAPRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSP 413

Query: 411 ISKTLCYFEWKIP 423
           ++  L  FEWK+P
Sbjct: 414 VTGRLNSFEWKVP 426


>gi|17986463|ref|NP_539097.1| hypothetical protein BMEI0179 [Brucella melitensis bv. 1 str. 16M]
 gi|265991915|ref|ZP_06104472.1| HemY domain-containing protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993646|ref|ZP_06106203.1| HemY domain-containing protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265999298|ref|ZP_05465724.2| HemY domain-containing protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|17982061|gb|AAL51361.1| hypothetical protein BMEI0179 [Brucella melitensis bv. 1 str. 16M]
 gi|262764627|gb|EEZ10548.1| HemY domain-containing protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002981|gb|EEZ15274.1| HemY domain-containing protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093114|gb|EEZ17249.1| HemY domain-containing protein [Brucella melitensis bv. 2 str.
           63/9]
          Length = 525

 Score =  184 bits (467), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 128/433 (29%), Positives = 225/433 (51%), Gaps = 17/433 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 3   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 62

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 63  LVKSLVQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 122

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 123 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 182

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK---NAKE-WNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++   + K+   + RA LL A+++  
Sbjct: 183 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 242

Query: 237 ADKGDMIASYHD-----AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
            D      ++H      A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  P
Sbjct: 243 LD------THHAHAKAIALEANKLAPDLVPAAVVAARALFADGEIRKGSKILEAAWKRFP 296

Query: 292 HPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           HP+IA+ Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A  
Sbjct: 297 HPDIASTYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQ 356

Query: 351 AMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSP 410
            ++ APR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP
Sbjct: 357 VLRAAPRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSP 415

Query: 411 ISKTLCYFEWKIP 423
           ++  L  FEWK+P
Sbjct: 416 VTGRLNSFEWKVP 428


>gi|261755593|ref|ZP_05999302.1| HemY domain-containing protein [Brucella suis bv. 3 str. 686]
 gi|261745346|gb|EEY33272.1| HemY domain-containing protein [Brucella suis bv. 3 str. 686]
          Length = 525

 Score =  184 bits (467), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 128/433 (29%), Positives = 225/433 (51%), Gaps = 17/433 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 3   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 62

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 63  LVKSLVQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 122

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 123 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 182

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK---NAKE-WNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++   + K+   + RA LL A+++  
Sbjct: 183 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 242

Query: 237 ADKGDMIASYHD-----AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
            D      ++H      A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  P
Sbjct: 243 LD------THHTHAKAIALEANKLAPDLVPAAVVAARALFADGEIRKGSKILEAAWKRFP 296

Query: 292 HPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           HP+IA+ Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A  
Sbjct: 297 HPDIASTYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQ 356

Query: 351 AMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSP 410
            ++ APR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP
Sbjct: 357 VLRAAPRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSP 415

Query: 411 ISKTLCYFEWKIP 423
           ++  L  FEWK+P
Sbjct: 416 VTGRLNSFEWKVP 428


>gi|225628086|ref|ZP_03786121.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|261217713|ref|ZP_05931994.1| HemY domain-containing protein [Brucella ceti M13/05/1]
 gi|261220938|ref|ZP_05935219.1| HemY domain-containing protein [Brucella ceti B1/94]
 gi|261315072|ref|ZP_05954269.1| HemY domain-containing protein [Brucella pinnipedialis M163/99/10]
 gi|261316370|ref|ZP_05955567.1| HemY domain-containing protein [Brucella pinnipedialis B2/94]
 gi|261321440|ref|ZP_05960637.1| HemY domain-containing protein [Brucella ceti M644/93/1]
 gi|261758825|ref|ZP_06002534.1| HemY domain-containing protein [Brucella sp. F5/99]
 gi|265987442|ref|ZP_06099999.1| HemY domain-containing protein [Brucella pinnipedialis M292/94/1]
 gi|265996898|ref|ZP_06109455.1| HemY domain-containing protein [Brucella ceti M490/95/1]
 gi|225616911|gb|EEH13958.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|260919522|gb|EEX86175.1| HemY domain-containing protein [Brucella ceti B1/94]
 gi|260922802|gb|EEX89370.1| HemY domain-containing protein [Brucella ceti M13/05/1]
 gi|261294130|gb|EEX97626.1| HemY domain-containing protein [Brucella ceti M644/93/1]
 gi|261295593|gb|EEX99089.1| HemY domain-containing protein [Brucella pinnipedialis B2/94]
 gi|261304098|gb|EEY07595.1| HemY domain-containing protein [Brucella pinnipedialis M163/99/10]
 gi|261738809|gb|EEY26805.1| HemY domain-containing protein [Brucella sp. F5/99]
 gi|262551366|gb|EEZ07356.1| HemY domain-containing protein [Brucella ceti M490/95/1]
 gi|264659639|gb|EEZ29900.1| HemY domain-containing protein [Brucella pinnipedialis M292/94/1]
          Length = 525

 Score =  184 bits (466), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 128/433 (29%), Positives = 225/433 (51%), Gaps = 17/433 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 3   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 62

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 63  LVKSLVQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 122

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 123 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 182

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK---NAKE-WNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++   + K+   + RA LL A+++  
Sbjct: 183 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 242

Query: 237 ADKGDMIASYHD-----AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
            D      ++H      A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  P
Sbjct: 243 LD------THHAHAKAIALEANKLAPDLVPAAVVAARALFADGEMRKGSKILEAAWKRFP 296

Query: 292 HPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           HP+IA+ Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A  
Sbjct: 297 HPDIASTYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQ 356

Query: 351 AMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSP 410
            ++ APR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP
Sbjct: 357 VLRAAPRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSP 415

Query: 411 ISKTLCYFEWKIP 423
           ++  L  FEWK+P
Sbjct: 416 VTGRLNSFEWKVP 428


>gi|254707585|ref|ZP_05169413.1| hypothetical protein BpinM_11596 [Brucella pinnipedialis
           M163/99/10]
 gi|254708877|ref|ZP_05170688.1| hypothetical protein BpinB_01173 [Brucella pinnipedialis B2/94]
 gi|254713700|ref|ZP_05175511.1| hypothetical protein BcetM6_10155 [Brucella ceti M644/93/1]
 gi|254715950|ref|ZP_05177761.1| hypothetical protein BcetM_05867 [Brucella ceti M13/05/1]
 gi|256030403|ref|ZP_05444017.1| hypothetical protein BpinM2_07105 [Brucella pinnipedialis
           M292/94/1]
 gi|256158386|ref|ZP_05456284.1| hypothetical protein BcetM4_05995 [Brucella ceti M490/95/1]
 gi|256253805|ref|ZP_05459341.1| hypothetical protein BcetB_05837 [Brucella ceti B1/94]
 gi|260169312|ref|ZP_05756123.1| hypothetical protein BruF5_13330 [Brucella sp. F5/99]
          Length = 523

 Score =  184 bits (466), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 128/433 (29%), Positives = 225/433 (51%), Gaps = 17/433 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 1   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 61  LVKSLVQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 121 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK---NAKE-WNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++   + K+   + RA LL A+++  
Sbjct: 181 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 240

Query: 237 ADKGDMIASYHD-----AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
            D      ++H      A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  P
Sbjct: 241 LD------THHAHAKAIALEANKLAPDLVPAAVVAARALFADGEMRKGSKILEAAWKRFP 294

Query: 292 HPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           HP+IA+ Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A  
Sbjct: 295 HPDIASTYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQ 354

Query: 351 AMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSP 410
            ++ APR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP
Sbjct: 355 VLRAAPRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSP 413

Query: 411 ISKTLCYFEWKIP 423
           ++  L  FEWK+P
Sbjct: 414 VTGRLNSFEWKVP 426


>gi|23502736|ref|NP_698863.1| hypothetical protein BR1884 [Brucella suis 1330]
 gi|254704899|ref|ZP_05166727.1| hypothetical protein Bsuib36_13470 [Brucella suis bv. 3 str. 686]
 gi|23348752|gb|AAN30778.1| conserved hypothetical protein [Brucella suis 1330]
          Length = 523

 Score =  184 bits (466), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 128/433 (29%), Positives = 225/433 (51%), Gaps = 17/433 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 1   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 61  LVKSLVQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 121 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK---NAKE-WNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++   + K+   + RA LL A+++  
Sbjct: 181 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 240

Query: 237 ADKGDMIASYHD-----AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
            D      ++H      A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  P
Sbjct: 241 LD------THHTHAKAIALEANKLAPDLVPAAVVAARALFADGEIRKGSKILEAAWKRFP 294

Query: 292 HPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           HP+IA+ Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A  
Sbjct: 295 HPDIASTYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQ 354

Query: 351 AMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSP 410
            ++ APR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP
Sbjct: 355 VLRAAPRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSP 413

Query: 411 ISKTLCYFEWKIP 423
           ++  L  FEWK+P
Sbjct: 414 VTGRLNSFEWKVP 426


>gi|237816247|ref|ZP_04595240.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|260755565|ref|ZP_05867913.1| HemY domain-containing protein [Brucella abortus bv. 6 str. 870]
 gi|260758788|ref|ZP_05871136.1| HemY domain-containing protein [Brucella abortus bv. 4 str. 292]
 gi|260760512|ref|ZP_05872855.1| HemY domain-containing protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884589|ref|ZP_05896203.1| HemY domain-containing protein [Brucella abortus bv. 9 str. C68]
 gi|261214836|ref|ZP_05929117.1| HemY domain-containing protein [Brucella abortus bv. 3 str. Tulya]
 gi|261323831|ref|ZP_05963028.1| HemY domain-containing protein [Brucella neotomae 5K33]
 gi|261751032|ref|ZP_05994741.1| HemY domain-containing protein [Brucella suis bv. 5 str. 513]
 gi|237788314|gb|EEP62529.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|260669106|gb|EEX56046.1| HemY domain-containing protein [Brucella abortus bv. 4 str. 292]
 gi|260670944|gb|EEX57765.1| HemY domain-containing protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675673|gb|EEX62494.1| HemY domain-containing protein [Brucella abortus bv. 6 str. 870]
 gi|260874117|gb|EEX81186.1| HemY domain-containing protein [Brucella abortus bv. 9 str. C68]
 gi|260916443|gb|EEX83304.1| HemY domain-containing protein [Brucella abortus bv. 3 str. Tulya]
 gi|261299811|gb|EEY03308.1| HemY domain-containing protein [Brucella neotomae 5K33]
 gi|261740785|gb|EEY28711.1| HemY domain-containing protein [Brucella suis bv. 5 str. 513]
          Length = 525

 Score =  184 bits (466), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 128/433 (29%), Positives = 225/433 (51%), Gaps = 17/433 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 3   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 62

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 63  LVKSLVQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 122

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 123 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 182

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK---NAKE-WNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++   + K+   + RA LL A+++  
Sbjct: 183 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 242

Query: 237 ADKGDMIASYHD-----AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
            D      ++H      A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  P
Sbjct: 243 LD------THHAHAKAIALEANKLAPDLVPAAVVAARALFADGEIRKGSKILEAAWKRFP 296

Query: 292 HPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           HP+IA+ Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A  
Sbjct: 297 HPDIASTYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQ 356

Query: 351 AMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSP 410
            ++ APR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP
Sbjct: 357 VLRAAPRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSP 415

Query: 411 ISKTLCYFEWKIP 423
           ++  L  FEWK+P
Sbjct: 416 VTGRLNSFEWKVP 428


>gi|62290741|ref|YP_222534.1| hypothetical protein BruAb1_1861 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700652|ref|YP_415226.1| hypothetical protein BAB1_1884 [Brucella melitensis biovar Abortus
           2308]
 gi|148559352|ref|YP_001259709.1| hypothetical protein BOV_1812 [Brucella ovis ATCC 25840]
 gi|163843908|ref|YP_001628312.1| HemY domain-containing protein [Brucella suis ATCC 23445]
 gi|189024954|ref|YP_001935722.1| hypothetical protein BAbS19_I17660 [Brucella abortus S19]
 gi|254690029|ref|ZP_05153283.1| hypothetical protein Babob68_07641 [Brucella abortus bv. 6 str.
           870]
 gi|254694518|ref|ZP_05156346.1| hypothetical protein Babob3T_07639 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696143|ref|ZP_05157971.1| hypothetical protein Babob28_00127 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254700528|ref|ZP_05162356.1| hypothetical protein Bsuib55_06701 [Brucella suis bv. 5 str. 513]
 gi|254731061|ref|ZP_05189639.1| hypothetical protein Babob42_07671 [Brucella abortus bv. 4 str.
           292]
 gi|256059861|ref|ZP_05450048.1| hypothetical protein Bneo5_05852 [Brucella neotomae 5K33]
 gi|256258283|ref|ZP_05463819.1| hypothetical protein Babob9C_13253 [Brucella abortus bv. 9 str.
           C68]
 gi|260546004|ref|ZP_05821744.1| HemY domain-containing protein [Brucella abortus NCTC 8038]
 gi|297247127|ref|ZP_06930845.1| HemY protein [Brucella abortus bv. 5 str. B3196]
 gi|62196873|gb|AAX75173.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616753|emb|CAJ11840.1| unnamed protein product [Brucella melitensis biovar Abortus 2308]
 gi|148370609|gb|ABQ60588.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
 gi|163674631|gb|ABY38742.1| HemY domain protein [Brucella suis ATCC 23445]
 gi|189020526|gb|ACD73248.1| hypothetical protein BAbS19_I17660 [Brucella abortus S19]
 gi|260096111|gb|EEW79987.1| HemY domain-containing protein [Brucella abortus NCTC 8038]
 gi|297174296|gb|EFH33643.1| HemY protein [Brucella abortus bv. 5 str. B3196]
          Length = 523

 Score =  184 bits (466), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 128/433 (29%), Positives = 225/433 (51%), Gaps = 17/433 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 1   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 61  LVKSLVQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 121 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK---NAKE-WNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++   + K+   + RA LL A+++  
Sbjct: 181 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 240

Query: 237 ADKGDMIASYHD-----AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
            D      ++H      A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  P
Sbjct: 241 LD------THHAHAKAIALEANKLAPDLVPAAVVAARALFADGEIRKGSKILEAAWKRFP 294

Query: 292 HPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           HP+IA+ Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A  
Sbjct: 295 HPDIASTYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQ 354

Query: 351 AMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSP 410
            ++ APR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP
Sbjct: 355 VLRAAPRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSP 413

Query: 411 ISKTLCYFEWKIP 423
           ++  L  FEWK+P
Sbjct: 414 VTGRLNSFEWKVP 426


>gi|306842962|ref|ZP_07475596.1| HemY domain protein [Brucella sp. BO2]
 gi|306286890|gb|EFM58415.1| HemY domain protein [Brucella sp. BO2]
          Length = 523

 Score =  182 bits (463), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 128/433 (29%), Positives = 224/433 (51%), Gaps = 17/433 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 1   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 61  LVKSLIQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 121 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK---NAKE-WNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++   + K+   + RA LL A+++  
Sbjct: 181 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 240

Query: 237 ADKGDMIASYHD-----AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
            D      ++H      A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  P
Sbjct: 241 LD------THHAHARAIALEANKLAPDLVPAAVVAARALFADGEIRKGSKILEAAWKRFP 294

Query: 292 HPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           HP+IA  Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A  
Sbjct: 295 HPDIAATYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQ 354

Query: 351 AMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSP 410
            ++ APR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP
Sbjct: 355 VLRAAPRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSP 413

Query: 411 ISKTLCYFEWKIP 423
           ++  L  FEWK+P
Sbjct: 414 VTGRLNSFEWKVP 426


>gi|163869275|ref|YP_001610531.1| hypothetical protein Btr_2583 [Bartonella tribocorum CIP 105476]
 gi|161018978|emb|CAK02536.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 520

 Score =  182 bits (463), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 139/498 (27%), Positives = 252/498 (50%), Gaps = 18/498 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R+  Y FV+ ++  +F+ V+++     +T+ +  +  S   +LS+L       +LL+ 
Sbjct: 1   MIRVFIYTFVVCILGLAFVWVANHNGVFVLTFLHFRFSASLLTVLSVLTLLFVTLVLLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +  FF S P+ L +  +KR   +GY+AL  G+++  A +  +A+KM + V++      E 
Sbjct: 61  LLSFFFSIPSALSNYFYKRQRKRGYEALSKGILATFAGDSMVAQKMEARVAKYLAGKQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           LV  L+ QI   +     A    E M +   T+   +Y L+ E+ +     +AQ+YA +A
Sbjct: 121 LVKFLKAQILSLQNNSVRAISLYEEMRKEDPTKLVGLYGLFREAMKSKAYEAAQQYAEEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNR------AILLIARSL 234
           L +SP   W  +AV+ +     +W +A+T   + +K      R+        +LL++   
Sbjct: 181 LTLSPALLWAHQAVLDRLGAEGKWDKALTVFERAQKALPRSVRSTPERQHIQVLLLSGQA 240

Query: 235 ENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPE 294
            +  +   + +    +++ KL  + +  +I AA  L   N+ RKA+ ++   W+  PHP+
Sbjct: 241 LHLFETHPVQAREAILKAHKLAPDFVPITIIAADILYKLNETRKADKMIIAAWQKEPHPD 300

Query: 295 IANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKI 354
           +  +Y     E  +G+LKRA  L   NK+  ES  ++SK AL+ G    A  +A  A++ 
Sbjct: 301 LGTLYIE-REEGAIGRLKRAKTLASYNKDVFESAFLISKAALDAGETILAREQAQKALQY 359

Query: 355 APRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKT 414
            PR+ ++LLLA IE+A  +N   +  W   AL A  DP+W+  +G + S W  +SPIS  
Sbjct: 360 HPRESVYLLLADIEEAQGNNQGAVRQWLSLALRAERDPVWMC-EGSIFSSWSAVSPISGR 418

Query: 415 LCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDSTI 474
           L  FEWK P + P  ++ E +N    +     D + ++   +      ++K++  +DS +
Sbjct: 419 LGCFEWKAPPRLPS-LTLEAVN----IVPKKQDKEDVVEESEGVEDKKLEKLTPIDDSFL 473

Query: 475 HPLDPHIRQPDDPGIKEQ 492
           H  +  + + D   IKEQ
Sbjct: 474 H--NAQVEKQD---IKEQ 486


>gi|300024948|ref|YP_003757559.1| HemY domain protein [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526769|gb|ADJ25238.1| HemY domain protein [Hyphomicrobium denitrificans ATCC 51888]
          Length = 577

 Score =  182 bits (462), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 120/447 (26%), Positives = 223/447 (49%), Gaps = 13/447 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RL+ Y   I+L+      ++  P  + I W      TS F  + +L   + + + L++
Sbjct: 1   MVRLVVYLVTIALIASGLAWLADRPGTLQIAWQGYDIETSVFRAVVLLAAAVASIVFLWS 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V R   + PA +   L +R   KG  A+ +GL++I A +  LA +    +  + +  +E 
Sbjct: 61  VFRALWNSPAAIGGRLVQRRQRKGLDAVSSGLIAIGAGDSTLASRF--ALQARKSLPHEP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L +LL  Q A        A    E ML  P T    +  L+ E+   G   +A+++A +A
Sbjct: 119 LTHLLRAQSAELSGDRATARRIYEAMLASPETELLGLRGLFLEAQHQGADEAARQFADRA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLIARSLEN 236
           L  +P   W   A+ +Q    K+W+ A+  L   +KN      + +R RA+LL A++ +N
Sbjct: 179 LKANPKLGWSATALFEQQCKQKDWTGALETLQHARKNGHIAKADADRKRAVLLTAKA-QN 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            ++     +   A+E+  L  + + A+  A + L S+    KA  +L+K W  +PHP++A
Sbjct: 238 VEEDSPDRALTLAMEAHALAPDLVPAAAIAGRILASRGNTAKAAKVLQKTWAKSPHPDLA 297

Query: 297 NIYTHL-LSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHA--KAMLAMK 353
           + Y +  + ++T  +  R  +L  +N  S+ES + V+  A+E    D+A    + +L  +
Sbjct: 298 SAYAYARVGDSTRDRFDRERQLAALNPHSIESPIAVATAAIEARMYDEARRVLEPLLPER 357

Query: 354 IAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISK 413
           +  R  +  L+A+IE  ++ +  ++  W   A++A  DP WI+ DG +S  W P SP+  
Sbjct: 358 LTQR--VATLMARIEAGDNGDKGRVREWLARAMNAARDPAWIA-DGVISDHWEPTSPVDG 414

Query: 414 TLCYFEWKIPTKSPEYISSENINFSLE 440
            L  F+W++P ++ +   +E +   +E
Sbjct: 415 RLDAFQWRVPVETRDATRNEILARRIE 441


>gi|306844854|ref|ZP_07477437.1| HemY domain protein [Brucella sp. BO1]
 gi|306274786|gb|EFM56567.1| HemY domain protein [Brucella sp. BO1]
          Length = 523

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 127/433 (29%), Positives = 224/433 (51%), Gaps = 17/433 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 1   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 61  LVKSLIQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 121 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK---NAKE-WNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++   + K+   + RA LL A+++  
Sbjct: 181 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 240

Query: 237 ADKGDMIASYHD-----AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
            D      ++H      A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  P
Sbjct: 241 LD------THHAHAKAIALEANKLAPDLVPAAVVAARALFADGEIRKGSKILEAAWKRFP 294

Query: 292 HPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           HP+IA+ Y +  S +    +LKRA  L  +   + E  + +++ A E G    A   A  
Sbjct: 295 HPDIASTYIYARSGDAAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQ 354

Query: 351 AMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSP 410
            ++ APR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP
Sbjct: 355 VLRAAPRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSP 413

Query: 411 ISKTLCYFEWKIP 423
           ++  L  FEWK+P
Sbjct: 414 VTGRLNSFEWKVP 426


>gi|294851122|ref|ZP_06791795.1| HemY protein [Brucella sp. NVSL 07-0026]
 gi|294819711|gb|EFG36710.1| HemY protein [Brucella sp. NVSL 07-0026]
          Length = 480

 Score =  181 bits (460), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 128/434 (29%), Positives = 225/434 (51%), Gaps = 17/434 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 3   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 62

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 63  LVKSLVQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 122

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 123 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 182

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK---NAKE-WNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++   + K+   + RA LL A+++  
Sbjct: 183 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 242

Query: 237 ADKGDMIASYHD-----AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
            D      ++H      A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  P
Sbjct: 243 LD------THHAHAKAIALEANKLAPDLVPAAVVAARALFADGEIRKGSKILEAAWKRFP 296

Query: 292 HPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           HP+IA+ Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A  
Sbjct: 297 HPDIASTYIYARSGDTAQDRLKRARHLVLLRSNNAEGSLALARAAYEAGEYSVARDNAEQ 356

Query: 351 AMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSP 410
            ++ APR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP
Sbjct: 357 VLRAAPRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSP 415

Query: 411 ISKTLCYFEWKIPT 424
           ++  L  FEWK+P 
Sbjct: 416 VTGRLNSFEWKVPV 429


>gi|121602299|ref|YP_988402.1| hypothetical protein BARBAKC583_0064 [Bartonella bacilliformis
           KC583]
 gi|120614476|gb|ABM45077.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 531

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 127/433 (29%), Positives = 217/433 (50%), Gaps = 10/433 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++ Y F + ++   F  V+++   V IT+    +  S   +LS+    L    L++ 
Sbjct: 1   MIRVVVYSFAVCVLGALFGWVANHNSIVVITFLQTRFAISLLTLLSVSIVLLVMLALVWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R     P  L      R   KG +AL  GL+++ + +   A+KM +   +    ++E 
Sbjct: 61  LLRGLFFAPNALRRYFSTRRQKKGREALSQGLLAVFSGDYVTAKKMETCALKYLANNHEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LL+ Q    ++    A    E M Q   T+   +Y LY E+  + +  +AQ YA +A
Sbjct: 121 LMKLLQAQTLFLQKDSIRAIGFYEEMRQETPTKLAGLYGLYREAVAMKEDEAAQHYAEEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK---NAKEWNRNR----AILLIARS 233
           L +SP   W  +AV+ +     +W +A+    + +K    A  W   R    A+LL  ++
Sbjct: 181 LALSPALLWAHQAVIDRLSAEGQWDKALDVFEKAQKALPRADRWTAERNYTYALLLSGQA 240

Query: 234 LENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHP 293
           L+   K   + +    +++ KL  + +  ++  A  L   N+ RKA+ I+   WK  PHP
Sbjct: 241 LQ-LFKTHPVKARTAILKAHKLLPDFVPITVITADILYKSNEVRKADKIIFNAWKKEPHP 299

Query: 294 EIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMK 353
           ++   Y     E  V +LK+A +L   N+++ ES  +V+K AL+ G ++ A  +A  A++
Sbjct: 300 DLGACYLK-NEERAVERLKKAKKLASYNEDTFESAFLVAKAALDAGEVEFAREQAQKALQ 358

Query: 354 IAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISK 413
           + PR+ ++LLLA IE+A  ++   +  W   AL A  DP W+  DG L S W  +SPIS 
Sbjct: 359 LHPRESVYLLLADIEEAQGNDQLLVRQWLSLALRAERDPTWMC-DGTLFSSWSAVSPISG 417

Query: 414 TLCYFEWKIPTKS 426
            L  FEWK P +S
Sbjct: 418 RLGCFEWKAPPRS 430


>gi|254504335|ref|ZP_05116486.1| HemY N-terminal domain protein [Labrenzia alexandrii DFL-11]
 gi|222440406|gb|EEE47085.1| HemY N-terminal domain protein [Labrenzia alexandrii DFL-11]
          Length = 660

 Score =  179 bits (455), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 114/430 (26%), Positives = 214/430 (49%), Gaps = 13/430 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++ +F ++ L    F  ++  P  +S++W   ++   P V+  ++   L A++++  
Sbjct: 11  MIRVLIFFAMLFLAALGFAWMADLPGTISVSWNGYVWEQPPVVVALVVGLVLVAFLVVIG 70

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V R  L  P +      +R  DKGY AL  GL+++   N  +AR+    +      + E 
Sbjct: 71  VIRAILKSPQIAGRFFKQRRKDKGYTALSQGLIALGTGNAKMARRYG--LDADKLLNEEP 128

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
              LL  Q A    +   A ++ E ML  P T+   ++ L+ E+ R  +  +A+ YA +A
Sbjct: 129 ATKLLLAQTAQLAGKDGEARQRFEAMLDDPNTKTLGLHGLFVEAERQREPVAARHYAEEA 188

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQ----KKKNAKEWNRNRAILL--IARSL 234
           +  +P   W  +AV+    +A  W  A+  L +    K  + K + R RA++L  +A  L
Sbjct: 189 VKAAPGLEWAGKAVLGYQAVAHHWDEALKTLERNYTSKLLDKKAYRRQRAVILTALAHKL 248

Query: 235 ENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPE 294
           E+    D   ++  A E+  L    + A++  ++    +   RKA  ++E  W+++PHPE
Sbjct: 249 ED---NDPDRAFSLAKEAHGLALELVPAAVITSRLATRRGDIRKASKVIEATWRLSPHPE 305

Query: 295 IANIYTHL-LSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMK 353
           +A  Y+H+   ++ V +LKRA  L      + E  + ++K ALE    ++A  +    ++
Sbjct: 306 LAETYSHVRTGDSAVDRLKRAKSLAAQRANTAEGAIAIAKAALEAREFEEARTQLKKVLQ 365

Query: 354 IAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISK 413
             P +  F+L+A++E+  + +  ++  W   A+ A  D  WI+ DG +SS W  +SP++ 
Sbjct: 366 SEPTRAAFILMAEVEETETGDKGRVRDWLARAVKASLDKAWIA-DGVVSSEWQAVSPVTG 424

Query: 414 TLCYFEWKIP 423
            L  F+W  P
Sbjct: 425 KLDAFQWSSP 434


>gi|299133147|ref|ZP_07026342.1| HemY domain protein [Afipia sp. 1NLS2]
 gi|298593284|gb|EFI53484.1| HemY domain protein [Afipia sp. 1NLS2]
          Length = 545

 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 133/527 (25%), Positives = 250/527 (47%), Gaps = 45/527 (8%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R+  +  ++++       V+     V ++W      TS  V+  +    + A IL++ 
Sbjct: 1   MVRIFSFLILLTVAALGATWVADQSGGVVLSWNGWRAETSLPVLALLALILVIAAILVWT 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R F   PA L    H++   K   A+  GL+++   +  LA + H+  +++   H+  
Sbjct: 61  IVRAFWKTPARLRRYRHEKREAKARHAITQGLIAVGTGDSSLAHR-HAGTAKRLAEHDP- 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL+ Q A  E     A      M +    R   +  L+ E+ R  DL++A   A +A
Sbjct: 119 LTLLLQAQTAQLEGDRPGAQHAFHAMAERQDMRLLGLRGLFIEAQRNDDLHTAVAMAEEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKK-----KNAKEWNRNRAILLIARSLE 235
           L I+P +PW + AV+       +W  A+  L+        +NA  + R R +LL AR+LE
Sbjct: 179 LKIAPSSPWASHAVLGFRCAQSDWDGALALLDSNYSASLIENAP-YRRQRGVLLTARALE 237

Query: 236 NADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEI 295
             ++ D   S   A+E++K     + A++ AAK     N+ R+A   +E  W  NPHP++
Sbjct: 238 LEER-DRDLSRKSAMEAIKFAPQLVPAAVLAAKFYSEDNQVRRAMRTIEVAWNANPHPDL 296

Query: 296 ANIYTHL-LSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKI 354
           A+ Y H+ L ++   +L R   L +   +  ES + +++ A+E     +A  +A+  +  
Sbjct: 297 ADAYAHVRLGDSARERLARVELLAQKAPDHRESRLAIARAAIEASEFGRAR-EALAPLLT 355

Query: 355 APRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKT 414
              + + LL+A++E+A +H+  +   WT  A+ A PDP W + DGY+S  W P+SP++  
Sbjct: 356 TMTQRVALLMAELERAGNHDEGRAREWTARAVRAAPDPAWTA-DGYVSDRWRPVSPVTGR 414

Query: 415 LCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHL------PSIKKV-- 466
           L  F+W  P  +   ++S++++ + E ++  + L    +   ++ +      P+++K   
Sbjct: 415 LDAFQWVTPVAA---LTSDHVDVAAEASHLPEKLPEPASVAIESKVAPAEPEPAVEKAPV 471

Query: 467 ----SSFEDSTIHP------------------LDPHIRQPDDPGIKE 491
               +  +   + P                  + P +R PDDPG+ E
Sbjct: 472 EAAPAPVKTDNVAPPVFRARPAGEARSPAPSAIIPLVRAPDDPGVPE 518


>gi|49474780|ref|YP_032822.1| hypothetical protein BQ12990 [Bartonella quintana str. Toulouse]
 gi|49240284|emb|CAF26758.1| hypothetical protein BQ12990 [Bartonella quintana str. Toulouse]
          Length = 518

 Score =  176 bits (446), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 144/514 (28%), Positives = 243/514 (47%), Gaps = 32/514 (6%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R++ Y FV+ ++  +F  V+++ + + IT+ +  +  S   +LS+L  FL   + L+ 
Sbjct: 1   MTRVLIYTFVVCMLGLAFGWVANHNDVLIITFLHFRFSISLLTLLSVLILFLGILVFLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +     S P  L +  +KR    GY+AL  G+++  A +   A+KM + V +     +E 
Sbjct: 61  LLSVLFSLPGTLSNYFYKRGQKLGYEALSQGVLAAFAGDGVAAKKMEARVVKYLAGKHEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           LV LL+ Q    +     A    E M +   T+   +Y L+ E+ +     +AQ+YA +A
Sbjct: 121 LVKLLQAQALSLQNNSARAISLYEEMRKETPTKLAGLYGLFREAMKANAYEAAQQYAQEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK-------NAKEWNRNRAILLIARS 233
           L +SP   W  + V+ +      W +A+    + +K       +  E    +A+LL  ++
Sbjct: 181 LALSPALLWAYQLVLDRLSAQGRWDKALDVFERAQKVLPRSVRSTPERQHVQALLLSGQA 240

Query: 234 L-----ENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWK 288
           L        D   +I   H      +L  + +  ++ AA  L   N+ RKA+ ++   W+
Sbjct: 241 LHLFRTHPTDARKVILKAH------RLVPDFVPITVIAADILYKLNETRKADKMIIAAWQ 294

Query: 289 VNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            NPHP +  +Y     E  VG+LK+A  L   +K++ ES  +V+K AL+ G    A  +A
Sbjct: 295 KNPHPNLGALYLE-REEGAVGRLKKAKALASYSKDTFESAFLVAKAALDAGERVLAREQA 353

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPL 408
             A++   R+ ++LLLA IE+A  +N   +  W   AL A  DP+W+  DG + S WLP+
Sbjct: 354 QKALQYHRRESVYLLLADIEEAQGNNQAAVRQWLSLALRAERDPVWMC-DGTIFSSWLPV 412

Query: 409 SPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSS 468
           SPIS  L  FEWK P   P      +    L      D    M  N  ++ L  + +  +
Sbjct: 413 SPISGRLGRFEWKAPPSPPPLTLETDNTIVLTKKSQEDKNDIMGKNVVEDKL--LNEFPA 470

Query: 469 FEDSTIHPLDPH---IRQP-------DDPGIKEQ 492
            ++  +H    +    RQ        DDPGIK +
Sbjct: 471 VKNDLLHSAQTNKQGARQSSKTRLNVDDPGIKTE 504


>gi|218515793|ref|ZP_03512633.1| hypothetical conserved membrane protein [Rhizobium etli 8C-3]
          Length = 364

 Score =  176 bits (446), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 102/257 (39%), Positives = 154/257 (59%), Gaps = 7/257 (2%)

Query: 172 SAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAI 227
           +A++YA KA D +P  PW  +A ++    A  W  AI  L Q+K        E NR  A+
Sbjct: 1   AARQYAEKAADNAPYLPWAAQATLEYRSQAGHWDDAIRLLEQQKAARVVEKAEANRLHAV 60

Query: 228 LLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIW 287
           LL AR+ E  + G+   +  DA+++LKL  + + A++ AAK+L  +   RKA  ILE+ W
Sbjct: 61  LLTARAAEKLE-GNPAGARDDALQALKLAADFVPAALIAAKALFREGGLRKAASILEQAW 119

Query: 288 KVNPHPEIANIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHA 346
           K  PHPE+   Y    S ++T+ +LKRA RLE +   +VESL++V++ AL+     +A A
Sbjct: 120 KSAPHPEVGQTYVRARSGDSTLDRLKRAERLEALRPNNVESLLVVAQAALDAQEFAKARA 179

Query: 347 KAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWL 406
           KA  A +I PR+  FLLLA IE+A + +  ++ +W   AL A  DP W++ DG++S  WL
Sbjct: 180 KAEAAARIEPREAAFLLLADIEEAETGDQGRVRHWLAQALKAPRDPAWVA-DGFVSDKWL 238

Query: 407 PLSPISKTLCYFEWKIP 423
           P+SP++  +  FEWK P
Sbjct: 239 PVSPVTGRIDAFEWKAP 255


>gi|239833008|ref|ZP_04681337.1| HemY domain-containing protein [Ochrobactrum intermedium LMG 3301]
 gi|239825275|gb|EEQ96843.1| HemY domain-containing protein [Ochrobactrum intermedium LMG 3301]
          Length = 480

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 127/443 (28%), Positives = 220/443 (49%), Gaps = 9/443 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++ +T+    Y       ++ +   + A ++L+ 
Sbjct: 1   MLRVLFYLVIVAALGFGFAWLADRPGELDVTFAGNHYNVPLITAVAGIVAIVAAILILWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L      R  D+GY++L TGL++  A +   AR+M     Q  +   E 
Sbjct: 61  LVKSIIQSPYTLRRHFRARKRDRGYQSLSTGLIAAGAGDAEAARRMTKQAGQLLSSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M+  P TR   +  LY E+ R+G  ++A+ YA +A
Sbjct: 121 LIKLLEAQTAMLEGRTEDARKGFEAMVDDPETRLLGLRGLYIEAQRVGAHDAARHYAAEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK---NAKE-WNRNRAILLIARSLEN 236
              +P   W + AV+ Q+    +W  A+  ++ +K+   ++K+   + RA LL A+++  
Sbjct: 181 AAQAPQLEWASSAVMGQFCAEGDWDAALKLVDARKQALSHSKDVVKKERAALLTAKAMAV 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D  D   +   A+E+ KL  + + A++ AA++L S    RK   ILE  WK  PHP+IA
Sbjct: 241 VDV-DHAQARTLALEANKLAPDLVPAAVVAARALFSDGDIRKGSKILEAAWKRFPHPDIA 299

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A   ++ +
Sbjct: 300 STYVYARSGDTAQDRLKRAKHLVSLRSNNAEGSLALARAAYEAGDYRLARDNAEQVLRAS 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+S  W P     +T 
Sbjct: 360 PRESAYLLLADIEEAETGDQGKVREWLARAVKAPRDPAWTA-DGYVSEQWSPGIAGYRTA 418

Query: 416 CYF--EWKIPTKSPEYISSENIN 436
             F  E       P +   E  N
Sbjct: 419 EQFRVEGSCGGTGPSHRGGEARN 441


>gi|209883479|ref|YP_002287336.1| HemY protein [Oligotropha carboxidovorans OM5]
 gi|209871675|gb|ACI91471.1| HemY protein [Oligotropha carboxidovorans OM5]
          Length = 572

 Score =  172 bits (436), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 118/420 (28%), Positives = 210/420 (50%), Gaps = 15/420 (3%)

Query: 30  ITWGNRLYRTSPFVILSILYFFLFA-WILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKAL 88
           ++W      TS   + ++L   L A  +++++V R F   P  L     ++   K  +A+
Sbjct: 30  LSWSGWRIETS-LPVAALLGVILLAVALVVWSVVRTFWKAPEGLRRRRREKRAAKARRAI 88

Query: 89  YTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQ 148
             GL+++   +   A + H+ ++ +   H+  L  +L+ Q A  E     A      M +
Sbjct: 89  TQGLIAVGTGDS-FAAQRHAGMATRLAAHDP-LALMLQAQTAQLEGDRAGAQRAFRAMAE 146

Query: 149 IPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAI 208
               R   +  L+ E+ R  D  +A   A +AL I+P +PW ++AV+       +W  A+
Sbjct: 147 RKDMRLLGLRGLFIEAQRSDDAYTAVAMAEEALKIAPASPWASQAVLGFRCAGSDWDGAL 206

Query: 209 TFLNQKKKNA----KEWNRNRAILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASI 264
             L+  K         + R R +LL AR+L   ++ D  AS   A+E++KL    + A++
Sbjct: 207 ALLDTNKAAGLVEPAVYRRERGVLLTARALALEER-DRDASRKSAMEAVKLAPQLVPAAV 265

Query: 265 CAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHL-LSENTVGKLKRALRLEEINKE 323
            AAK     N+ R+A  ++E  W  NPHP++A+ Y H+ L ++   +L R   L +   +
Sbjct: 266 LAAKFYSEDNQVRRAMRVVEAAWVANPHPDLADAYAHVRLGDSARERLSRVEMLAQKTPD 325

Query: 324 SVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQ 383
             E  + V++ A++ G  ++A  +A+  +  AP + + LL+A++E+AN H+  +   WT 
Sbjct: 326 HREGRLAVARAAIDAGEFERAR-EALAPLIDAPTQRVALLMAELERAN-HDEGRAREWTA 383

Query: 384 SALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEWKIPTK--SPEYISSENINFSLEM 441
            A+ A PDP W + DGY+S  W P+SP++  L  F+W  P    +PE  + E    +L M
Sbjct: 384 RAVRAAPDPAWTA-DGYVSDRWRPVSPVTGRLDAFQWVTPVAALAPERATIEAETPTLPM 442


>gi|319409418|emb|CBI83064.1| conserved exported hypothetical protein [Bartonella schoenbuchensis
           R1]
          Length = 510

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 126/444 (28%), Positives = 215/444 (48%), Gaps = 16/444 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFL-FAWILLF 59
           M+R+  Y FV+ ++  +F  V+ +   V+IT+ +     S    LS    FL   W LL+
Sbjct: 1   MIRVFIYIFVVCVLGAAFGWVASHNSVVTITFMHTRLSISLLAFLSTFIVFLGILWGLLY 60

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
            V       P   ++  + R   +G +AL  GL++    +   A+KM +   +    + E
Sbjct: 61  VVC----FAPGAFYNYFYTRRQRRGREALSQGLLAAFIGDHLTAQKMETRALKYLEENCE 116

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATK 179
            L+ LL+ Q  + ++    A    E M Q  +T+   +Y L+ E+       +AQ YA +
Sbjct: 117 PLIKLLQAQTLVLQKDSIRAIHLYEEMRQKKSTKLAGLYGLFREAMDTKTYEAAQHYAQE 176

Query: 180 ALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN-------AKEWNRNRAILLIAR 232
           A  +SP   W  +AV+ +     +W  A+    + +K          E N   A+LL  +
Sbjct: 177 AFTLSPSLVWAHQAVLDRLSAEGQWDEALDVFEKVQKALPRSARLTAERNHTHALLLSGK 236

Query: 233 SLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPH 292
           +L +  K   + +    +++ KL  +    ++  A  L   N+ RKA+ I+ + WK +PH
Sbjct: 237 AL-HVFKIHPVKARSAILKAHKLVPDFGPITVITAGILYKLNETRKADKIIIEAWKKDPH 295

Query: 293 PEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAM 352
           P+   +Y     E  VG+LK+A +L   NK + ES  +++K AL+ G +  A  +A  A+
Sbjct: 296 PDFGALYLGR-EERAVGRLKKAKKLASYNKNTFESAFLIAKAALDAGELTLAREQAKKAL 354

Query: 353 KIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPIS 412
              PR+ ++LLLA IE+   ++   +  W   A +A  DP WI D+   SS W  +SPIS
Sbjct: 355 NYHPRESVYLLLADIEEVQGNDQGLVHQWLSLARNAERDPTWICDNTLFSS-WSAVSPIS 413

Query: 413 KTLCYFEWKIPTKS-PEYISSENI 435
             L  FEWK P +  P  + +++I
Sbjct: 414 GRLGCFEWKAPPRRFPLTLEADDI 437


>gi|254473094|ref|ZP_05086492.1| hypothetical protein PJE062_2166 [Pseudovibrio sp. JE062]
 gi|211957815|gb|EEA93017.1| hypothetical protein PJE062_2166 [Pseudovibrio sp. JE062]
          Length = 613

 Score =  169 bits (428), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 113/432 (26%), Positives = 209/432 (48%), Gaps = 16/432 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++ +F  + L+      ++  P  V++ W   + + S    +      + A I+++ 
Sbjct: 1   MVRVLIFFAFVFLLALGGAWMADRPGVVTLEWQGYVVQASLLTTVVAFGASIVASIVVWG 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
             R     P ++ H + +R  DKGY AL  GLM++ + +   ARK     + +    +E 
Sbjct: 61  FFRLIWKSPTLVSHFMQRRRKDKGYDALSQGLMALGSGDTLHARKF-GLKADKLLDGDEP 119

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
              LL  Q +  +  +  +  + E ML+   +    ++ LY E+ R  +  +A+ +A +A
Sbjct: 120 AARLLLAQASQLDGDHAESRRRFEAMLEDDRSMAVGLHGLYIEAERESEPAAARHFAEEA 179

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQ----KKKNAKEWNRNRAILLIARSLE- 235
            ++ P   W   AV+    ++ +W  AI  L +    +  + K   R +A+LL AR+LE 
Sbjct: 180 FNLVPGLRWAGNAVLGYQAVSGDWEEAIATLERNYAARMLDKKTLRRQKAVLLTARALEL 239

Query: 236 ---NADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPH 292
              N D+   +A     +E+  L  + + A+I AA+      + RKA  ILE  WK++PH
Sbjct: 240 ENENPDRARTLA-----VEAHGLAPSLVPAAIVAARLRTRAGEIRKASKILEATWKLSPH 294

Query: 293 PEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLA 351
           P++A  Y H+   ++V  +L R   L  +   S E  + ++  A+E    D+A  +    
Sbjct: 295 PDLAEAYAHVRPGDSVTDRLSRVRTLASMRAYSSEGAIAIAVAAIEAKKFDEAREQLKRV 354

Query: 352 MKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPI 411
           ++  P +  FLL+A +E+    +  +I  W   A+ A  D +WI+ DG +S+ W P+SP 
Sbjct: 355 LRSEPTQRAFLLMADLEEREHGDQGRIREWLSRAVRAPHDKVWIA-DGVVSANWAPVSPK 413

Query: 412 SKTLCYFEWKIP 423
           +  +  +EW  P
Sbjct: 414 TGRVDAYEWATP 425


>gi|49476261|ref|YP_034302.1| hypothetical protein BH16090 [Bartonella henselae str. Houston-1]
 gi|49239069|emb|CAF28372.1| hypothetical protein BH16090 [Bartonella henselae str. Houston-1]
          Length = 517

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 130/434 (29%), Positives = 220/434 (50%), Gaps = 10/434 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++ Y FV+ L   +F  V++Y + + IT+ +  +  S    LS+L  FL    LL+ 
Sbjct: 1   MIRILIYTFVVCLFGLAFEWVANYNDVLVITFSHFRFSVSLLTALSLLILFLGILALLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +     S P +L +  +KR    GY+AL  G +++ A +  +A+KM + V +    + E 
Sbjct: 61  LFSILFSVPHILSNYFYKRRQKHGYEALSQGFLAVFAGDAIVAQKMQTRVEKYLAGNREP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL+ Q    +     A    E M +   T+   +Y L+ E+ +     +AQ+YA +A
Sbjct: 121 LAKLLQAQTLSLQNNSARAIGLYEQMRKEKQTKLAGLYGLFREAMKTNAYEAAQQYAQEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN-------AKEWNRNRAILLIARS 233
             +SP   W  +AV+ +      W +A+    Q +K        A E    +A+LL  ++
Sbjct: 181 QALSPALLWAHQAVLDRLSAEGSWDKALDVFEQAQKALPRSVRLAPERQHLQALLLSGQA 240

Query: 234 LENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHP 293
           L +  +   + +    +++ KL  + I  ++ AA  L   N+ RKA+ ++   W+  PHP
Sbjct: 241 L-HLLRTHPVDACKAILKAHKLVPDFIPITVIAADILYKLNETRKADKMIVAAWQKEPHP 299

Query: 294 EIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMK 353
           ++  +Y     E  VG+LK+A  L   NK++ ES  +++K AL+ G    A  +A  A++
Sbjct: 300 DLGALYLE-REEGAVGRLKKAKTLASYNKDTFESTFLIAKAALDAGERVLAREQAQKALQ 358

Query: 354 IAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISK 413
              R+ ++LLLA IE+A  +N   +  W   AL A  DP+W+  DG + S W  +SPIS 
Sbjct: 359 YHKRESVYLLLADIEEAQGNNQAAVRQWLSLALRAERDPVWMC-DGTIFSSWAVISPISG 417

Query: 414 TLCYFEWKIPTKSP 427
            L  FEWK P + P
Sbjct: 418 RLGCFEWKAPPRMP 431


>gi|319404858|emb|CBI78459.1| conserved exported hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 514

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 134/461 (29%), Positives = 213/461 (46%), Gaps = 10/461 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R+  Y FV+ ++   F   ++    + IT+    +  S   I+S +   L   + L+ 
Sbjct: 1   MIRIFIYIFVVCVIGAVFSWGANNNSFLVITFLQMRFTVSLLTIISGIVILLMVLVFLWK 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
             R   S P  L+     R  + G KAL  GL++  A +   A+KM     +      E 
Sbjct: 61  FFRIIFSIPRTLYSFFSGRYQECGRKALTQGLLAAFAGDYAAAQKMERRALKYFIKDYEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LL  QI   ++    A    E M +  +T+   +Y L+ E+      + AQ YA +A
Sbjct: 121 LIKLLRAQILSLQKNSMKAIALYEEMQKDESTKLAGLYGLFREAMNTKAYDVAQHYAEEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKE-----WNRNRAILLIARSLE 235
           LD+SP   W  + V+ +     +W++A+    + ++           R     L+   L 
Sbjct: 181 LDLSPALLWAQQFVLDRLSAEGQWNKALDVFYRAQRALPRSEHCTSERKYTHALLLSGLA 240

Query: 236 NADKGDMIASYHDAI-ESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPE 294
                  +A    AI ++ KL  + +  ++     L    + RKA+ I+ K W+ NPHP+
Sbjct: 241 LHLTETQLAGARKAILKAHKLMPDFVPITVLMVDILYQLKEVRKADKIIIKAWQENPHPD 300

Query: 295 IANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKI 354
           +  +Y     E+ VG+LKRA  L   NKE  ES  IV+K AL+ G ++ A   A  A+  
Sbjct: 301 LGALYLR-REESAVGRLKRAKTLAFYNKEIFESAFIVAKAALDAGELELAREYAQKALTY 359

Query: 355 APRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKT 414
            PR+ ++LLLA IE+A   N      W   AL A PDP W  D  + SS WL +SPIS  
Sbjct: 360 HPRESVYLLLADIEEAKG-NGQGSRQWLSLALRAEPDPAWACDGSFFSS-WLIVSPISGR 417

Query: 415 LCYFEWKIPTK-SPEYISSENINFSLEMAYPADDLQSMLNN 454
           L   EWK+P + SP  +  +N+    E      D + ++ N
Sbjct: 418 LGRCEWKVPPRCSPITLEVDNVMLKRECKKGVVDEKGVIKN 458


>gi|319899462|ref|YP_004159559.1| hypothetical protein BARCL_1326 [Bartonella clarridgeiae 73]
 gi|319403430|emb|CBI76998.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 514

 Score =  167 bits (422), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 128/443 (28%), Positives = 209/443 (47%), Gaps = 12/443 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R+  Y FV+ ++   F   ++    + IT+    +  S   I+S L   L   + L+ 
Sbjct: 1   MIRIFIYVFVVCVIGAVFSWCANNNSFLVITFLQMRFTVSLLTIVSGLVILLAILVFLWK 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
             R   S P  L+    +    +G KAL  GL++  A +   A+KM     +      E 
Sbjct: 61  FFRIIFSIPRSLYSFFSRHYQKQGGKALTQGLLAAFAGDYMTAQKMEVRALRYLVKDYEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LL  QI   ++    A    E M +   T+    Y L+ E+      + AQ YA +A
Sbjct: 121 LIKLLRAQILFLQKDSMNAIVLYEEMKKEELTKLAGFYGLFREAINTKAYDIAQHYAEEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN-------AKEWNRNRAILLIARS 233
           L +SP   W  + V+ +     +W++A+   ++ ++          E     A+LL   +
Sbjct: 181 LALSPTLLWAQQFVLDRLSAEGKWNKALDVFHRAQRALPRSEHCTPERKYIHALLLSGLA 240

Query: 234 LENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHP 293
           L   +   ++ +    +++ KL  + +  ++  A  L    + RKA+ I+ K W+ NPHP
Sbjct: 241 LHFVET-QLVEARKAILKAHKLMPDFVPITVIMADILYKLKEVRKADKIIIKAWQENPHP 299

Query: 294 EIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMK 353
           +   +Y     E+ VG+LKRA +L   NK+  ES  IV+K AL+ G ++ A   A  A+ 
Sbjct: 300 DFGTLYLR-REESAVGRLKRAKKLASYNKDIFESSFIVAKAALDAGELELARECAQKALT 358

Query: 354 IAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISK 413
             PR+ ++LLLA IE+A   N      W   AL A  DP W  D  + SS W  +SPIS 
Sbjct: 359 YHPREGVYLLLADIEEAQG-NDQGSRQWLSLALRAERDPAWACDGSFFSS-WSAVSPISG 416

Query: 414 TLCYFEWKIPTK-SPEYISSENI 435
            L  FEWK+P + SP  +  +N+
Sbjct: 417 RLGRFEWKVPPRCSPITLEVDNM 439


>gi|91974947|ref|YP_567606.1| HemY-like [Rhodopseudomonas palustris BisB5]
 gi|91681403|gb|ABE37705.1| HemY-like [Rhodopseudomonas palustris BisB5]
          Length = 588

 Score =  167 bits (422), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 118/432 (27%), Positives = 211/432 (48%), Gaps = 18/432 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGN-RLYRTSPFVILSI---LYFFLFAWI 56
           MLR+I +  +I+L       V+  P DV ++W + R     P  +L +   +   + AW 
Sbjct: 1   MLRIILFLVIIALAAAGAAWVAEQPGDVVLSWNDWRAEMRLPVFVLGLGAAIVSIVLAWA 60

Query: 57  LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTF 116
           ++  + R     P+ +     +R   +   A+  GL+++  H    A + H+  +++H  
Sbjct: 61  IITGLWR----APSRMKRGRFERRSGRARHAITQGLLAVG-HGDAAAARNHASAARRHAP 115

Query: 117 HNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRY 176
           H+  L  LL+ Q A  E   + A      M     T+   +  LY E+ R  D   A   
Sbjct: 116 HDP-LALLLQAQSAQLEGDRDGARRAFLAMAGRDDTKSLGMRGLYIEAQRADDPYGALAI 174

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAI----TFLNQKKKNAKEWNRNRAILLIAR 232
           A +AL + P++ W ++AV+       +WS A+    T L+    + K + R RA+LL AR
Sbjct: 175 AEEALRLQPNSTWASQAVLGFRCARADWSGALDILETNLSSGLVDKKVFRRQRAVLLTAR 234

Query: 233 SLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPH 292
           +++  D  + +A    A+E+ KL    I A++ AAK L   ++ R+A  ++E  W+  PH
Sbjct: 235 AIDLEDSDESLA-RDSALEANKLAPTLIPAAVLAAKCLAETHQVRRAMKVIEAAWQAQPH 293

Query: 293 PEIANIYTHLLSENTVG-KLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLA 351
           P++A  Y ++   +    +L R   L   N    ES + +++  ++ G   +A  +A+  
Sbjct: 294 PDLAAAYANIKPGDPANIRLARVQNLIAKNPADFESALAIARAGIDAGEFSRAR-RALQP 352

Query: 352 MKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPI 411
               P + + +L+A+IE     +T K   WT  A+ A+PD +W + DGY S  W P+SP+
Sbjct: 353 FIDNPTQRVAMLMAEIEHGERGDTAKARAWTLRAVRALPDAMWTA-DGYTSDHWRPVSPV 411

Query: 412 SKTLCYFEWKIP 423
           +  L  F+W++P
Sbjct: 412 TGRLDAFQWQVP 423


>gi|27375675|ref|NP_767204.1| hypothetical protein bll0564 [Bradyrhizobium japonicum USDA 110]
 gi|27348813|dbj|BAC45829.1| bll0564 [Bradyrhizobium japonicum USDA 110]
          Length = 580

 Score =  166 bits (421), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 126/437 (28%), Positives = 215/437 (49%), Gaps = 18/437 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGN-RLYRTSP-FVILSILYFFLFAWILL 58
           MLR++ +  +I+L       V+  P D+ +T G  R   T P FV L  L  F  A +L+
Sbjct: 1   MLRIVLFLVLIALAAAGAAWVADQPGDLVLTAGGFRASTTLPRFVFL--LGLFAAAVVLV 58

Query: 59  FAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHN 118
           +++       P  L    H++ + +G  A+  GL++I   +  LAR+ H+  +++H   N
Sbjct: 59  WSILTTIWRTPGRLRRRSHEKRHARGRHAITHGLLAIGHGDTALARR-HAETARRHA-PN 116

Query: 119 EYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYAT 178
           + L  LL  Q A  E   + A      M +   TR   +  L+ E+ R  D   A   A 
Sbjct: 117 DPLALLLHAQSAQLEGNRDEAQRAFRAMAEREDTRLLGLRGLFIEAQRADDAVGAVMIAE 176

Query: 179 KALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSL 234
           +A+ +SP + W + AV+       +WS A+  L+        +   + R R +LL AR+L
Sbjct: 177 EAIKLSPSSTWASHAVLGFRCARGDWSGALAILDSNLSAGLIDKPAYRRQRGVLLTARAL 236

Query: 235 ENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPE 294
           E     D   +    +E++KL    + A++ AAK     ++ R+A  ++E  W  NPHP+
Sbjct: 237 E-LQTMDRDVARESVMEAIKLAPTLVPAAVLAAKFESEAHQVRRAMKLVEAAWLANPHPD 295

Query: 295 IANIYTHL-LSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQ---AHAKAML 350
           +A  Y H+ L ++   +L+R   L      + ++  I  ++AL   +ID    + A+A+L
Sbjct: 296 LAEAYAHVKLGDSARQRLQRVETL-AAKTPADKAGHIEGQLALARAAIDASEFSRARAVL 354

Query: 351 AMKI-APRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLS 409
           A  +  P + + LL+A+IE+    +  +   WT  A+ A  DP W + DGY+S  W P+S
Sbjct: 355 APYVNDPTQRVALLMAEIERTEHGDGGRARAWTLRAVRARHDPAWTA-DGYVSDRWRPVS 413

Query: 410 PISKTLCYFEWKIPTKS 426
           P++  L  F+W+ P  S
Sbjct: 414 PVTGRLDAFQWQTPVAS 430


>gi|148251900|ref|YP_001236485.1| HemY domain-containing protein [Bradyrhizobium sp. BTAi1]
 gi|146404073|gb|ABQ32579.1| putative exported protein of unknown function with HemY domain
           (porphyrin biosynthesis) [Bradyrhizobium sp. BTAi1]
          Length = 641

 Score =  163 bits (413), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 116/434 (26%), Positives = 212/434 (48%), Gaps = 16/434 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGN-RLYRTSPFVILSILYFFLFAWILLF 59
           MLR++ +  ++ L       V+    DV + WG  R+  T P  +L+ L   + A +L++
Sbjct: 1   MLRIVVFLILVGLAAAGSAWVAEQTGDVVLNWGPWRIAMTLPVFVLA-LGLTITACVLVW 59

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
            +    L  P  + +    R + +G  A+  GL++I   ++  AR+ H+  +++    ++
Sbjct: 60  NLISALLRAPGRIRNHHRARRHQRGRHAITHGLLAIGHGDLTAARQ-HADAAKR-LAGDD 117

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATK 179
            L  LL  Q A      + A      M +   TR   +  L+ E+ R  D  +A   A +
Sbjct: 118 PLTLLLHAQAAQLGGDRDGAQRAFRAMAERHDTRLLGLRGLFIEAQRADDAYAAVMIADE 177

Query: 180 ALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARS-- 233
           AL ++P+A W + AV+       +W+ A+  L+        +   + R R +LL AR+  
Sbjct: 178 ALKLAPNATWASHAVLGFRCAQGDWNGALAILDSNYTAGMIDKPTYRRQRGVLLTARAIA 237

Query: 234 LENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHP 293
           LE  ++    AS   A+E++KL    I A++ AAK     ++ R+A  I+E  W   PHP
Sbjct: 238 LETENRDLARAS---AMEAVKLAPTLIPAAVLAAKFESEAHQVRRAMKIIEAAWTAGPHP 294

Query: 294 EIANIYTHL-LSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAM 352
           ++A+ Y H+ L ++   +L R   L    ++ +E  + +++ A++     +A A A+   
Sbjct: 295 DLADAYAHVRLGDSARQRLTRIENLAARTRDHIEGALAIARAAIDAAEFGRARA-ALAPF 353

Query: 353 KIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPIS 412
              P + + +L+A++E+    +  K   WT  A+ A  DP W + DGY+S  W P+SP++
Sbjct: 354 TDDPTQRVAMLMAELERTEHGDAGKSREWTLRAVRARHDPAWTA-DGYVSDHWRPISPVT 412

Query: 413 KTLCYFEWKIPTKS 426
             L  F+W+ P  S
Sbjct: 413 GRLDAFQWQTPVAS 426


>gi|319407818|emb|CBI81471.1| conserved exported hypothetical protein [Bartonella sp. 1-1C]
          Length = 514

 Score =  162 bits (411), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 133/461 (28%), Positives = 215/461 (46%), Gaps = 10/461 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R+  Y FV+ ++   F   ++    + IT+    +  S   I+S L   L   + L+ 
Sbjct: 1   MIRIFIYIFVVCVIGAIFSWGANNNSFLVITFLQMRFTVSLLTIISGLVILLMVLVFLWK 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
             R   S P  L+     R  + G KAL  GL++  A +   A+KM     +      E 
Sbjct: 61  FFRIIFSIPRTLYRFFSGRYQECGRKALTQGLLAAFAGDYAAAQKMERRALKYLIKDYEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LL  QI   ++    A    E M +   T+   +Y L+ E+      + A+ YA +A
Sbjct: 121 LIKLLRAQILSLQKNSMKAIALYEEMQKDEPTKLAGLYGLFREAMNTKAYDVAKHYAEEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK---NAKEWN--RNRAILLIARSLE 235
           L +SP   W  + V+ +     +W++A+    + ++    ++  N  RN    L+   L 
Sbjct: 181 LALSPALLWAQQFVLDRLSAEGQWNKALDVFYRAQRALPRSEHCNSERNYTHALLLSGLA 240

Query: 236 NADKGDMIASYHDAI-ESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPE 294
                  +A    AI ++ KL  + +  ++     L    + RKA+ ++ K W+ NPHP+
Sbjct: 241 LHLTETKLAEARKAILKAHKLMPDFVPITVIMIDILYQLKEVRKADKMIIKAWQENPHPD 300

Query: 295 IANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKI 354
           +  +Y     E+ VG+LKRA  L   NK+  ES  IV+K AL+ G ++ A   A  A+  
Sbjct: 301 LGALYLR-REESAVGRLKRAKALASYNKDIFESAFIVAKAALDAGELELAREYAQKALTY 359

Query: 355 APRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKT 414
            PR+ ++LLLA IE+A   N      W   AL A PDP W  D  + SS WL +SPIS  
Sbjct: 360 HPRESVYLLLADIEEAQG-NGQGNRQWLSLALRAEPDPAWACDGSFFSS-WLIVSPISGR 417

Query: 415 LCYFEWKIPTK-SPEYISSENINFSLEMAYPADDLQSMLNN 454
           L   EWK+P + SP  +  +N+    E      D + ++ N
Sbjct: 418 LGRCEWKVPPRCSPITLEVDNVMLKRECKKGVVDEKEVIKN 458


>gi|39933335|ref|NP_945611.1| HemY-like [Rhodopseudomonas palustris CGA009]
 gi|39652960|emb|CAE25702.1| unknown protein [Rhodopseudomonas palustris CGA009]
          Length = 565

 Score =  162 bits (410), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 135/548 (24%), Positives = 247/548 (45%), Gaps = 68/548 (12%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGN-RLYRTSP---FVILSILYFFLFAWI 56
           MLR++ +  +I+L       V+  P +V ++W + +   T P    VI + +   + AW 
Sbjct: 1   MLRIVLFLVIIALAAAGAAWVADQPGEVVLSWNDWKASMTLPVFALVIGAGVVAVMLAWA 60

Query: 57  LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTF 116
           ++  V R     P  +      R   +   A+  GL+++   +   AR +H+  +++H  
Sbjct: 61  IILGVVR----APGWMKRGRSSRRSARARNAITQGLLAVGHGDSSTAR-LHANAARRHAP 115

Query: 117 HNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRY 176
           H+  L  LL+ Q A  E     A      M     T+   +  LY E+ R  D  +A   
Sbjct: 116 HDP-LALLLQAQSAQLEGDREGARRAFLAMAARKDTKSLGMRGLYIEAQRADDPYAALAI 174

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIAR 232
           A +AL + P+  W ++AV+       +W+ A+  L +       + K + R RA+LL AR
Sbjct: 175 AEEALRVQPNCAWASQAVLGFRCARSDWTGALEILERNLSAGLIDKKAFRRQRAVLLTAR 234

Query: 233 SLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPH 292
           ++ + ++ D   +   A+E+ KL    + A++ AAK L   ++ R+A  ++E  W+  PH
Sbjct: 235 AI-DLEESDESLARDSALEANKLAPTLVPAAVLAAKYLAEAHQVRRAMKVIEAAWQAQPH 293

Query: 293 PEIANIYTHLLSENT-VGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHA--KAM 349
           P++A+ Y +L   +T   +L R   L     + +ES + +++ A++ GS  +A    +  
Sbjct: 294 PDLASTYANLKPGDTATARLGRVENLVGKGPQQLESALAIARAAIDAGSFSRARTVLQPY 353

Query: 350 LAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLS 409
           L M   P + + +L+A+IE  +  +T K   WT  A+ A+ DP+W + DGY+S  W P+S
Sbjct: 354 LDM---PTQRVAMLMAEIEHGDRGDTAKARAWTLRAVRALHDPVWTA-DGYVSDHWRPVS 409

Query: 410 PISKTLCYFEWKIPTKS--------------------------PEYISSENINFSLEMAY 443
           P++  L  F+W++P  +                          P   +SE +  ++E A 
Sbjct: 410 PVTGRLDAFQWQVPVSALPSSKAVVVDDKFHDALIASSAGETLPASTTSEAVTVTVEAAP 469

Query: 444 PA-----DDLQSMLNNGKKNHLPSIKKVSSF---------------EDSTIHPLDPHIRQ 483
            A      +  +++    K   P+    +                       P+ P +R 
Sbjct: 470 EAPIVAPKEPTAVVEEPAKADKPAKTTEAPAEAVAPPAASSSPLFHRRKEAAPVIPIVRA 529

Query: 484 PDDPGIKE 491
           PDDPG+ E
Sbjct: 530 PDDPGVDE 537


>gi|188579976|ref|YP_001923421.1| HemY domain protein [Methylobacterium populi BJ001]
 gi|179343474|gb|ACB78886.1| HemY domain protein [Methylobacterium populi BJ001]
          Length = 511

 Score =  162 bits (410), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 118/443 (26%), Positives = 218/443 (49%), Gaps = 23/443 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R + +  ++++     + ++ +P  V++ W      TS  + L+ +        L++A
Sbjct: 1   MWRALVFLALLAVAAYGAVWIADHPGTVTVVWNGYEIGTSLAIALTGVLVAAIILGLIWA 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +    +  PA +     +R  +KG  +L  G++++ + + PLA + H+    +    ++ 
Sbjct: 61  IVTGVIGLPASISRSTRERRRNKGLASLSRGMIAVGSGD-PLAARRHAG-DAERLLGSQP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL+ Q A      + A +  + M   P TR   +  L+ E+ R  D  +A+ YA +A
Sbjct: 119 LTLLLKAQAAQISGDRDAAEQAFKRMADDPETRVLGLRGLFVEARRREDEGAARAYAAEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQK------KKNAKEWNRNRAILLIARSL 234
             ++P   W  EAV++      EWS A   + ++       K+A    R RA+LL A + 
Sbjct: 179 ARLAPSVTWANEAVLEAQCADGEWSAATETVERRAALGLMDKHAA--RRQRAVLLTA-AA 235

Query: 235 ENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPE 294
           +  + G+   +   A++++KL  + + A++ A + L  +N  RKA  I+E  WK  PHPE
Sbjct: 236 QRHEAGEPETATEQALKAVKLAPDLVPAAVIAGRLLARRNDLRKAAKIIEAAWKATPHPE 295

Query: 295 IANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMK 353
           +  +Y +L + ++   +L RA  L +++    ES +++++ A E  S D A A+ +LA  
Sbjct: 296 LGKVYLNLRTGDSARDRLARAETLAKLSSWDPESRLVIAQAASE--SKDFARAREVLAPL 353

Query: 354 I--APRKEIFLLLAQIEQANSHNTD--KILYWTQSALHAMPDPLWISDDGYLSSVWLPLS 409
           +   P   +  ++A+IE A  H  D  +   W   A  A  DP W++ DG +S  W P+S
Sbjct: 354 VDDRPTSRVCRMMARIEAAE-HGADSGRSREWLARAARAPRDPAWVA-DGVVSERWAPVS 411

Query: 410 PISKTLCYFEWKIPTKSPEYISS 432
           P++  L  F WK P   PE ++ 
Sbjct: 412 PVTGRLDAFVWKTP---PEILAG 431


>gi|86747438|ref|YP_483934.1| HemY-like [Rhodopseudomonas palustris HaA2]
 gi|86570466|gb|ABD05023.1| HemY-like [Rhodopseudomonas palustris HaA2]
          Length = 583

 Score =  162 bits (410), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 128/434 (29%), Positives = 214/434 (49%), Gaps = 22/434 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGN-RLYRTSPFVILSILYFFLFAWILLF 59
           MLR+I +  +I+L       V+  P DV ++W   R     P  IL  L   + A  L++
Sbjct: 1   MLRIILFLVIIALAAAGAAWVAEQPGDVVLSWNAWRAEMRLPVFILG-LGGAIVAIGLVW 59

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
           A+       P  + H    R   K  +A+  GL+++  H    A + H+  +++H  H+ 
Sbjct: 60  AIIAALWRAPKRMKHGRAARRSGKANRAITQGLLAVG-HGDAAAARSHATAARRHAPHDP 118

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATK 179
             + L      L E   + A      M     T+   +  LY E+ R  D  +A   A +
Sbjct: 119 LALLLQAQAAQL-EGDRDGARRAFLAMAGRDDTKSLGMRGLYIEAQRANDPQAALAIAEE 177

Query: 180 ALDISPDAPWVTEAVVQQYVLAKEWSRAI----TFLNQKKKNAKEWNRNRAILLIARSLE 235
           AL + P+A W ++AV+       +W+ A+    T L+    + K + R RA+LL AR+L+
Sbjct: 178 ALRLQPNAAWASQAVLGFRCARADWTGALEILETNLSSGLVDKKAFRRQRAVLLTARALD 237

Query: 236 NADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEI 295
             D  D   S   A+E+ KL    + A++ AAK L   ++ R+A  +LE  W+  PHP++
Sbjct: 238 VEDS-DQSLSRDSALEANKLAPTLVPAAVLAAKCLAETHQVRRAMKVLETAWQAEPHPDL 296

Query: 296 ANIYTHLLSENTVGKLKRALRLEE-INKESV--ESLVIVSKIALEMGSIDQAHAKAMLAM 352
           A  Y H+   +      R  R+E  I K++   ES + +++ A++ G      +KA LA+
Sbjct: 297 AEAYAHIKPGDP--PATRLARIENLIGKKATDFESALALARAAIDAGEF----SKARLAL 350

Query: 353 KI---APRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLS 409
           +     P + + +L+A+IE     +T K   WT  A+ A+PDP+W + DGY+S  W P+S
Sbjct: 351 QPYLDNPTQRVAMLMAEIEHGERGDTAKARAWTLRAVRALPDPVWTA-DGYISDHWRPVS 409

Query: 410 PISKTLCYFEWKIP 423
           P+S  L  F+W++P
Sbjct: 410 PVSGRLDAFQWQVP 423


>gi|192288690|ref|YP_001989295.1| HemY domain protein [Rhodopseudomonas palustris TIE-1]
 gi|192282439|gb|ACE98819.1| HemY domain protein [Rhodopseudomonas palustris TIE-1]
          Length = 565

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 135/548 (24%), Positives = 248/548 (45%), Gaps = 68/548 (12%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGN-RLYRTSP---FVILSILYFFLFAWI 56
           MLR++ +  +I+L       V+  P +V ++W + +   T P    VI + +   + AW 
Sbjct: 1   MLRIVLFLVIIALAAAGAAWVADQPGEVVLSWNDWKASMTLPVFALVIGAGVVAVMLAWA 60

Query: 57  LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTF 116
           ++  V R     P+ +      R   +   A+  GL+++   +   AR +H+  +++H  
Sbjct: 61  IILGVVR----APSWMKRGRSSRRSARARNAITQGLLAVGHGDSGTAR-LHANAARRHAP 115

Query: 117 HNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRY 176
           H+  L  LL+ Q A  E     A      M     T+   +  LY E+ R  D  +A   
Sbjct: 116 HDP-LALLLQAQSAQLEGDREGARRAFLAMAARKDTKSLGMRGLYIEAQRADDPYAALAI 174

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIAR 232
           A +AL + P+  W ++AV+       +W+ A+  L +       + K + R RA+LL AR
Sbjct: 175 AEEALRVQPNCAWASQAVLGFRCARSDWTGALEILERNLSAGLIDKKAFRRQRAVLLTAR 234

Query: 233 SLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPH 292
           ++ + ++ D   +   A+E+ KL    + A++ AAK L   ++ R+A  ++E  W+  PH
Sbjct: 235 AI-DLEESDESLARDSALEANKLAPTLVPAAVLAAKYLAEAHQVRRAMKVIEAAWQAQPH 293

Query: 293 PEIANIYTHLLSENT-VGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHA--KAM 349
           P++A+ Y +L   +T   +L R   L     + +ES + +++ A++ GS  +A    +  
Sbjct: 294 PDLASTYANLKPGDTATARLGRVENLVGKGPQQLESALAIARAAIDAGSFSRARTVLQPY 353

Query: 350 LAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLS 409
           L M   P + + +L+A+IE  +  +T K   WT  A+ A+ DP+W + DGY+S  W P+S
Sbjct: 354 LDM---PTQRVAMLMAEIEHGDRGDTAKARAWTLRAVRALHDPVWTA-DGYVSDHWRPVS 409

Query: 410 PISKTLCYFEWKIPTKS--------------------------PEYISSENINFSLEMAY 443
           P++  L  F+W++P  +                          P   +SE +  ++E A 
Sbjct: 410 PVTGRLDAFQWQVPVSALPSSKAVVVDDKFHDALIASSAGETLPASTTSEAVTVTVEAAP 469

Query: 444 PA-----DDLQSMLNNGKKNHLPSIKKVSSF---------------EDSTIHPLDPHIRQ 483
            A      +  +++    K   P+    +                       P+ P +R 
Sbjct: 470 EAPIVAPKEPTAVVEEPAKADKPAKTTEAPAEAVAPPAASSSPLFHRRKEAAPVIPIVRA 529

Query: 484 PDDPGIKE 491
           PDDPG+ E
Sbjct: 530 PDDPGVDE 537


>gi|240137308|ref|YP_002961777.1| hypothetical protein MexAM1_META1p0562 [Methylobacterium extorquens
           AM1]
 gi|240007274|gb|ACS38500.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens AM1]
          Length = 511

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 115/455 (25%), Positives = 216/455 (47%), Gaps = 18/455 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R + +  ++++     + ++ +P  V++ W       S  + L+ +        L++A
Sbjct: 1   MWRALVFLALLAVAAYGAVWIADHPGTVTVVWNGYEIGMSLAIALTGVLVAAIVLGLIWA 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V    +  PA +     +R  +KG  +L  G++++ + + PLA + H+    +    ++ 
Sbjct: 61  VVTGVIGLPASISRSTRERRRNKGLASLSRGMIAVGSGD-PLAARRHAG-DAERLLGSQP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL+ Q A      + A +  + M   P TR   +  L+ E+ R  D  +A+ YA++A
Sbjct: 119 LTLLLKAQAAQISGDRDAAEQAFKRMADDPETRVLGLRGLFVEARRREDEGAARAYASEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLEN 236
             ++P   W  EAV++      EWS A   + ++      +     R RA+LL A + + 
Sbjct: 179 ARLAPSVTWANEAVLEAQCADGEWSAATETVERRAALGLMDKHAARRQRAVLLTA-AAQR 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            + G+  ++   A++++KL  + + A++ A + L  +N  RKA  I+E  WK  PHPE+A
Sbjct: 238 HEAGEPDSATEQALKAVKLAPDLVPAAVIAGRLLARRNDLRKAAKIIEAAWKATPHPELA 297

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
            +Y +L + ++   +L RA  L +++    ES +++++ A E     +A           
Sbjct: 298 KVYLNLRTGDSARDRLARAENLAKLSSWEPESRLVIAQAATEAKDFGRAREALAPLTDDR 357

Query: 356 PRKEIFLLLAQIEQA-NSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKT 414
           P   +  ++A+IE A +   + +   W   A  A  DP W++ DG +S  W P+SP+S  
Sbjct: 358 PTARVCRMMARIEAAEHGAESGRSREWLARAARAPRDPAWVA-DGIISERWAPVSPVSGR 416

Query: 415 LCYFEWKIPTKSPEYISSEN-----INFSLEMAYP 444
           L  F WK P   PE ++        +  S E A P
Sbjct: 417 LDAFVWKTP---PEILAGPEDDDAPVPASAEPAAP 448


>gi|254559413|ref|YP_003066508.1| hypothetical protein METDI0838 [Methylobacterium extorquens DM4]
 gi|254266691|emb|CAX22471.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens DM4]
          Length = 511

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 113/440 (25%), Positives = 212/440 (48%), Gaps = 17/440 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R + +  ++++     + ++ +P  V++ W       S  + L+ +        L++A
Sbjct: 1   MWRALVFLALLAVAAYGAVWIADHPGTVTVVWSGYEIGMSLAIALTGVLVAAIVLGLIWA 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V    +  PA +     +R  +KG  +L  G++++ + + PLA + H+    +    ++ 
Sbjct: 61  VVTGVIGLPASISRSTRERRRNKGLASLSRGMIAVGSGD-PLAARRHAG-DAERLLGSQP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL+ Q A      + A +  + M   P TR   +  L+ E+ R  D  +A+ YA++A
Sbjct: 119 LTLLLKAQAAQISGDRDAAEQAFKRMADDPETRVLGLRGLFVEARRREDEGAARAYASEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQK------KKNAKEWNRNRAILLIARSL 234
             ++P   W  EAV++      EWS A   + ++       K+A    R RA+LL A + 
Sbjct: 179 ARLAPSVTWANEAVLEAQCADGEWSAATETVERRAALGLMDKHAA--RRQRAVLLTA-AA 235

Query: 235 ENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPE 294
           +  + G+   +   A++++KL  + + A++ A + L  +N  RKA  I+E  WK  PHPE
Sbjct: 236 QRHEAGEPDTATEQALKAVKLAPDLVPAAVIAGRLLARRNDLRKAAKIIEAAWKATPHPE 295

Query: 295 IANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMK 353
           +A +Y +L + ++   +L RA  L +++    ES +++++ A E     +A         
Sbjct: 296 LAKVYLNLRTGDSARDRLARAENLAKLSSWEPESRLVIAQAATEAKDFGRAREALAPLTD 355

Query: 354 IAPRKEIFLLLAQIEQA-NSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPIS 412
             P   +  ++A+IE A +   + +   W   A  A  DP W++ DG +S  W P+SP+S
Sbjct: 356 DRPTARVCRMMARIEAAEHGAESGRSREWLARAARAPRDPAWVA-DGIISERWAPVSPVS 414

Query: 413 KTLCYFEWKIPTKSPEYISS 432
             L  F WK P   PE ++ 
Sbjct: 415 GRLDAFVWKTP---PEILAG 431


>gi|163850175|ref|YP_001638218.1| HemY domain-containing protein [Methylobacterium extorquens PA1]
 gi|163661780|gb|ABY29147.1| HemY domain protein [Methylobacterium extorquens PA1]
          Length = 511

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 114/446 (25%), Positives = 214/446 (47%), Gaps = 17/446 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R + +  ++++     + ++ +P  V++ W       S  + L+ +        L++A
Sbjct: 1   MWRALVFLALLAVAAYGAVWIADHPGTVTVVWNGYEIGMSLAIALTGVLVAAIVLGLIWA 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V    +  PA +     +R  +KG  +L  G++++ + + PLA + H+    +    ++ 
Sbjct: 61  VVTGVIGLPASISRSTRERRRNKGLASLSRGMIAVGSGD-PLAARRHAG-DAERLLGSQP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL+ Q A      + A +  + M   P TR   +  L+ E+ R  D  +A+ YA++A
Sbjct: 119 LTLLLKAQAAQISGDRDAAEQAFKRMADDPETRVLGLRGLFVEARRREDEGAARAYASEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQK------KKNAKEWNRNRAILLIARSL 234
             ++P   W  EAV++      EWS A   + ++       K+A    R RA+LL A + 
Sbjct: 179 ARLAPSVTWANEAVLEAQCADGEWSAATETVERRAALGLMDKHAA--RRQRAVLLTA-AA 235

Query: 235 ENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPE 294
           +  + G+   +   A++++KL  + + A++ A + L  +N  RKA  I+E  WK  PHPE
Sbjct: 236 QRHEAGEPDTATEQALKAVKLAPDLVPAAVIAGRLLARRNDLRKAAKIIEAAWKATPHPE 295

Query: 295 IANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMK 353
           +A +Y +L + ++   +L RA  L +++    ES +++++ A E     +A         
Sbjct: 296 LAKVYLNLRTGDSARDRLARAENLAKLSSWEPESRLVIAQAATEAKDFGRAREALAPLTD 355

Query: 354 IAPRKEIFLLLAQIEQA-NSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPIS 412
             P   +  ++A+IE A +   + +   W   A  A  DP W++ DG +S  W P+SP+S
Sbjct: 356 DRPTARVCRMMARIEAAEHGAESGRSREWLARAARAPRDPAWVA-DGIISERWAPVSPVS 414

Query: 413 KTLCYFEWKIPTKSPEYISSENINFS 438
             L  F WK P   PE ++    + S
Sbjct: 415 GRLDAFVWKTP---PEILAGPEDDDS 437


>gi|218528780|ref|YP_002419596.1| HemY domain protein [Methylobacterium chloromethanicum CM4]
 gi|218521083|gb|ACK81668.1| HemY domain protein [Methylobacterium chloromethanicum CM4]
          Length = 511

 Score =  160 bits (406), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 113/440 (25%), Positives = 212/440 (48%), Gaps = 17/440 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R + +  ++++     + ++ +P  V++ W       S  + L+ +        L++A
Sbjct: 1   MWRALVFLALLAVAAYGAVWIADHPGTVTVVWNGYEIGMSLAIALTGVLVAAIVLGLIWA 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V    +  PA +     +R  +KG  +L  G++++ + + PLA + H+    +    ++ 
Sbjct: 61  VVTGVIGLPASISRSTRERRRNKGLASLSRGMIAVGSGD-PLAARRHAG-DAERLLGSQP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL+ Q A      + A +  + M   P TR   +  L+ E+ R  D  +A+ YA++A
Sbjct: 119 LTLLLKAQAAQISGDRDAAEQAFKRMADDPETRVLGLRGLFVEARRREDEGAARAYASEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQK------KKNAKEWNRNRAILLIARSL 234
             ++P   W  EAV++      EWS A   + ++       K+A    R RA+LL A + 
Sbjct: 179 ARLAPSVTWANEAVLEAQCADGEWSAATETVERRAALGLMDKHAA--RRQRAVLLTA-AA 235

Query: 235 ENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPE 294
           +  + G+   +   A++++KL  + + A++ A + L  +N  RKA  I+E  WK  PHPE
Sbjct: 236 QRHEAGEPDTATEQALKAVKLAPDLVPAAVIAGRLLARRNDLRKAAKIIEAAWKATPHPE 295

Query: 295 IANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMK 353
           +A +Y +L + ++   +L RA  L +++    ES +++++ A E     +A         
Sbjct: 296 LAKVYLNLRTGDSARDRLARAENLAKLSSWEPESRLVIAQAATEAKDFGRAREALAPLTD 355

Query: 354 IAPRKEIFLLLAQIEQA-NSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPIS 412
             P   +  ++A+IE A +   + +   W   A  A  DP W++ DG +S  W P+SP+S
Sbjct: 356 DRPTARVCRMMARIEAAEHGAESGRSREWLARAARAPRDPAWVA-DGIISERWAPVSPVS 414

Query: 413 KTLCYFEWKIPTKSPEYISS 432
             L  F WK P   PE ++ 
Sbjct: 415 GRLDAFVWKTP---PEILAG 431


>gi|319406345|emb|CBI79982.1| conserved exported hypothetical protein [Bartonella sp. AR 15-3]
          Length = 481

 Score =  157 bits (397), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 132/480 (27%), Positives = 216/480 (45%), Gaps = 20/480 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R+  Y F +  +   F   S+    + IT+    +  S   I+S L   L   + L+ 
Sbjct: 1   MIRIFIYIFAVCAIGAVFSWGSNNNNFLVITFLQMRFTVSLLTIISGLVILLTILVFLWK 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
             R   S P  L+     R  + G KAL  GL+++ A +   A+KM     +      E 
Sbjct: 61  FFRIIFSIPGTLYSFFSGRYQEYGRKALIQGLLAVFAGDYIAAQKMEIRALKYLVKDYEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LL  QI   ++    A    E M +   T+   +Y L+ E+      + AQ YA +A
Sbjct: 121 LIKLLRAQILSLQKDSMKAIALYEEMQKEEPTKLAGLYGLFREAINTKAYDVAQHYAEEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK---NAKEWNRNRAILLIARSLENA 237
           L +SP   W  + V+ +     +W++A+   ++ ++   ++  +   R           A
Sbjct: 181 LALSPALSWAQQFVLDRLSAEGQWNKALDVFHRAQRALPHSDHYTSERKYTHALLLSGLA 240

Query: 238 D---KGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPE 294
               +  ++ +    +++ KL  + +  ++     L    + RKA+ ++ K W+ NPHP+
Sbjct: 241 LHLIETQLMEARKAILKAHKLMPDFVPITVIMVDILYRLKEVRKADKMIIKAWQKNPHPD 300

Query: 295 IANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKI 354
              +Y     E+ VG+LKRA  L   NK+  ES  IV+K AL+ G ++ A   A  A+  
Sbjct: 301 FGTLYLR-REESAVGRLKRAKTLASYNKDIFESSFIVAKAALDAGELELAREYAQRALTY 359

Query: 355 APRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKT 414
            PR+ ++LLLA IE+A   N      W   AL A  DP W   DG     W  +SPIS  
Sbjct: 360 HPRESVYLLLADIEEAQG-NGQGSRQWLSLALCAERDPAWAC-DGSFFPFWSAVSPISGR 417

Query: 415 LCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDSTI 474
           L   EWK+P + P  I+ E  N    MA   +D +  +N  K      + K  SFE  ++
Sbjct: 418 LGRCEWKVPPRCPP-ITLEIDN----MALKKEDKKGPVNEKK------VIKDKSFEKKSL 466


>gi|92116186|ref|YP_575915.1| HemY-like [Nitrobacter hamburgensis X14]
 gi|91799080|gb|ABE61455.1| HemY-like protein [Nitrobacter hamburgensis X14]
          Length = 552

 Score =  156 bits (395), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 133/530 (25%), Positives = 240/530 (45%), Gaps = 47/530 (8%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R+I +  +I+L       V+     + ++W      T+       L   + A +L+++
Sbjct: 1   MFRIILFLVLIALAALGATWVADQTGTIVMSWDVWRVETTLPAFALGLGLLVVAVLLVWS 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R     P  +     +R   +G  A+  GL++I  H    A + H+ V+++   H E 
Sbjct: 61  IVRGLWQAPRRIRRARRERRNRRGRDAITRGLLAIG-HGDAAAARTHARVARRLVSH-EP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL  Q A  +   + A      M +   TR   +  L+ E+ R  D  +A   A +A
Sbjct: 119 LTLLLHAQSAQLDGDADRAQRAFRAMAERADTRLLGLRGLFIEAQRADDPQAAVAIAEEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLEN 236
           L +SP + W ++A +       +W+ A+  L++       +   + R R +LL AR+LE 
Sbjct: 179 LKVSPSSIWASQAALGFRCARGDWTGALAILDKNVAAGLIDKALYRRQRGVLLTARALE- 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            +K D  AS +  +E++K     I A + A+K L   N+ R+A  I+E  W   PHP++A
Sbjct: 238 LEKSDRDASRNTVMEAVKYAPTLIPAVVLASKYLSEGNQMRRAMRIIETAWLAQPHPDLA 297

Query: 297 NIYTHLLSENTVG-KLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y H++  ++   +L R   L E      ES + +++ A++     +A  + +  +  A
Sbjct: 298 DAYAHVMPGDSARERLARVETLAENASGHPESAMAIARAAIDASEFARAR-EVLEPLIAA 356

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           P + + +L+A+IE     ++ +   WT  A+ A+ DP+W + DGY+S  W P+SP++  L
Sbjct: 357 PTQRVAMLMAEIEHNEHGDSGRARAWTLRAVRALHDPVWTA-DGYVSDHWRPVSPVTGRL 415

Query: 416 CYFEWK-----IPTKSPEYISSENINFSLEMAYPADDL-------QSMLNNGKKNHLP-- 461
             F+W+     +P+  P  + +E   FS ++A  A          QS   +G    +   
Sbjct: 416 DAFQWQAPLAALPSSRPALVEAE---FSDQIASDAPRFEALPAASQSAARDGDGATVAIE 472

Query: 462 ---------SIKKVSSFEDSTIHPLDPH-----------IRQPDDPGIKE 491
                    S +  +S    T   LD             +R PDDPG+ +
Sbjct: 473 SSSPETAAMSAEAATSTTFRTQSDLDKAGASDIPAVIAIVRAPDDPGVDD 522


>gi|217977723|ref|YP_002361870.1| HemY domain protein [Methylocella silvestris BL2]
 gi|217503099|gb|ACK50508.1| HemY domain protein [Methylocella silvestris BL2]
          Length = 516

 Score =  156 bits (394), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 128/451 (28%), Positives = 205/451 (45%), Gaps = 35/451 (7%)

Query: 1   MLRLIRYFFV-ISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYF------FLF 53
           M+R++ +  V I L I    ++   P ++ + W    Y+    V++ I          L 
Sbjct: 1   MIRVLLFLAVLIGLAIAEAWLIER-PGELVLNWQG--YKIETSVLMGIAAVFVAAAILLG 57

Query: 54  AWILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
            W+LL    RF  + P+++      R  +KGY AL  G++++ A +   AR+  + V  Q
Sbjct: 58  LWMLL----RFIFNIPSLMALASRGRRREKGYAALSRGMIAVGAGDTQAARR--AAVEAQ 111

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
               N+ L  LL+ Q A    +   A      M +    R   +  L+ E+ R GD+  A
Sbjct: 112 RMLPNDPLALLLKAQSAQLSGESGSAEAAFTEMTRRNDMRVLGLRGLHVEAERQGDVEKA 171

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQK------KKNAKEWNRNRAI 227
           Q YA  A +I+P  PW  +A     V A +W  A+  L          K  +E  R+RA+
Sbjct: 172 QHYAETAREIAP-LPWAAKANFAHKVAAGDWRGALALLESGAGSKHIDKTIRE--RSRAV 228

Query: 228 LLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIW 287
           L  A ++E AD      +   A  ++K     + A   AA+    Q   RKA  ++E  W
Sbjct: 229 LETAIAIEKAD-AQPAEALALARAAVKRAPTLVPAVALAARLTSEQGDARKAAKLIEAGW 287

Query: 288 KVNPHPEIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHA 346
               HP+IA IY  L   E++  +LKRA+ L ++     ES ++V++ A+  G    A  
Sbjct: 288 AGTHHPDIAKIYVGLYPGESSADRLKRAISLAQLAPREPESKIMVAEAAIAAGDFKAAR- 346

Query: 347 KAMLAMKIAPRK---EIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSS 403
           +AM  +   P +    +  L+A++E+        I  W   A  A PDP W++ DG  S 
Sbjct: 347 EAMQPLIEGPERPTARMCRLMAELEEKQHGAAGYIREWLTRASLAPPDPTWVA-DGVASD 405

Query: 404 VWLPLSPISKTLCYFEWKIPTKSPEYISSEN 434
            W P+SP++  L  F W+ P    E +SS N
Sbjct: 406 QWRPISPVTGKLDAFVWQKPV---ERLSSGN 433


>gi|312114938|ref|YP_004012534.1| HemY domain protein [Rhodomicrobium vannielii ATCC 17100]
 gi|311220067|gb|ADP71435.1| HemY domain protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 524

 Score =  155 bits (391), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 133/491 (27%), Positives = 225/491 (45%), Gaps = 32/491 (6%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M RLI YF +I LV   F  ++  P +V+I W     +TS F+    L   L A++++F 
Sbjct: 1   MTRLIGYFVIIVLVAVGFAWIADRPGNVTIQWLGYDIQTSVFIGSVAL---LLAFVIVFL 57

Query: 61  VSRFFLSC---PAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFH 117
           +    L     P      + +R    G +A+  G+ +  A +   A K  +    + T  
Sbjct: 58  LGWLGLLTWTGPKKFRGRMQRRRQRVGQEAVRRGIFAAGAGDKSAALKADAIA--RRTVP 115

Query: 118 NEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYA 177
           NE L  LL+ Q A        + +  E ML+ P   E  +  LY E+ +     +A+++A
Sbjct: 116 NEPLALLLQAQSAQLNEDSIASRQAFERMLEKPEMAELGLRGLYMEAKKANQNEAAKQFA 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN---AK-EWNRNRAILLIARS 233
            +AL  +P   W + A+ +      +W  A+  L   K++   AK E +R R++LL   +
Sbjct: 176 ERALAANPALAWSSSALFEIQSREGDWRAALKTLQIAKEHRHLAKPEADRRRSLLLTQLA 235

Query: 234 LENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHP 293
           +E  D     A  + A E+  L    I A++ A + L +Q +  +A  IL + W+   HP
Sbjct: 236 IELEDSQPSKALAY-ATEAFDLSPTLIPAAVVAGRILTTQGQTSRATKILTQAWRSTQHP 294

Query: 294 EIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAM 352
           EIA  + H    ++   +L R   L     +++E  V V+  A++     Q    A LA+
Sbjct: 295 EIALTFAHARRGDSPRDRLARVKSLVAAGSQTLEGAVAVAVSAIDA----QEWKTARLAL 350

Query: 353 KI----APRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPL 408
           +      P   +  L+A+IE   + ++ +   W   A    PDP+W++ DG +S+ W P+
Sbjct: 351 EPYLANNPPARVCRLMARIEAGQNRDSGRAREWLAKAARGAPDPVWVAPDGTVSAEWQPI 410

Query: 409 SPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLP-SIKKVS 467
           SP +  L  FEWK P   P   S+   +F+ E++  A D+ S+    +   LP S  K  
Sbjct: 411 SPTTGALGSFEWKTP---PANASANPDDFAAEIS--ALDVVSL----EGESLPDSYAKTK 461

Query: 468 SFEDSTIHPLD 478
                +  P+D
Sbjct: 462 GLSGRSNEPVD 472


>gi|146337456|ref|YP_001202504.1| putative signal peptide;putative HemY porphyrin biosynthesis
           protein [Bradyrhizobium sp. ORS278]
 gi|146190262|emb|CAL74256.1| conserved hypothetical protein; putative signal peptide;putative
           HemY porphyrin biosynthesis protein [Bradyrhizobium sp.
           ORS278]
          Length = 644

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 117/436 (26%), Positives = 210/436 (48%), Gaps = 20/436 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGN-RLYRTSPFVILSILYFFLFAWILLF 59
           M R++ +  ++ L       V+    DV + WG  R+  T P  +L+ L   + A +L++
Sbjct: 1   MFRIVVFLILVGLAAAGSAWVAEQTGDVVLNWGPWRVAMTLPVFVLA-LGLTIAACVLVW 59

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
            +    L  P  +     +R + +G  A+  GL++I  H    A + H+ ++++    ++
Sbjct: 60  NLLSALLRAPNRIRKAHRERRHRRGRHAITHGLLAIG-HGDSTAARQHADMAKRLA-GDD 117

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATK 179
            L  LL  Q A  E   + A      M +   TR   +  L+ E+ R  D  +A   A +
Sbjct: 118 PLTLLLHAQAAQLEGDRDGARRAFRAMAERQDTRLLGLRGLFIEAQRADDAMAAVVIADE 177

Query: 180 ALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSL- 234
           AL ++P+A W + AV+       +W+ A++ L+        +   + R R +LL AR++ 
Sbjct: 178 ALKLAPNASWASHAVLGFRCAQGDWNGALSILDGNYTAGMIDKPTYRRQRGVLLTARAMA 237

Query: 235 ---ENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
              EN D      +   A+E++KL    + A++ AAK     ++ R+A  I+E  W   P
Sbjct: 238 LETENRD-----LARASAMEAVKLAPTLVPAAVLAAKFESEAHQVRRAMKIIEAAWTSCP 292

Query: 292 HPEIANIYTHL-LSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           HP++A+ Y H+ L ++ V +L R   L       VE  + V++ A++     +A A A+ 
Sbjct: 293 HPDLADAYAHVRLGDSAVQRLSRITNLAARTPNHVEGALAVARAAIDAAEFGRARA-ALA 351

Query: 351 AMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSP 410
                P + + +L+A++E+    +  K   WT  A+ A  DP W + DGY+S  W P+SP
Sbjct: 352 PFTEDPTQRVAMLMAELERTEHGDAGKAREWTLRAVRARHDPAWTA-DGYVSDRWRPISP 410

Query: 411 ISKTLCYFEWKIPTKS 426
           ++  L  F+W+ P  S
Sbjct: 411 VTGRLDAFQWQTPVAS 426


>gi|316931768|ref|YP_004106750.1| HemY domain-containing protein [Rhodopseudomonas palustris DX-1]
 gi|315599482|gb|ADU42017.1| HemY domain protein [Rhodopseudomonas palustris DX-1]
          Length = 565

 Score =  152 bits (385), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 117/435 (26%), Positives = 216/435 (49%), Gaps = 18/435 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGN-RLYRTSPF---VILSILYFFLFAWI 56
           MLR++ +  +I+L       V+  P +V ++W + R   T P     + + +   + AW 
Sbjct: 1   MLRIVLFLVIIALAAAGAAWVAEQPGEVVLSWNDWRASMTLPVFAAALGAGVVAVMLAWA 60

Query: 57  LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTF 116
           ++  V R     P  +      R  ++   A+  GL+++  H    A + H+  +++H  
Sbjct: 61  IVLGVVR----APGWMKRGRSSRRSERARNAITQGLLAVG-HGDSAAARAHANAARRHAP 115

Query: 117 HNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRY 176
           H+  L  LL+ Q A  E     A      M     T+   +  LY E+ R  D  +A   
Sbjct: 116 HDP-LALLLQAQSAQLEGDREGARRAFLAMASRKDTKSLGMRGLYIEAQRADDPYAALAI 174

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIAR 232
           A +AL + P+  W ++AV+       +W+ A+  L +       + K + R RA+LL AR
Sbjct: 175 AEEALRLQPNCAWASQAVLGFRCARSDWTGALEILERNLSAGLIDKKAFRRQRAVLLTAR 234

Query: 233 SLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPH 292
           ++ + ++ D   +   A+E+ KL    + A++ AAK L   ++ R+A  ++E  W+  PH
Sbjct: 235 AI-DLEESDESLARDSALEANKLAPTLVPAAVLAAKHLAGAHQVRRAMKVIEAAWQAQPH 293

Query: 293 PEIANIYTHLLSENT-VGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLA 351
           PE+A+ Y +L   +T   +L R   L     + +ES V +++ A++ GS  +A       
Sbjct: 294 PELASTYANLKPGDTATARLGRVENLVGKGPQQLESAVAIARAAIDAGSFGRARTALEPY 353

Query: 352 MKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPI 411
           +++ P + + +L+A+IE  +  +T K   WT  A+ A+ DP+W + DGY+S  W P+SP+
Sbjct: 354 LEM-PTQRVAMLMAEIEHGDRGDTAKARAWTLRAVRALHDPVWTA-DGYVSDHWRPVSPV 411

Query: 412 SKTLCYFEWKIPTKS 426
           +  L  F+W++P  +
Sbjct: 412 TGRLDAFQWQVPVSA 426


>gi|85713683|ref|ZP_01044673.1| HemY protein [Nitrobacter sp. Nb-311A]
 gi|85699587|gb|EAQ37454.1| HemY protein [Nitrobacter sp. Nb-311A]
          Length = 577

 Score =  149 bits (376), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 128/527 (24%), Positives = 243/527 (46%), Gaps = 42/527 (7%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGN-RLYRTSPFVILSILYFFLFAWILLF 59
           MLR+I +  +I+L       ++     + ++W   R+  T P   L  L   + A +L++
Sbjct: 27  MLRIILFLVLIALSALGASWIADQTGTIVLSWDVWRIETTLPVFALG-LGLLVVASLLVW 85

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
           +  R     P  L      R   +G  A+  GL++I  H    A + H+ V+++     +
Sbjct: 86  SAVRGLWQAPTRLRRARRARRTARGRDAITRGLLAIG-HGDATAARNHARVARR-LVSQD 143

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATK 179
            L  LL  Q A  +   + A      M +   TR   +  L+ E+ R GD  +A   A +
Sbjct: 144 PLALLLHAQAAQLDGDADRAQRVFRTMAERADTRLLGLRGLFIEAQRAGDPAAAVAIAEE 203

Query: 180 ALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILLIARSLE 235
           AL  SP + W ++A +       +W+ A+  L++   + +     + R R +LL AR+LE
Sbjct: 204 ALKTSPSSIWASQAALGFRCARGDWAGALAILDRNAASGRIDKALYRRQRGVLLTARALE 263

Query: 236 NADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEI 295
             +  D   S    +E++K     + A + A+K L   N+ R+A  ++E  W   PHP++
Sbjct: 264 -LETSDRDLSRQTVMEAVKFAPTLVPAVVLASKYLSEANQMRRAMRMIETAWLAQPHPDL 322

Query: 296 ANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKI 354
           A+ Y H++  ++ + +L R  +L E      ES + +++ AL+     +A   A+  +  
Sbjct: 323 ADAYAHVMPGDSALQRLARVEKLSEKAPGHPESAMAIARAALDASEFARAR-DALEPLIA 381

Query: 355 APRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKT 414
           AP + + +L+A+IE +   ++ +   WT  A+ A+ DP+W + DGY+S  W P+SP++  
Sbjct: 382 APTQRVAMLMAEIEHSEHGDSGRARAWTLRAVRALHDPVWTA-DGYVSDHWRPVSPVTGR 440

Query: 415 LCYFEWK-----IPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHL-----PSIK 464
           +  F+W+     +P+  P  + ++  +   E     + L +    G+         P+  
Sbjct: 441 VDAFQWQTPLAALPSSRPPLVEADVSDQIAEETPRVEALPAASPGGESKAQDDAMSPADV 500

Query: 465 KVSSF------EDSTIHPLD--------------PHIRQPDDPGIKE 491
           + +SF      +++   P+               P +R PDDPG+ +
Sbjct: 501 EAASFGTIPMPDETAASPISHTEEDKPGAIPDVIPIVRAPDDPGVDD 547


>gi|218679767|ref|ZP_03527664.1| putative transmembrane protein [Rhizobium etli CIAT 894]
          Length = 280

 Score =  149 bits (376), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 96/266 (36%), Positives = 138/266 (51%), Gaps = 16/266 (6%)

Query: 47  ILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKM 106
           + +F    W    +V+R+F +           R  D+GY+AL TGL++  A N  LARKM
Sbjct: 27  VWWFIRLVWTSPHSVTRYFRA-----------RKRDRGYQALSTGLIAAGAGNALLARKM 75

Query: 107 HSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCR 166
            +          E L+ LLE Q AL E +++ A  K E M   P TRE  +  LY E+ R
Sbjct: 76  AARSRGLIRADQEPLINLLEAQAALIEGRHDEARAKFEAMANDPETRELGLRGLYLEARR 135

Query: 167 IGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWN 222
           +G   +A++YA KA D +P  PW  +A ++    A  W  AI  L Q+K        E N
Sbjct: 136 LGANEAARQYAEKAADNAPYLPWAAQATLEYRSQAGRWDDAIRLLEQQKAARVVEKAEAN 195

Query: 223 RNRAILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVI 282
           R  A+LL AR+ E  + G+   +  DA+++LKL  + I A++ AAK+L  +   RKA  I
Sbjct: 196 RLHAVLLTARAGERLE-GNPAGARDDALQALKLAADFIPAALIAAKALFREGGLRKAASI 254

Query: 283 LEKIWKVNPHPEIANIYTHLLSENTV 308
           LE+ WK  PHPEI   Y    S ++ 
Sbjct: 255 LEQAWKSAPHPEIGQAYVRARSGDST 280


>gi|90421577|ref|YP_529947.1| HemY-like [Rhodopseudomonas palustris BisB18]
 gi|90103591|gb|ABD85628.1| HemY-like [Rhodopseudomonas palustris BisB18]
          Length = 561

 Score =  148 bits (374), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 132/539 (24%), Positives = 236/539 (43%), Gaps = 57/539 (10%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITW----GNRLYRTSPFVILSILYFFLFAWI 56
           MLR+I +  VI+        ++  P +V ++W           +   +LS +      W 
Sbjct: 1   MLRIILFLVVIAAAAAGAGWLAEQPGNVVLSWRGWQAEMTLAVAALALLSAIVAVALGWT 60

Query: 57  LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTF 116
           +L  V    L  P  L      R   +  +A+  GL+++  H      + H+  +++H  
Sbjct: 61  ILAGV----LRSPGRLRRSRRARREARARRAITQGLLAVG-HGDAAIARAHANAAKRHAP 115

Query: 117 HNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRY 176
            +  L  LL+ Q A  +   + A      M     T+   +  L+ E+ R  D  +A   
Sbjct: 116 QDP-LALLLQAQSAQLDGDRDGAKRAFLAMAGRDDTKSLGMRGLFIEAQRAEDPYAALTI 174

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAI----TFLNQKKKNAKEWNRNRAILLIAR 232
           A +AL +SP + W ++AV+       +WS A+    T L     + K + R R +LL AR
Sbjct: 175 AEEALRLSPASSWASQAVLGFRCARGDWSGALEILETNLTSGLIDKKTYRRLRGVLLTAR 234

Query: 233 SLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPH 292
           ++E  ++ D+  S   A+E++KL    + A++ A+K L   ++ R+A   +E  W  +PH
Sbjct: 235 AIE-CEETDVSLSRDSALEAVKLAPTLVPAAVLASKYLSEAHQIRRAMKTIETAWLAHPH 293

Query: 293 PEIANIYTHLLSENTVG-KLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLA 351
           P++A  Y H+   ++   +L+R   L        E  V V++ A++ G  ++A   A++ 
Sbjct: 294 PDLAEAYAHIKPGDSAQVRLQRVEALAAKASGDTEGAVAVARAAIDAGDFNRARG-ALMP 352

Query: 352 MKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPI 411
              AP + + +L+A+IE     ++     WT  A+ A+ DP+W + DG +S  W P+SP+
Sbjct: 353 FVDAPTQRVAMLMAEIEHTERKDSRSARAWTLRAVRALRDPVWTA-DGCVSDRWRPVSPV 411

Query: 412 SKTLCYFEWKIP---------------------TKSP-----EYISSENINFSLEMAYP- 444
           +  L  F+W  P                      +SP     E ++SE     +  A P 
Sbjct: 412 TGRLDAFQWTTPLAELPTNKAVVLESDLFDETLIESPTEEVTEGVTSEPATPEVSKAEPS 471

Query: 445 -----ADDLQSMLNNGKKNHLPSIKKVSSF-------EDSTIHPLDPHIRQPDDPGIKE 491
                   ++ ++ +      P +    S        + S   P+ P +R PDDPGI E
Sbjct: 472 KPETSGTPVEVVMESKPAAEAPVVGPTESSPPLFHRPQRSAAAPVIPIVRAPDDPGIDE 530


>gi|158421882|ref|YP_001523174.1| putative HemY protein [Azorhizobium caulinodans ORS 571]
 gi|158328771|dbj|BAF86256.1| putative HemY protein [Azorhizobium caulinodans ORS 571]
          Length = 532

 Score =  147 bits (371), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 119/433 (27%), Positives = 205/433 (47%), Gaps = 20/433 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITW-GNRLYRTSPFVILSILYFFLFAWILLF 59
           M+RL+ +  V++ +      ++  P ++ + W G R+  T P V L+ L  F  A ++++
Sbjct: 1   MIRLVLFLIVLAAIAFGASWLADRPGEMLVVWQGWRIETTVP-VALAALAAFSVALLIVW 59

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
            +    L  P M+     +R  +KG+ A+  GL++I + +  L     +          E
Sbjct: 60  HLGALLLRSPRMIATFSRRRRREKGWAAVSRGLVAIGSGD--LDAARRARAEALRYLPKE 117

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATK 179
            L  LL  Q A A    + A      ML  P TR   +  L+ E+ R GD+ +A+  A +
Sbjct: 118 PLTQLLAAQSAQATGHQDDALRTFRTMLDTPDTRLLGLRGLHMEARRSGDIAAARMLAEE 177

Query: 180 ALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILLIARSLE 235
           A + SP   W  +AV++      +++ A   L ++  +      ++ R RA+LL A    
Sbjct: 178 AANQSPALTWAADAVIEARCGEGDYAGAREVLEKQMAHRGIDKLQYRRRRAVLLAA-EAL 236

Query: 236 NADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEI 295
             ++ D   +   A+E+++L    + A+  A + L +  + RKA  I+E  +   PHPE+
Sbjct: 237 ALEQTDPPVARERAVEAVRLAPTLVPAAAVAGRLLGANGELRKATKIVETAYASTPHPEL 296

Query: 296 ANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQ---AHAKAMLA 351
           A +  HL   +  + +LKR   L     +  ESL     IAL   +ID    A A+A+L 
Sbjct: 297 AQVAAHLRPGDAALDRLKRIRTLAAKAPDHAESL-----IALAHATIDANEFAEARALLQ 351

Query: 352 -MKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSP 410
            +   P + + LL+A++E +   +  K   W   AL A  DP WI+ DG +   W P+SP
Sbjct: 352 RLSAEPTQRVCLLMAELEASEHEDVGKAREWAARALRAPRDPAWIA-DGRVFDAWAPVSP 410

Query: 411 ISKTLCYFEWKIP 423
           ++  L  F W +P
Sbjct: 411 VTGKLDAFVWAVP 423


>gi|154245109|ref|YP_001416067.1| HemY domain-containing protein [Xanthobacter autotrophicus Py2]
 gi|154159194|gb|ABS66410.1| HemY domain protein [Xanthobacter autotrophicus Py2]
          Length = 567

 Score =  145 bits (365), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 104/409 (25%), Positives = 201/409 (49%), Gaps = 12/409 (2%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++  P +V++ W    Y T+  V L+++       ++L+ +    +  P ++     +R 
Sbjct: 21  LADRPGEVTVVWEGVAYGTTVPVALAVIAVVAGLILILWRILSLLVRSPKIIAAFSRRRR 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
            +KG+ A+  GL+++   +    R+     ++     +E L +LL  Q A  + ++ +A 
Sbjct: 81  REKGWNAVTRGLLAVGIGDNAAVRQARHDAAR--LLPHEPLTHLLTAQAAQLDGKHEVAV 138

Query: 141 EKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVL 200
                M+  P TR   +  L+ E+ + GD  +A   A +A   +P   W  +AV++    
Sbjct: 139 AAFRAMVDKPETRLLGLRGLHMEARKAGDKVAAYAIAEEAASAAPTLGWAADAVIEARCA 198

Query: 201 AKEWSRAITFLNQ----KKKNAKEWNRNRAILLIARSLENADKGDMIASYHDAIESLKLC 256
           A +++ A   L +    K  +  ++ R +A+LL A ++   +  D + +   A+E+++L 
Sbjct: 199 AGDYAGARGVLERQMALKGIDKAQYRRRKAVLLAAEAI-ALEHSDPLVAREKAVEAVRLA 257

Query: 257 DNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV-GKLKRAL 315
              + A+ CA + L +  + RKA  ++E  +  NPHPE+A++  +L   +    +LKR  
Sbjct: 258 PTLVPAAACAGRLLGAAGELRKAAKVVETAFATNPHPELADVEAYLRPGDAAQDRLKRIR 317

Query: 316 RLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA-PRKEIFLLLAQIEQANSHN 374
            L        ES + +S+ A++     Q  A+ +L   +A P + + LL+A++E A   +
Sbjct: 318 TLVNRAPSHRESAIALSRAAIDAHEFRQ--ARLVLEPLLAEPSQRVCLLMAELEAAEHAD 375

Query: 375 TDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEWKIP 423
             K   WT  A+ A  DP WI+ DG +S  W  +SP+S  L  F W++P
Sbjct: 376 IGKAREWTARAVRAHRDPAWIA-DGVVSDAWAAVSPVSGKLDAFVWEVP 423


>gi|170742656|ref|YP_001771311.1| HemY domain-containing protein [Methylobacterium sp. 4-46]
 gi|168196930|gb|ACA18877.1| HemY domain protein [Methylobacterium sp. 4-46]
          Length = 528

 Score =  144 bits (364), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 110/427 (25%), Positives = 208/427 (48%), Gaps = 13/427 (3%)

Query: 19  IIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHK 78
           + ++ +P  VS++WG     TS    L  +         L++++R  L  P  +    H+
Sbjct: 19  VWLADHPGVVSVSWGGVDVATSLNAALVGVLVLAVVLGFLWSLARGVLRLPRRMRASSHE 78

Query: 79  RNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNI 138
           R   +G++AL  G++++ + + P A + H+  +++    +E L  LL  Q A        
Sbjct: 79  RRRTRGFEALSRGMVAVGSGD-PAAARRHAGEAER-LLGSEPLALLLTAQAAQISGDRAG 136

Query: 139 AHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQY 198
           A      M +   TR   +  L+ E+ R GD  +A+ YA +A  ++P   W  EAV++  
Sbjct: 137 AERAFRRMTEASETRVLGLRGLFVEARRQGDEATARAYAAEASRLAPGVSWANEAVMEAQ 196

Query: 199 VLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLENADKGDMIASYHDAIESLK 254
              ++W+ A+  ++++      +     R RA+LL A S +  + GD   +   A E+++
Sbjct: 197 CADRDWAGALETVSRRAALGLADKAASRRQRAVLLTA-SAQELEAGDPERALAQAREAVR 255

Query: 255 LCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLL-SENTVGKLKR 313
           L  + + A++ A + L  + + +KA  ++E  WK  PHP++A +Y  L   +++  +L R
Sbjct: 256 LAPDLVPAAVVAGRLLSRRAELKKAARVIEAAWKAGPHPDLARVYLDLRPGDSSRDRLAR 315

Query: 314 ALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQA-NS 372
           A  L  ++    E+   +++ ALE     +A       +  +P +  +LL+A+IE+  + 
Sbjct: 316 AETLARLSSWHPEARFAIARAALEAREFGRARDVLQPLLAESPTQRAYLLMAEIEETEHG 375

Query: 373 HNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEWKIPTKSPEYISS 432
             + +   W   A HA  DP W + DG +S  W P+SP+S  L  F W+ P   PE ++ 
Sbjct: 376 RGSGRAREWLSRAAHAPRDPAWCA-DGIVSDRWAPISPVSGRLDAFVWQTP---PELLAG 431

Query: 433 ENINFSL 439
            + +  L
Sbjct: 432 RSQDLPL 438


>gi|115522092|ref|YP_779003.1| HemY domain-containing protein [Rhodopseudomonas palustris BisA53]
 gi|115516039|gb|ABJ04023.1| HemY domain protein [Rhodopseudomonas palustris BisA53]
          Length = 577

 Score =  144 bits (364), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 114/432 (26%), Positives = 204/432 (47%), Gaps = 18/432 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTS----PFVILSILYFFLFAWI 56
           MLR+I +  VI+L       ++  P +V ++W       S      V+  IL   L AW 
Sbjct: 1   MLRIILFLVVIALAATGAAWLAEQPGNVVLSWNGWQAEASLAVFSMVVGGILVSVLLAWA 60

Query: 57  LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTF 116
           ++  + R     P  L     +R   +   A+  GL+++  H      + H+  +++H+ 
Sbjct: 61  IITGLWR----SPRRLARSRRERKLARARHAVTQGLLAVG-HGDAAIARAHANAARRHS- 114

Query: 117 HNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRY 176
            N+ L  LL+ Q A  +     A      M     T+   +  L+ E+ R  D  +A   
Sbjct: 115 PNDPLALLLQAQAAQLDGDREGAKRAFLAMASRDDTKSLGMRGLFIEAQRAEDPYAALTV 174

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLIAR 232
           A +AL +SP + W   AV+       +WS A+  L     +     K + R R +LL AR
Sbjct: 175 AEEALRLSPGSHWAAHAVLGFRCARSDWSGAMDILENNLASGLIDKKTYRRQRGVLLTAR 234

Query: 233 SLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPH 292
           ++E  D  D+  +   A+E++KL    + A++ AAK +   ++ R+A  I+E  W  +PH
Sbjct: 235 AIECED-ADVSVARDSALEAIKLVPTLVPAAVLAAKYMSEAHQLRRALKIIEAAWIAHPH 293

Query: 293 PEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLA 351
           P++A  Y H+   ++   +L R   L       +E  + +++ A++     +A   A+  
Sbjct: 294 PDLAEAYAHIKQGDSAQARLSRIETLAAKAPGHIEGALAIARAAIDASDFTRAR-NALAP 352

Query: 352 MKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPI 411
              AP + + +L+A+IE A+ +++     WT  A+ A+ DP+W + DG +S  W P+SP+
Sbjct: 353 YVEAPTQRVAMLMAEIEHADRNDSRAARAWTLRAVRALRDPVWTA-DGCVSDRWRPVSPV 411

Query: 412 SKTLCYFEWKIP 423
           +  L  F+W  P
Sbjct: 412 TGRLDAFQWTSP 423


>gi|220924339|ref|YP_002499641.1| HemY domain-containing protein [Methylobacterium nodulans ORS 2060]
 gi|219948946|gb|ACL59338.1| HemY domain protein [Methylobacterium nodulans ORS 2060]
          Length = 507

 Score =  143 bits (361), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 112/415 (26%), Positives = 205/415 (49%), Gaps = 14/415 (3%)

Query: 19  IIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLF--AVSRFFLSCPAMLFHML 76
           + ++ +P  V++TW    Y  +  +  +++   +FA IL F  A +R  L  P  L    
Sbjct: 19  VWLADHPGVVTVTWSG--YEVATSLAAALVGVLIFAVILGFVWAFTRGILRFPHRLRVRN 76

Query: 77  HKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQY 136
             R   +GY+AL  G++++ + + P A + H+  + +    +E L  LL+ Q A      
Sbjct: 77  RARRRARGYEALSRGMVAVGSGD-PAAARRHAGEAAR-LLGDEPLALLLKAQAAQISGDR 134

Query: 137 NIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQ 196
             A      M + P TR   +  L+ E+ R GD  +A+ YA +A  ++P   W  EAV++
Sbjct: 135 AGAENAFRRMTEEPETRVLGLRGLFVEARRQGDEATARAYAAEAARLAPGVSWANEAVLE 194

Query: 197 QYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLENADKGDMIASYHDAIES 252
                ++W+ A+  ++++      +     R RA+LL A +LE  + GD   +   A E+
Sbjct: 195 AQCADRDWNNALETVSRRASLGIADKTAARRQRAVLLTASALE-LEAGDPERALAQAREA 253

Query: 253 LKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLL-SENTVGKL 311
           +KL  + + A+  A +    +   ++A  ++E  WK +PHP++A +Y  L   +++  +L
Sbjct: 254 VKLAPDLVPAAAVAGRLFARRADLKRAARVVEAAWKASPHPDLARVYLDLRPGDSSRDRL 313

Query: 312 KRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQA- 370
            RA  L  ++    ES   +++ ALE     +A       +   P + ++L++A+IE+A 
Sbjct: 314 ARAETLARLSSWHPESRFAIARAALEAREFGRARDVLSPLLADNPTQRVYLMMAEIEEAE 373

Query: 371 NSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEWKIPTK 425
           +   + +   W   A HA  DP W + DG +S  W P+SP+S  L  F W+ P +
Sbjct: 374 HGRGSGRAREWLARAAHAPRDPAWCA-DGIVSDRWAPVSPVSGRLDAFVWQTPPE 427


>gi|75674672|ref|YP_317093.1| HemY protein [Nitrobacter winogradskyi Nb-255]
 gi|74419542|gb|ABA03741.1| HemY protein [Nitrobacter winogradskyi Nb-255]
          Length = 555

 Score =  140 bits (352), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 130/532 (24%), Positives = 240/532 (45%), Gaps = 47/532 (8%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGN-RLYRTSPFVILSILYFFLFAWILLF 59
           MLR+I +  +I+L       ++     + ++W   R+  T P   L  L   + A +L +
Sbjct: 1   MLRIILFLVLIALSALGATWIADQTGTIVLSWDVWRIETTIPVFALG-LGLLIVASLLAW 59

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
           +V       P  +     +R   +G  A+  GL++I   +   A   +   + +    N+
Sbjct: 60  SVVHGLWQAPTRMRRARRERRIARGRDAITRGLLAIGYGDA--AAARNHAKAARRLVSND 117

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATK 179
            L  LL  Q A  +   + A      M +   TR   +  L+ E+ R GD  +A   A +
Sbjct: 118 PLALLLHAQAAQLDGDADRAQRAFRTMAERNDTRLLGLRGLFIEAQRAGDPAAAVAIAEE 177

Query: 180 ALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILLIARSLE 235
           AL  SP + W ++A +       +W+ A+  L++   + +     + R R +LL AR+LE
Sbjct: 178 ALKTSPSSIWASQAALGFRCARGDWTGALAILDKNVASGRIDKALYRRQRGVLLTARALE 237

Query: 236 NADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEI 295
             +K D   S    +E++K     I A + A+K L   N+ R+A  ++E  W   PHP++
Sbjct: 238 -LEKSDRDLSRQTVMEAVKFAPTLIPAVVLASKYLSEANQMRRAMRLIETAWLAQPHPDL 296

Query: 296 ANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKI 354
           A+ Y H++  ++ + +L R  +L E      ES + +++ A++      A A+ +L   I
Sbjct: 297 ADAYAHVMPGDSALQRLARVEKLSEKAPGHPESAMAIARAAIDASEF--ARAREVLEPLI 354

Query: 355 -APRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISK 413
            AP + + +L+A+IE     ++ +   WT  A+ A+ DP+W + DGY+S  W P+SP++ 
Sbjct: 355 AAPTQRVAMLMAEIEHNERGDSGRARAWTLRAVRALHDPVWTA-DGYVSDHWRPVSPLTG 413

Query: 414 TLCYFEWK-----IPTKSPEYISSENIN---------FSLEMAYPADDLQS--------- 450
            +  F+W+     +P+  P  + +E  +          +L  A   +D ++         
Sbjct: 414 RVDAFQWQTPLSALPSSRPPLVEAEVSDQIAEDAPRVEALPAATSTEDFKAQDGAIPPAG 473

Query: 451 -------MLNNGKKNHLPSIKKVSSFED---STIHPLDPHIRQPDDPGIKEQ 492
                   ++   +    S     S ED     I  + P +R PDDPG+ + 
Sbjct: 474 VEASSSGTISMPDETATASADYTPSEEDNKPGAIPDVIPIVRAPDDPGVDDD 525


>gi|154251805|ref|YP_001412629.1| HemY domain-containing protein [Parvibaculum lavamentivorans DS-1]
 gi|154155755|gb|ABS62972.1| HemY domain protein [Parvibaculum lavamentivorans DS-1]
          Length = 512

 Score =  133 bits (335), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 122/445 (27%), Positives = 207/445 (46%), Gaps = 28/445 (6%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR +  F +++++    I ++  P D+ + W     RTS  V + ++    F  +L + 
Sbjct: 1   MLRALYIFLIVAVLSGIAIWLADNPGDLIMHWRGYEIRTSFVVGVGVMALAAFLVLLAYR 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +   F+  PA +   L KR   KG+ AL  G++++AA +   A++   Y +Q H   +  
Sbjct: 61  IIVSFIETPASVSAYLEKRRQQKGFLALSRGMVAVAAGDAADAKR---YAAQAHKLLDAP 117

Query: 121 -LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATK 179
            L  LL  Q A  E     A    E ML  P T    +  L+ ++ R GD + A  +A +
Sbjct: 118 PLTLLLAAQAAQLEGNEAAATAYFEQMLAAPETEFLGLRGLFIQARRAGDRDGALAHARR 177

Query: 180 ALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQ----KKKNAKEWNRNRAILLIARSLE 235
           A ++ P  PW  +AV +     ++W  A+  L++    K     E  R RA+LL AR++ 
Sbjct: 178 AFNLRPQTPWAAQAVFEIEAAEEDWDAALETLDRVVSAKLIPRDEARRRRAVLLTARAMT 237

Query: 236 NADK--GDMIASYHDAIE-SLKLCDNSIM-------ASICAAKSLISQNKKRKAEVILEK 285
            A+   G +      A+E + KL   ++        A   AA+      + RK   ++E 
Sbjct: 238 AAEAAYGQVGEGRTSALEKATKLSLEAVSLEPKFPPAVALAARLCGETGRARKGMKLIED 297

Query: 286 IWKVNPHPEIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQA 344
            W   PHP++A+++  ++  E+   +  RA  L   N + +ES ++V++ A+  G+ D A
Sbjct: 298 AWSDAPHPDLADVWLDMIEGESGYDRATRARVLASRNVDHIESRILVARGAI--GARDWA 355

Query: 345 HAKAMLA------MKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD 398
            A+  L        K  P + I  L+A+IE+    +      W   ALHA  DP W +  
Sbjct: 356 AAREALVPYTGAEAKEVPTQCICELMAEIEEGEFGDRGASRSWLTRALHAPADPQW-TGT 414

Query: 399 GYLSSVWLPLSPISKTLCYFEWKIP 423
           GY S  W P++P++      EW  P
Sbjct: 415 GYRSPRWSPVNPVTGEFDALEWSAP 439


>gi|170748490|ref|YP_001754750.1| HemY domain-containing protein [Methylobacterium radiotolerans JCM
           2831]
 gi|170655012|gb|ACB24067.1| HemY domain protein [Methylobacterium radiotolerans JCM 2831]
          Length = 536

 Score =  132 bits (333), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 106/409 (25%), Positives = 190/409 (46%), Gaps = 10/409 (2%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++  P  V++ W      TS  V L  +        LL+A+ R  +  P  L     +R 
Sbjct: 21  IADRPGTVTVVWNGYQIGTSLAVALVGVIAAAIVLGLLWAIVRGVIGLPEALVRGSAERR 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             KG  AL  G++++ + + PLA + ++    +     E L  LL+ Q A      + A 
Sbjct: 81  RAKGLSALSRGMVAVGSGD-PLAARRYAG-DAERLLGTEPLTLLLKAQAAQISGDRDAAE 138

Query: 141 EKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVL 200
              + M+  P TR   +  L+ E+ R  D  +A+ YAT+A  ++P   W  EA+++    
Sbjct: 139 SAFQRMVDDPETRVLGLRGLFVEARRREDETAARAYATEAARLAPSVTWANEALLEAQSA 198

Query: 201 AKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLENADKGDMIASYHDAIESLKLC 256
             +W+ A+  + ++      +     R RA+LL A + E  + G+   +    ++++KL 
Sbjct: 199 DGDWAAALETIERRSSLGLIDKAAARRQRAVLLTAIAGER-EAGEPELATERVLQAVKLA 257

Query: 257 DNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV-GKLKRAL 315
            + + A+  A + L  +   +KA  I+E  WK NPHP++A +Y  L   ++V  +L RA 
Sbjct: 258 PDLVPAACIAGRLLARRGDVKKAARIVEAAWKANPHPDLAKVYLGLRPGDSVRDRLARAE 317

Query: 316 RLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQAN-SHN 374
            L +++    ES + + + AL+     +A       +   P     L++A IE+A     
Sbjct: 318 VLAKLSVWDPESRLALGQAALDARDYKRAREAVKPLLSDRPTARACLMMAAIEEAEHGAA 377

Query: 375 TDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEWKIP 423
           + +   W   A  A  D +WI+ DG  +  W P+SP++  L  F W+ P
Sbjct: 378 SGQAREWLARAARAPRDRVWIA-DGIATDTWAPVSPVTGRLDAFAWREP 425


>gi|296444989|ref|ZP_06886950.1| HemY domain protein [Methylosinus trichosporium OB3b]
 gi|296257410|gb|EFH04476.1| HemY domain protein [Methylosinus trichosporium OB3b]
          Length = 466

 Score =  129 bits (323), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 117/435 (26%), Positives = 191/435 (43%), Gaps = 29/435 (6%)

Query: 24  YPEDVSITWGNRLYRTSPFV----ILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKR 79
           +P  +++ WG     TS  V     L ++   + AW +L +    F   P  L      R
Sbjct: 24  HPGSITLDWGGYHIETSLLVAIAATLGLIALVIIAWAILVS----FFQAPTRLAQSSRSR 79

Query: 80  NYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIA 139
             +KG++AL  G+++  A ++  A+K       +     E L +LL+ Q+A  E     A
Sbjct: 80  RREKGFQALSRGIIAAGAGHVGAAKKASKEA--EKCLAKEPLTFLLKAQVAQLEGDRVGA 137

Query: 140 HEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYV 199
                 M  +  TR   +  L+ E+ R  D  +A  +A +A  ++P  PW   A+++ + 
Sbjct: 138 ETAFHEMTLLSETRLLGLRGLHIEAKRRNDAEAAHLFADQAHQLAP-VPWAGHALLEHHG 196

Query: 200 LAKEWSRAITF----LNQKKKNAKEWNRNRAILLIARSLENADKGDMIASYHDAIESLKL 255
              +W  A       L  K  +     R RA++  A ++E        A  H A +++K 
Sbjct: 197 SNADWEEARVAIEANLKAKAIDLPTAQRLRAVVETALAMEKQVDSPSEA-LHLARQAVKR 255

Query: 256 CDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLL-SENTVGKLKRA 314
               + A     + L       KA  +LEK +  NPHP+I   Y     SE+   +L R 
Sbjct: 256 APTLVPAIALIGRLLARHGDSAKALKLLEKAYAENPHPDIVAAYLDASPSESNAERLARV 315

Query: 315 LRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKI----APRKEIFLLLAQIEQA 370
            +L     ++ ES VIV++ AL   + D A A+  LA  +    AP  +I LL+A++E A
Sbjct: 316 KKLALAAPKAPESGVIVARAAL--AARDFAMARRALAPLVAEGQAPTAQICLLMAEVEDA 373

Query: 371 NSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEWKIPTKSPEYI 430
            +  +  +  W      A  DP WI+ DG +S  W P SP++  L  F W  P   PE I
Sbjct: 374 ENGPSGPVREWLARGSRAPRDPAWIA-DGVISRSWAPASPVTGKLDAFVWTTP---PEPI 429

Query: 431 --SSENINFSLEMAY 443
              +E+    +  A+
Sbjct: 430 RGPAEDARAGIPAAF 444


>gi|288957242|ref|YP_003447583.1| hypothetical protein AZL_004010 [Azospirillum sp. B510]
 gi|288909550|dbj|BAI71039.1| hypothetical protein AZL_004010 [Azospirillum sp. B510]
          Length = 449

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 116/452 (25%), Positives = 205/452 (45%), Gaps = 12/452 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R + +   +++VI   I ++  P  VS+ W         +V L +L   L    L + 
Sbjct: 1   MIRALWFLLKLAVVIAIAIWLADRPGSVSVHWLGYAVEAPFWVALLVLLAALGLAALGYR 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R  +  P  L      R  ++GY+AL  G+++IAA + P ARKM     +     NE 
Sbjct: 61  LLRGTIRLPQRLRRHSRARRRERGYRALTQGMVAIAAGDAPTARKM---ARKADVLLNEP 117

Query: 121 -LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATK 179
            L  LL  Q A  +     A +    ML+ P T    +  L  ++ + GD   A   A K
Sbjct: 118 PLTMLLSAQAAQLQGDERAAKQYFTAMLERPETAFLGMRGLLTQAIKSGDRVEALTLARK 177

Query: 180 ALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLIARSLE 235
           A  + P+ PW+   +      A +W+ A   L Q  +      +E  R+R +LL+ RS E
Sbjct: 178 ARGLQPNTPWLLGTLYDLEARAGDWAAAEGTLQQAIQAGAMPTEEGRRHRVVLLLERSFE 237

Query: 236 NADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEI 295
              +G   A+   A  +  L      A++  A+  ++ ++ + A  ++E+ W+  PHPE+
Sbjct: 238 AERRGRADAALSHAQAAHDLMPGFAPAAVRLARLQVAADRLKPAAKVVERAWRHEPHPEL 297

Query: 296 ANIY-THLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKI 354
           A+IY T + S + + +++   +L     +S ES + V++ A++     +A      AM+I
Sbjct: 298 ADIYGTIVASYDALTRVRLFQKLVRQAPDSAESHLAVARAAIDAQLWGEARQHLERAMEI 357

Query: 355 APRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLSSVWLPLSPISK 413
            P +  + L+A +++   H+ +    W   A +A  DP+W     G +S  W  L     
Sbjct: 358 GPTRRTYRLMAALDRGERHDEEVAKDWLAKAANAPEDPVWTCGSCGAVSHNWGGLCGHCG 417

Query: 414 TLCYFEWKIPTKSPEYISSENINFSLEMAYPA 445
                 WK PT +   + + ++  +L  A PA
Sbjct: 418 AFDSLSWKAPTVAVPLMEATDLPPAL--ARPA 447


>gi|209965650|ref|YP_002298565.1| HemY domain protein [Rhodospirillum centenum SW]
 gi|209959116|gb|ACI99752.1| HemY domain protein [Rhodospirillum centenum SW]
          Length = 472

 Score =  123 bits (309), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 109/438 (24%), Positives = 194/438 (44%), Gaps = 24/438 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R + +F  I L+I   I ++  P  VSI + + +     + +L  L   + A ++L+ 
Sbjct: 1   MRRAVFFFIKIGLLIALAIWLARNPGSVSIQFQDWMVDMPFWAMLLALAVIIVASVVLYR 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE- 119
           V  F +  PA           ++GY AL  G++++AA +   A +   +  +  T  NE 
Sbjct: 61  VFSFVVGGPAAFARSRQAAKRERGYHALTQGMVAVAAGDREAASR---FARKADTLLNEP 117

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATK 179
            L  LL  Q A        A +  + MLQ P T    +  L  ++ + GD   A + A +
Sbjct: 118 PLTLLLSAQAAQLAGDDMAARKYFQSMLQRPETEFLGLRGLLTQALKGGDRTEALKLARR 177

Query: 180 ALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQ----KKKNAKEWNRNRAILLIARSLE 235
           A +I P A W   A+++       W +A   L++    K    +   R+R  LL+ R+  
Sbjct: 178 AAEIQPKAQWPVLALMELEAKEGHWKQAEEALDRATATKALPQETLRRHRVALLVERART 237

Query: 236 NADKG---DMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEV-ILEKIWKVNP 291
              +G   D +A    A E +    + + A++  A +L +Q   RKA    +E+ WK+ P
Sbjct: 238 AVAEGRSKDALALAQRANEQMP---SHVPAAVLVA-TLRAQAGNRKAATRAIEEAWKIAP 293

Query: 292 HPEIANIYTHLLSENTVG-----KLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHA 346
           HPE+A  +  + +    G      +KR   L  ++  +  + V + +  L     DQA  
Sbjct: 294 HPELAEAWGRIEAIFRPGIDPASLVKRYEALVALDPRAAAAYVALGEACLRADLRDQART 353

Query: 347 KAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQ--SALHAMPDPLWI-SDDGYLSS 403
               A  +AP + +F LL ++ +    + + +  W +  + LH  PDP+W+ S  G  ++
Sbjct: 354 HLEKAWTLAPTQHVFRLLTELARHEDGDGEAMREWLERSAGLHPDPDPVWVCSACGTPAA 413

Query: 404 VWLPLSPISKTLCYFEWK 421
            W  + P  +     EW+
Sbjct: 414 GWSAVCPSCRGFDTMEWR 431


>gi|86136714|ref|ZP_01055292.1| HemY domain protein [Roseobacter sp. MED193]
 gi|85826038|gb|EAQ46235.1| HemY domain protein [Roseobacter sp. MED193]
          Length = 503

 Score =  122 bits (307), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 107/450 (23%), Positives = 202/450 (44%), Gaps = 16/450 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWI--- 56
           +L+++ +  +++L+     I+      V IT     Y       +L++    L  WI   
Sbjct: 5   LLKILVFVALVALIAFGAGILMETAGGVQITVAGTEYTLGALQSVLALGVLVLSVWIFLK 64

Query: 57  ---LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
              LL A  +F       +     K    KGY+AL  G+M++A+    LA    S  ++ 
Sbjct: 65  LLTLLVATLKFLNGDETAMSRYFDKGRERKGYQALSDGMMALASGEGRLALTKASKAAR- 123

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
               N  L  LL  Q A      + A E  + +L    TR   V  +  +    GD ++A
Sbjct: 124 -YLDNPQLTDLLTAQAAEMAGDTHKAAEAYKRLLSDQTTRFVGVRGIMKQKLSEGDKDTA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILL 229
            + A KAL + P    V + ++Q    A++W+ A   L+ K K+       + R  A+L 
Sbjct: 183 LQLAEKALALRPKHEEVQDTLLQLQAQAEDWAGARKTLSAKLKSGSLPRDVFKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ S E AD+   +     AIE+ +L  + + A+  AA++ + Q KKR A  +L+K W+ 
Sbjct: 243 LSASREVADEAASLEQREQAIEANRLSPDLVPAAAMAARAYLEQGKKRNAIKVLKKAWEA 302

Query: 290 NPHPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A+++  +  E T   ++KR  +L  +  +  E+ ++++++ +      +A    
Sbjct: 303 QPHPDLAHVFAEVEPEETAPQRVKRFDQLARLKPQDDETRLVMAELHIVAEDFPEARRAL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLSSVWLP 407
              ++ AP   +  L+A IE+    +      W   AL A   P W+  +  ++ + W P
Sbjct: 363 GDLVERAPDARVLTLMAAIEKGEGADNAVTQAWLARALTAPRGPQWLCTNCNHIHAEWAP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINF 437
           +     +     W+ P ++PE  S+  ++ 
Sbjct: 423 VCEHCTSFDTLSWQRP-ETPEVASATGVHM 451


>gi|89067497|ref|ZP_01155010.1| HemY domain protein [Oceanicola granulosus HTCC2516]
 gi|89047066|gb|EAR53120.1| HemY domain protein [Oceanicola granulosus HTCC2516]
          Length = 495

 Score =  119 bits (297), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 106/409 (25%), Positives = 193/409 (47%), Gaps = 33/409 (8%)

Query: 43  VILSILYFFLFAWILLFAVSRFF--LSCPAMLFHMLH-----------KRNYDKGYKALY 89
           V L+ L   +   +L+ A+  FF  L   + LFH L+           KR   +G++AL 
Sbjct: 41  VTLTTLQLAIAFVVLVLAIWLFFKLLGLLSALFHFLNGDETAVSRYFNKRTERRGFEALS 100

Query: 90  TGLMSIAAHNIPLA----RKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEM 145
            G+M++AA +  LA     K   Y+ +        L  LL+ Q A       +A +  ++
Sbjct: 101 EGMMALAAGDGQLALVKAEKADRYLDRPE------LTNLLKAQAAERAGDRRVAEDTYKL 154

Query: 146 MLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWS 205
           +LQ   TR   V  L  +    G+  +A + A +A  +SP    V+  +++     ++W+
Sbjct: 155 LLQDDRTRFVGVQGLMRQKLEAGETETAMQLAQRAFALSPKNDEVSNTLLRLQAEHEDWA 214

Query: 206 RAITFLNQKKKNA---KEWNRNR-AILLIARSLENADKGDMIASYHDAIESLKLCDNSIM 261
            A   L  + K     ++ +R R A+L ++ + E   +G   A++ +AIE+ +L  + I 
Sbjct: 215 GARQTLGARLKTGAIPRDVHRRRDAVLALSEAREKLLEGKDAAAHEEAIEANRLSPDLIP 274

Query: 262 ASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLL-SENTVGKLKRALRLEEI 320
           A+I AA+  I QN  R A  +L+K W+  PHP++A  +  +   E    ++KR   L  +
Sbjct: 275 AAIMAARGYIDQNNGRSAARVLKKAWEAQPHPDLAAAFADIKPDEGPAERIKRFRDLTRV 334

Query: 321 NKESVESLVIVSKIALEMGSIDQAHAKAMLA--MKIAPRKEIFLLLAQIEQANSHNTDKI 378
           + +  E+ +++++  L + + D   AK  L   ++  P   +  L+A IE+    +   +
Sbjct: 335 HPDHSETRMLLAE--LHVAAEDFPEAKRALGDLVETDPTARVLTLMAAIERGAGADDTVV 392

Query: 379 LYWTQSALHAMPDPLWISDDGY-LSSVWLPLSPISKTLCYFEWKIPTKS 426
             W   AL A     WI D+ + +++ W P+ P  K+     WK P +S
Sbjct: 393 RGWLTKALTAPRGDQWICDNCHNVAAHWAPVCPNCKSFDTLAWKRPPQS 441


>gi|126738548|ref|ZP_01754253.1| HemY domain protein [Roseobacter sp. SK209-2-6]
 gi|126720347|gb|EBA17053.1| HemY domain protein [Roseobacter sp. SK209-2-6]
          Length = 503

 Score =  118 bits (295), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 109/445 (24%), Positives = 198/445 (44%), Gaps = 16/445 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWI--- 56
           +L+++ +F +I++     I++      V IT     Y  S    +L++    L  W+   
Sbjct: 5   LLKVLVFFAIIAVAAFGVIVLGETAGGVQITVAGTEYTLSALQSVLALGVLVLAVWVFFK 64

Query: 57  ---LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
              LL A  +F       +     K    KGY+AL  GLM++A+    LA    S  ++ 
Sbjct: 65  VLALLVATLKFLNGDETAISRYFDKGRERKGYQALSDGLMALASGEGRLAMAKASRAARY 124

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  L  LL  Q A        A +  + +L    TR   V  +  +    GD ++A
Sbjct: 125 --LEKPELTDLLTAQAAEMAGDTGKAADAYKRLLSNQNTRFVGVRGIMKQKLSEGDSDTA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
            + A KAL + P    V + ++Q    A++W+ A   L+ K K        + R  A+L 
Sbjct: 183 LQLAEKALALRPKHEEVQDTLLQLQAKAEDWAGARKTLSTKLKTGTLPRDVFKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ S E A     +     AIE+ +L  + + A+  AA++ + Q KKR A  IL+K W  
Sbjct: 243 LSASKEVAADTSSLEQREQAIEANRLSPDLVPAAAMAARAYLEQGKKRAAIKILKKAWSA 302

Query: 290 NPHPEIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A+ +  +  +E+   ++KR  +L  +N ++ E+ ++++++ +      +A    
Sbjct: 303 QPHPDLAHAFAEVEPNESASERVKRFDQLARLNPQNDETRLVMAELLIVAEDFPEARRVL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLSSVWLP 407
              ++ AP      L+A IE+        I  W   AL A   P W+ ++  ++ + W P
Sbjct: 363 GDLVERAPDARSLTLMAAIEKGEGAGDAVIQGWLARALSAPRGPQWLCENCNHIHAEWAP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISS 432
           +     +     WK P ++PE  S+
Sbjct: 423 VCEHCTSFDTLSWKRP-ETPELNSA 446


>gi|323135815|ref|ZP_08070898.1| HemY domain protein [Methylocystis sp. ATCC 49242]
 gi|322398906|gb|EFY01425.1| HemY domain protein [Methylocystis sp. ATCC 49242]
          Length = 464

 Score =  116 bits (291), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 100/364 (27%), Positives = 170/364 (46%), Gaps = 24/364 (6%)

Query: 84  GYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKL 143
           G   +  GL+++ A ++  AR   +    +     E L  +L  Q A     +  A +  
Sbjct: 84  GLDVISQGLVAVGAGDL--ARARKAAALAERLLPGEPLTQMLNAQAAQLSGDHQAAAKAF 141

Query: 144 EMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKE 203
             M   P T+   +  L+ E+ R  D  +A  +A  A +I+P  PW   AV++ +    +
Sbjct: 142 HKMTLKPETKLLGLRGLHIEAKRRQDAEAAHHFAKAAHEIAP-LPWAGSAVLEHHAAGGD 200

Query: 204 WSRAITF----LNQKKKNAKEWNRNRAILLIARSLENADKGDMIASYHDAI----ESLKL 255
           W +A       L  K  +A      RA++  A ++E   +       HDA+    ++LK 
Sbjct: 201 WEKARAAVEANLAAKAIDAATAQNLRAVIETAMAMEKERE-----HPHDALRLARQALKR 255

Query: 256 CDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLL-SENTVGKLKRA 314
                 A+  AA+ LI    +++A  ++E +W   PHP++A +Y   L  E+   ++ R 
Sbjct: 256 RPGFPPAAATAARVLIHHGDRKQALKLIETVWATKPHPDLAEVYFEALPDESNSQRVARI 315

Query: 315 LRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA----PRKEIFLLLAQIEQA 370
            +L  +  ++ ES  I+++ AL   + D   A+  LA  +A    P     LL+A+IE A
Sbjct: 316 EKLARLAPDAPESRHILAQAALS--ARDFTKAREALAPLVAAGQHPTAHTCLLMAEIEDA 373

Query: 371 NSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEWKIPTKSPEYI 430
            +  +  +  W      A  DP WI+D G +S  WLP+SP+S  L  FEWKIP  S +++
Sbjct: 374 QNGPSGPVREWLARGSRAPRDPAWIAD-GVVSKHWLPISPVSGKLDAFEWKIPPHSAQHL 432

Query: 431 SSEN 434
           + E 
Sbjct: 433 TEEG 436


>gi|254476677|ref|ZP_05090063.1| HemY domain protein [Ruegeria sp. R11]
 gi|214030920|gb|EEB71755.1| HemY domain protein [Ruegeria sp. R11]
          Length = 496

 Score =  116 bits (290), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 103/436 (23%), Positives = 189/436 (43%), Gaps = 15/436 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFA-WI--- 56
           +L+++ +  +++++     +++     V IT     Y  S    +  L   +FA W+   
Sbjct: 5   LLKILVFVAIVAVLAFGASLLTETAGGVQITVAGTEYTLSALQSVIALAVLVFAVWLGFK 64

Query: 57  ---LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
              LL A  RF       L     K    KGY+AL  G+M++A+    LA  M      +
Sbjct: 65  VLSLLIATLRFLNGDETALSRYWDKGRERKGYQALSDGMMALASGEGRLA--MAKAARAE 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
              +N  L  LL  Q A        A E  + ++   +TR   V  +  +    GD  +A
Sbjct: 123 KYLNNPELTDLLTAQAAEMAGDTKKAAEAYKRLVSNQSTRFVGVRGIMKQKLSEGDTETA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKE----WNRNRAILL 229
           ++ A KAL + P    V + ++     A++W+ A   L  K K        + R  A+L 
Sbjct: 183 RQLAEKALALRPKHEEVQDTLLTLQARAQDWAGARKTLTTKLKTGTLPRDVYKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ S    + G  +     AIE+ +L  + + A+  AA++ +S+ KKR A  +L+K W+ 
Sbjct: 243 LSASKAIVEDGATVEQQEQAIEANRLSPDLVPAAAMAARTYLSRGKKRNAIRVLKKAWEA 302

Query: 290 NPHPEIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A  +  +   E+   ++KR ++L  +  +  E+ +I++++ +      +A    
Sbjct: 303 QPHPDLAQAFAEVEPGESAQERVKRFVQLSRLAPQHDETRLIMAELNIVAEDFPEARRAL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLSSVWLP 407
              ++ AP      L+A IE+        I  W   AL A   P W+ D   ++ + W P
Sbjct: 363 GDLVERAPDARALTLMAAIEKGEGAPDAVIQGWLTRALSAPRGPQWVCDKCNHIHADWAP 422

Query: 408 LSPISKTLCYFEWKIP 423
           +     +     W  P
Sbjct: 423 VCENCASFDTLSWTRP 438


>gi|218507798|ref|ZP_03505676.1| hypothetical conserved membrane protein [Rhizobium etli Brasil 5]
          Length = 240

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 76/224 (33%), Positives = 113/224 (50%), Gaps = 4/224 (1%)

Query: 17  SFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHML 76
            F   +  P D+S+ W  ++Y+T   V +S +   + A ++++   R   + P  +    
Sbjct: 17  GFSWFADRPGDLSLIWEGQIYQTKLIVAVSAIIALIAAVMIVWWFVRLIWTSPHSVTRYF 76

Query: 77  HKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQY 136
             R  D+GY+AL TGL++  A N  LARKM +          E L+ LLE Q AL E ++
Sbjct: 77  RARKRDRGYQALSTGLIAAGAGNALLARKMAARSRGLIRADQEPLINLLEAQAALIEGRH 136

Query: 137 NIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQ 196
           + A  K E M   P TRE  +  LY E+ R+G   +A++YA KA D +P  PW  +A ++
Sbjct: 137 DEARAKFEAMANDPETRELGLRGLYLEARRLGANEAARQYAEKAADNAPYLPWAAQATLE 196

Query: 197 QYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLEN 236
               A  W  AI  L Q+K        E NR  A+LL AR+ E 
Sbjct: 197 YRSQAGHWDDAIRLLEQQKAARVVEKAEANRLHAVLLTARAAEK 240


>gi|163745151|ref|ZP_02152511.1| hypothetical protein OIHEL45_06170 [Oceanibulbus indolifex HEL-45]
 gi|161381969|gb|EDQ06378.1| hypothetical protein OIHEL45_06170 [Oceanibulbus indolifex HEL-45]
          Length = 501

 Score =  114 bits (286), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 105/440 (23%), Positives = 193/440 (43%), Gaps = 26/440 (5%)

Query: 4   LIRYFFVISLVIC-----SFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWIL 57
           LI+    + LV        F++ S     + +T     Y   P   ++++L      W+L
Sbjct: 5   LIKIVLFVVLVAALAWGAGFLLESQG--GIQLTVAGTEYTLGPLQSVIAVLLLMFAVWVL 62

Query: 58  LFAVSRF-----FLSCPAMLFHMLHKRNYD-KGYKALYTGLMSIAAHNIPLARKMHSYVS 111
           L  V+       FL+           RN + KGY+AL  GLM++A+    +A  M     
Sbjct: 63  LKIVALLSATWHFLNGDETALSRYFDRNRERKGYEALSDGLMALASGEGQVA--MAKAAK 120

Query: 112 QQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLN 171
                    L  LL  Q A        A      +++   TR   V  +  +    GD  
Sbjct: 121 ADRYLKRPALTNLLTAQAAELAGDRRKAERTYRKLVEDEKTRFVGVRGIMKQKLADGDTE 180

Query: 172 SAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA---KEWNRNR-AI 227
           +A + A KA  + P      + +++      +W+ A   L  K KN    ++ ++ R A+
Sbjct: 181 TALKLAEKAFALKPKHEETGDTLLKLQADKHDWTGARQTLQAKYKNGHLPRDVHKRRDAV 240

Query: 228 LLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIW 287
           L ++ + E   +G+ I +   AIE+ +L  + + A++ AA+S I+Q+K R A  +L+K W
Sbjct: 241 LALSEAREVIAEGNSIEAREAAIEANRLSPDLVPAAVMAARSYIAQDKPRYASKVLQKAW 300

Query: 288 KVNPHPEIANIYTHLLSENT-VGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHA 346
            V+PHP++A  +  +  + T   ++KR   L +   +  E+ +++++  L + + D   A
Sbjct: 301 SVHPHPDLAAAFAEVQPDETPQQRIKRFRALTKSQPDHPETKMLLAE--LHIANEDFPEA 358

Query: 347 KAMLA--MKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSS 403
           +  L   ++  P      L+A IE+    +   +  W   AL+    P WI ++  ++ +
Sbjct: 359 RRALGNLVETDPSARSVTLMAAIERGEGASDTVVKGWLTRALNVSRGPQWICENCHHIHA 418

Query: 404 VWLPLSPISKTLCYFEWKIP 423
            W P+    K+    EWK P
Sbjct: 419 EWKPICENCKSFDTLEWKTP 438


>gi|77462046|ref|YP_351550.1| hypothetical protein RSP_1508 [Rhodobacter sphaeroides 2.4.1]
 gi|77386464|gb|ABA77649.1| Uncharacterized HemY-like membrane protein [Rhodobacter sphaeroides
           2.4.1]
          Length = 482

 Score =  114 bits (284), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 110/469 (23%), Positives = 199/469 (42%), Gaps = 34/469 (7%)

Query: 4   LIRYFFVISLVICSFIIVSHYPED---VSITWGNRLYRTSPF-VILSILYFFLFAWILL- 58
           LI+    ++LV+      S   E    + +  G+      P   +++ L   L  W+ L 
Sbjct: 5   LIKILIFVALVVALTFGASQLMESGGALRLAVGDLELNLGPLQAVIAALLLILAVWLFLK 64

Query: 59  -----FAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHN----IPLARKMHSY 109
                FAV RF       +     +    KG +AL  G+M++AA      +  A K   Y
Sbjct: 65  IVGFLFAVLRFLNGDETAVSRYFDRSREQKGLRALSEGMMALAAGEPRTAMSRAAKARKY 124

Query: 110 VSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGD 169
           + Q        +  LL  Q A        A E  +++L+   TR   V  L  +    GD
Sbjct: 125 LGQN------AMTTLLNAQAAQQAGDSRRAQESYKLLLEDERTRFVGVRGLLKQKLDEGD 178

Query: 170 LNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNR 225
            ++A   A KA +I+P      + +++      +WS A + L+ K K+       + R  
Sbjct: 179 TDTALALAQKAFEINPKHSETQDILLKLQADLHDWSGARSTLSAKMKSGALPKAVYKRRD 238

Query: 226 AILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEK 285
           A+L +  + +  D+   I +   AI + K   + I A+  AA+S ++Q  K+ A  +L+K
Sbjct: 239 AVLALQTAKDVFDENASIEAREAAILANKQSPDLIPAAAMAARSYLAQGNKKYATRVLKK 298

Query: 286 IWKVNPHPEIANIYTHLLSENTVG-KLKRALRLEEINKESVESLVIVSKIALEMGSIDQA 344
            W+  PHP++A  +  +  + T   +LKR   L  I+ +  E+ +++++++L   + D  
Sbjct: 299 AWEAEPHPDLAAAFAEIEPDETPAERLKRFRTLTAIHPDHDETRMLIAELSL--AAEDFP 356

Query: 345 HAKAMLAMKIA--PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYL 401
            A+  L   +A  P +    ++A +E+    +   +  W   AL A   P W  D+   +
Sbjct: 357 GARRALGDIVARHPTQRALTIMAAVERGEGGDEAVVRGWLARALTAPRGPQWCCDNCQTV 416

Query: 402 SSVWLPLSPISKTLCYFEWKIPTK--SPEYISSENINF--SLEMAYPAD 446
            + W P+           W+ PT+  +P    +E +        A PAD
Sbjct: 417 HATWAPICDNCGGFDTLSWREPTQKSTPSATGTELLPLIVGAPAARPAD 465


>gi|149912845|ref|ZP_01901379.1| hypothetical protein RAZWK3B_02615 [Roseobacter sp. AzwK-3b]
 gi|149813251|gb|EDM73077.1| hypothetical protein RAZWK3B_02615 [Roseobacter sp. AzwK-3b]
          Length = 496

 Score =  113 bits (283), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 108/456 (23%), Positives = 198/456 (43%), Gaps = 27/456 (5%)

Query: 4   LIRYFFVISLVICSFIIVSHYPE---DVSITWGNRLYRTSPFVILSILYFFLFAWILL-- 58
           +++    I+LV  + +  +H  E    V I +G + +  +P   +  L   + A  LL  
Sbjct: 5   ILKIVGFIALVSAATLGAAHLIEMEGGVRIVFGGQEFNLTPIKAVIALIVLVIALWLLLK 64

Query: 59  -----FAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
                 A  +F       +     K   +KG++AL  G+M++A+    LA  M      +
Sbjct: 65  LVSLLVATLKFINGDETAISRYFDKNRQEKGFRALSEGMMALASGEGDLA--MSKASKAE 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  L  LL  Q A        A    + +L+   TR   V  L  +    GD  +A
Sbjct: 123 KYLRKPDLTNLLTAQAAELSGDTRKAELVYKKLLKDDRTRFVGVRGLMRQKLAAGDTETA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA---KEWNRNR-AILL 229
            + A  A  + P    V +A+++      +W  A   LN K K     ++ ++ R A+L 
Sbjct: 183 LKLAKTAFALKPRHGEVQDALLRLQAQTADWKGARETLNAKLKYGSLPRDLHKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ + +  D+G  I +   AIE+ +L  + + A++ AA+S ISQ  KR A  + +K W V
Sbjct: 243 LSEAKDVLDEGKDIEAREAAIEANRLSPDLVPAAVLAARSYISQGSKRYATRVTKKAWGV 302

Query: 290 NPHPEIANIYTHLLSENT-VGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
           +PHP++A  +  +  + T   +LKR  +L  ++ ++ E+ ++  K  L + + D   A+ 
Sbjct: 303 HPHPDLAAAFAEIEPDETPAQRLKRFSKLIAMHPDNRETKLL--KAELHLAAEDFPAARR 360

Query: 349 MLA--MKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLSSVW 405
            L   ++  P   +  ++A IE+    +   +  W   AL A   P W+ D+  ++ + W
Sbjct: 361 ALGDLVETDPDARVLTIMAAIERGEGSSDAVVKGWLARALSAPRGPQWVCDNCQHIHAEW 420

Query: 406 LPLSPISKTLCYFEWKIPTKSPEYISSENINFSLEM 441
            P            WK P      +S+   +  +EM
Sbjct: 421 APACDHCNAFDTLTWKTPP-----VSTMTTSTGIEM 451


>gi|298292771|ref|YP_003694710.1| HemY domain protein [Starkeya novella DSM 506]
 gi|296929282|gb|ADH90091.1| HemY domain protein [Starkeya novella DSM 506]
          Length = 526

 Score =  113 bits (283), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 109/431 (25%), Positives = 202/431 (46%), Gaps = 16/431 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTS----PFVILSILYFFLFAWI 56
           M+RL+ Y  V++L+      ++  P  ++I W      TS       +L++L   +  W 
Sbjct: 1   MIRLVVYLLVLALIAFGVAWLADRPGSIAIDWQGWQIETSILVAASALLALLAATILLWT 60

Query: 57  LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTF 116
           LL    R     P ++      R  ++G+ A+  GL+++ + +   AR+  +    +   
Sbjct: 61  LL----RLIFRSPELIAFSWRSRRRNRGWAAVTRGLVAVGSGDALGARRAAN--DAERLL 114

Query: 117 HNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRY 176
            +E L  LL  Q A      + A      M + P+TR   +  L+ E+ R GD  +A   
Sbjct: 115 GHEPLTRLLAAQAAQLAGDRDGAEAAFRAMSETPSTRLLGLRGLHVEARRRGDAAAALLS 174

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK---EWNRNRAILLIARS 233
           A +A  + P   W  +AV++   L  +++ A+  L ++  +       +R R  +L+A  
Sbjct: 175 AEEAARVEPGLAWAADAVIEARCLNGDFAGALATLEREAAHGGLERAAHRRRRAVLLAAQ 234

Query: 234 LENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHP 293
            +  +  D   +   A+E+ +L    + A+  A + L +    RKA  I+E  +   PHP
Sbjct: 235 AQALELSDPSTAREKAVEATRLAPTLVPAAEVAGRLLGASGDTRKAAKIIEAAYAATPHP 294

Query: 294 EIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAM 352
           ++A+ + HL   +++  +LKR   L        ES +++++ A++    D A   A+  +
Sbjct: 295 DLADAFLHLRPGDSSQERLKRIRTLTARMPSHPESAMVLARAAIDAQEFDVAR-TALGPL 353

Query: 353 KIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPIS 412
              P +   LL+A++E A   +  K   WT  A+ A  DP W++ DG ++  W P+SP++
Sbjct: 354 LGEPTQRACLLMAELEAAEHGDVGKAREWTARAVRAARDPAWVA-DGVVAERWAPVSPVT 412

Query: 413 KTLCYFEWKIP 423
             L  FEWK+P
Sbjct: 413 GKLDAFEWKLP 423


>gi|126460935|ref|YP_001042049.1| HemY domain-containing protein [Rhodobacter sphaeroides ATCC 17029]
 gi|126102599|gb|ABN75277.1| HemY domain protein [Rhodobacter sphaeroides ATCC 17029]
          Length = 482

 Score =  113 bits (282), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 110/469 (23%), Positives = 198/469 (42%), Gaps = 34/469 (7%)

Query: 4   LIRYFFVISLVICSFIIVSHYPED---VSITWGNRLYRTSPF-VILSILYFFLFAWILL- 58
           LI+    ++LV+      S   E    + +  G+      P   +++ L   L  W+ L 
Sbjct: 5   LIKILIFVALVVALTFGASQLMESGGALRLAVGDLELNLGPLQAVIAALLLILAVWLFLK 64

Query: 59  -----FAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHN----IPLARKMHSY 109
                FAV RF       +     +    KG +AL  G+M++AA      +  A K   Y
Sbjct: 65  IVGFLFAVLRFLNGDETAVSRYFDRSREQKGLRALSEGMMALAAGEPRTAMSRAAKARKY 124

Query: 110 VSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGD 169
           + Q        +  LL  Q A        A E  +++L+   TR   V  L  +    GD
Sbjct: 125 LGQN------AMTTLLNAQAAQQAGDSRRAQESYKLLLEDERTRFVGVRGLLKQKLDEGD 178

Query: 170 LNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNR 225
             +A   A KA +I+P      + +++      +WS A + L+ K K+       + R  
Sbjct: 179 TETALALAQKAFEINPKHSETQDILLKLQADLHDWSGARSTLSAKMKSGALPKAVYKRRD 238

Query: 226 AILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEK 285
           A+L +  + +  D+   I +   AI + K   + I A+  AA+S ++Q  K+ A  +L+K
Sbjct: 239 AVLALQTAKDVFDENASIEAREAAILANKQSPDLIPAAAMAARSYLAQGNKKYATRVLKK 298

Query: 286 IWKVNPHPEIANIYTHLLSENTVG-KLKRALRLEEINKESVESLVIVSKIALEMGSIDQA 344
            W+  PHP++A  +  +  + T   +LKR   L  I+ +  E+ +++++++L   + D  
Sbjct: 299 AWEAEPHPDLAAAFAEIEPDETPAERLKRFRTLTAIHPDHDETRMLIAELSL--AAEDFP 356

Query: 345 HAKAMLAMKIA--PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYL 401
            A+  L   +A  P +    ++A +E+    +   +  W   AL A   P W  D+   +
Sbjct: 357 GARRALGDIVARHPTQRALTIMAAVERGEGGDEAVVRGWLARALTAPRGPQWCCDNCQTV 416

Query: 402 SSVWLPLSPISKTLCYFEWKIPTK--SPEYISSENINF--SLEMAYPAD 446
            + W P+           W+ PT+  +P    +E +        A PAD
Sbjct: 417 HATWAPICDNCGGFDTLSWREPTQKSTPSATGTELLPLIVGAPAARPAD 465


>gi|332559973|ref|ZP_08414295.1| HemY domain-containing protein [Rhodobacter sphaeroides WS8N]
 gi|332277685|gb|EGJ23000.1| HemY domain-containing protein [Rhodobacter sphaeroides WS8N]
          Length = 482

 Score =  112 bits (281), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 110/469 (23%), Positives = 198/469 (42%), Gaps = 34/469 (7%)

Query: 4   LIRYFFVISLVICSFIIVSHYPED---VSITWGNRLYRTSPF-VILSILYFFLFAWILL- 58
           LI+    ++LV+      S   E    + +  G+      P   +++ L   L  W+ L 
Sbjct: 5   LIKILIFVALVVALTFGASELMESGGALRLAVGDLELNLGPLQAVIAALLLILAVWLFLK 64

Query: 59  -----FAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHN----IPLARKMHSY 109
                FAV RF       +     +    KG +AL  G+M++AA      +  A K   Y
Sbjct: 65  IVGFLFAVLRFLNGDETAVSRYFDRSREQKGLRALSEGMMALAAGEPRTAMSRAAKARKY 124

Query: 110 VSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGD 169
           + Q        +  LL  Q A        A E  +++L+   TR   V  L  +    GD
Sbjct: 125 LGQN------AMTTLLNAQAAQQAGDSRRAQESYKLLLEDERTRFVGVRGLLKQKLDEGD 178

Query: 170 LNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNR 225
             +A   A KA +I+P      + +++      +WS A + L+ K K+       + R  
Sbjct: 179 TETALALAQKAFEINPKHSETQDILLKLQADLHDWSGARSTLSAKMKSGALPKAVYKRRD 238

Query: 226 AILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEK 285
           A+L +  + +  D+   I +   AI + K   + I A+  AA+S ++Q  K+ A  +L+K
Sbjct: 239 AVLALQTAKDVFDENASIEAREAAILANKQSPDLIPAAAMAARSYLAQGNKKYATRVLKK 298

Query: 286 IWKVNPHPEIANIYTHLLSENTVG-KLKRALRLEEINKESVESLVIVSKIALEMGSIDQA 344
            W+  PHP++A  +  +  + T   +LKR   L  I+ +  E+ +++++++L   + D  
Sbjct: 299 AWEAEPHPDLAAAFAEIEPDETPAERLKRFRTLTAIHPDHDETRMLIAELSL--AAEDFP 356

Query: 345 HAKAMLAMKIA--PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYL 401
            A+  L   +A  P +    ++A +E+    +   +  W   AL A   P W  D+   +
Sbjct: 357 GARRALGDIVARHPTQRALTIMAAVERGEGGDEAVVRGWLARALTAPRGPQWCCDNCQTV 416

Query: 402 SSVWLPLSPISKTLCYFEWKIPTK--SPEYISSENINF--SLEMAYPAD 446
            + W P+           W+ PT+  +P    +E +        A PAD
Sbjct: 417 HATWAPICDNCGGFDTLSWREPTQKSTPSATGTELLPLIVGAPAARPAD 465


>gi|146278943|ref|YP_001169102.1| HemY domain-containing protein [Rhodobacter sphaeroides ATCC 17025]
 gi|145557184|gb|ABP71797.1| HemY domain protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 482

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 110/452 (24%), Positives = 190/452 (42%), Gaps = 28/452 (6%)

Query: 4   LIRYFFVISLVICSFIIVSHYPED---VSITWGNRLYRTSPF--VILSILYFF---LFAW 55
           LI+    ++LV+      S   E    + +  GN      P   VI ++L  F   LF  
Sbjct: 5   LIKILIFVALVVGLTFGASMLMESGGALRLAVGNLELNLGPLQAVIAALLLIFTVWLFLK 64

Query: 56  IL--LFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHN----IPLARKMHSY 109
           I+  LFAV RF       +     +    KG +AL  G+M++AA      +  A K   Y
Sbjct: 65  IMGFLFAVLRFLNGDETAVSRYFDRSREQKGLRALSEGMMALAAGEPRMAMSRASKARKY 124

Query: 110 VSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGD 169
           + Q        +  LL  Q A        A E  +++LQ   T+   +  L  +    GD
Sbjct: 125 LGQN------AMTTLLNAQAAQQAGDSRRAQESYKLLLQDERTKFVGIRGLLKQKLDEGD 178

Query: 170 LNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK----EWNRNR 225
             +A   A KA +I+P      + +++      +WS A + L  K K+       + R  
Sbjct: 179 TETALALAQKAFEINPKHSETQDILLKLQADRHDWSGARSTLTAKMKSGALPKAVYKRRD 238

Query: 226 AILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEK 285
           A+L +  + +  D+   I +   AI + K   + I A+  AA+S ++Q  K+ A  +L+K
Sbjct: 239 AVLALQTAKDVFDENASIEAREAAILANKQSPDLIPAAAMAARSYLAQGNKKYATRVLKK 298

Query: 286 IWKVNPHPEIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQA 344
            W+  PHP++A  +  +  +E  V +LKR   L  IN +  ES ++ ++++L       A
Sbjct: 299 AWEAEPHPDLAAAFAEIEPNETPVERLKRFRTLTSINPDHEESRLLTAELSLAAEDFPAA 358

Query: 345 HAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLSS 403
                  +   P +    ++A +E+    +   +  W   AL A   P W  D+   + +
Sbjct: 359 RRALGDIVSRHPTQRSLTIMAAVERGEGGDEAVVRGWLARALSAPRGPQWCCDNCQTVHA 418

Query: 404 VWLPLSPISKTLCYFEWKIPTK--SPEYISSE 433
            W P+           W+ PT+  +P    +E
Sbjct: 419 NWAPICDNCGGFDTLSWREPTRKSTPSATGTE 450


>gi|149204332|ref|ZP_01881299.1| HemY domain protein [Roseovarius sp. TM1035]
 gi|149142217|gb|EDM30264.1| HemY domain protein [Roseovarius sp. TM1035]
          Length = 490

 Score =  112 bits (279), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 91/391 (23%), Positives = 168/391 (42%), Gaps = 8/391 (2%)

Query: 43  VILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPL 102
           V++ I++  +    LL A  +F       L     +   DKGY+AL  G++++A+    +
Sbjct: 54  VLVFIIWLLMKLTGLLVASLKFINGDETALSRYFDRSRQDKGYRALSEGMLALASGEGEV 113

Query: 103 ARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYF 162
           A  M      +       L  L+  Q A        A E  + +L    TR   V  +  
Sbjct: 114 A--MAQVAKAEKYLRKPALTNLITAQAAEMAGNRRKAEEVYKQLLTNEKTRFVGVRGILR 171

Query: 163 ESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA---K 219
           +    GD  +A + A  A  + P    V + ++       +W  A   LN K K     +
Sbjct: 172 QKLAEGDTETALKLAKTAFALKPRHAEVQDTLLDLQAKTSDWKGARETLNAKLKYGSLPR 231

Query: 220 EWNRNR-AILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRK 278
           + ++ R A+L ++ + +  D+G  I +   AIE+ +L  + I A++ AA+  I Q   R 
Sbjct: 232 DVHKRRDAVLALSEARDVLDEGKTIEAREAAIEANRLSPDLIPAAVLAARGYIDQGNTRN 291

Query: 279 AEVILEKIWKVNPHPEIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALE 337
           A  ++ K W V PHP++A  +  +  +E+   +LKR  +L +++ E+ E+ ++ +++ L 
Sbjct: 292 ALRVINKAWLVRPHPDLAAAFAAIEPNESPRQRLKRFAKLLKVHPENRETRLLEAELNLA 351

Query: 338 MGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISD 397
                 A        ++ P      ++A IE+    +   +  W   AL A   P W+ D
Sbjct: 352 AEDFPAARRALGTLAEVEPDARALTIMAAIERGEGASDAVVKGWLARALSAPRGPQWVCD 411

Query: 398 D-GYLSSVWLPLSPISKTLCYFEWKIPTKSP 427
              ++ + W P      +     W+ P  SP
Sbjct: 412 KCQHIHAEWAPACENCNSFDTLSWRAPPNSP 442


>gi|221640998|ref|YP_002527260.1| HemY domain-containing protein [Rhodobacter sphaeroides KD131]
 gi|221161779|gb|ACM02759.1| HemY domain protein precursor [Rhodobacter sphaeroides KD131]
          Length = 478

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 109/469 (23%), Positives = 198/469 (42%), Gaps = 34/469 (7%)

Query: 4   LIRYFFVISLVICSFIIVSHYPED---VSITWGNRLYRTSPF-VILSILYFFLFAWILL- 58
           +I+    ++LV+      S   E    + +  G+      P   +++ L   L  W+ L 
Sbjct: 1   MIKILIFVALVVALTFGASQLMESGGALRLAVGDLELNLGPLQAVIAALLLILAVWLFLK 60

Query: 59  -----FAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHN----IPLARKMHSY 109
                FAV RF       +     +    KG +AL  G+M++AA      +  A K   Y
Sbjct: 61  IVGFLFAVLRFLNGDETAVSRYFDRSREQKGLRALSEGMMALAAGEPRTAMSRAAKARKY 120

Query: 110 VSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGD 169
           + Q        +  LL  Q A        A E  +++L+   TR   V  L  +    GD
Sbjct: 121 LGQN------AMTTLLNAQAAQQAGDSRRAQESYKLLLEDERTRFVGVRGLLKQKLDEGD 174

Query: 170 LNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNR 225
             +A   A KA +I+P      + +++      +WS A + L+ K K+       + R  
Sbjct: 175 TETALALAQKAFEINPKHSETQDILLKLQADLHDWSGARSTLSAKMKSGALPKAVYKRRD 234

Query: 226 AILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEK 285
           A+L +  + +  D+   I +   AI + K   + I A+  AA+S ++Q  K+ A  +L+K
Sbjct: 235 AVLALQTAKDVFDENASIEAREAAILANKQSPDLIPAAAMAARSYLAQGNKKYATRVLKK 294

Query: 286 IWKVNPHPEIANIYTHLLSENTVG-KLKRALRLEEINKESVESLVIVSKIALEMGSIDQA 344
            W+  PHP++A  +  +  + T   +LKR   L  I+ +  E+ +++++++L   + D  
Sbjct: 295 AWEAEPHPDLAAAFAEIEPDETPAERLKRFRTLTAIHPDHDETRMLIAELSL--AAEDFP 352

Query: 345 HAKAMLAMKIA--PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYL 401
            A+  L   +A  P +    ++A +E+    +   +  W   AL A   P W  D+   +
Sbjct: 353 GARRALGDIVARHPTQRALTIMAAVERGEGGDEAVVRGWLARALTAPRGPQWCCDNCQTV 412

Query: 402 SSVWLPLSPISKTLCYFEWKIPTK--SPEYISSENINF--SLEMAYPAD 446
            + W P+           W+ PT+  +P    +E +        A PAD
Sbjct: 413 HATWAPICDNCGGFDTLSWREPTQKSTPSATGTELLPLIVGAPAARPAD 461


>gi|254510666|ref|ZP_05122733.1| HemY domain protein [Rhodobacteraceae bacterium KLH11]
 gi|221534377|gb|EEE37365.1| HemY domain protein [Rhodobacteraceae bacterium KLH11]
          Length = 498

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 102/450 (22%), Positives = 195/450 (43%), Gaps = 16/450 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF---VILSILYF----FLF 53
           +L+++ +  +I L+      +      V IT     Y   P    + L +L F    F  
Sbjct: 5   LLKILVFVAIIGLLAMGAGFLMESSGGVQITVAGTEYTLGPLQSAIALGVLVFAVWLFFK 64

Query: 54  AWILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
              LL A  +F       L     +    +GY+AL  GLM++A+    +A  M      +
Sbjct: 65  LLTLLVATLKFLNGDETALSRYFDRSREKRGYQALADGLMALASGEGRVA--MTKANKAE 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
              +   L  LL  Q A        A E  + ++   +TR   V  +  +    GD  +A
Sbjct: 123 KLLNKPELTNLLVAQAAEMTGDTKKASETYKKLVANNSTRFVGVRGIMKQKLSEGDDETA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
            + A KAL I P      + ++     A++W+ A + LN K K        + R  A+L 
Sbjct: 183 LKLAEKALAIKPRHEETQDVLLNLQTRAQDWAGARSTLNSKLKAGYLPRDVFKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ + +  D+   +     AIE+ +L  + + A+  AA++ I + K R A  IL+K W+ 
Sbjct: 243 LSEAKDILDETASVEQQEHAIEANRLSPDLVPAAAMAARAYIEKGKPRAAAKILKKAWEA 302

Query: 290 NPHPEIANIYTHLLSENT-VGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A+ +   + + T   ++KR   L  I+ +++E+ +I++++ +      +A    
Sbjct: 303 QPHPDLAHAFAEAVPDETPEQRIKRFTALTRIHPDNMETRLILAELNIVAEDFPEARRAL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGY-LSSVWLP 407
              ++       + L+A IE+    +   +  W   AL+A   P W+ D+ + + + W P
Sbjct: 363 GDVVEKQGDARAYTLMAAIERGEGASDAVVQGWLAKALNAPRGPQWVCDNCHDIQAEWAP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINF 437
           +     +     W+ P ++PE  S   ++ 
Sbjct: 423 ICQNCGSFDTLSWQTP-QTPEIASVTGVHM 451


>gi|182678175|ref|YP_001832321.1| HemY domain-containing protein [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182634058|gb|ACB94832.1| HemY domain protein [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 493

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 120/482 (24%), Positives = 218/482 (45%), Gaps = 30/482 (6%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ +  +I+ +      +   P    +TW      TS  V +++L        L   
Sbjct: 1   MLRVLLFLCLIAALALGAAWIGEQPGHFLMTWQGYQVETSAPVAITLLGVSAAILALALW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +    L+ P         R  +KGY AL  G+++  A +  +A K  + +  Q     + 
Sbjct: 61  LLVTILNLPKTFARWRETRLKNKGYAALSRGIVAAGAGDTHVANK--AALDAQKYLPKDP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           LV +LE Q A      + A +   +M + P  R   +  LY E+ R  D  +A  +A +A
Sbjct: 119 LVLVLEAQAAQLAGDRSRAQDAFRLMGERPEMRLLGLRGLYAEALRNDDSEAAYHFAHEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK-----EWNRNRAILLIARSLE 235
             + P  PW  +AV+ +++ A++W  A   L  K+ NA+        R  AIL  A + E
Sbjct: 179 HKVHP-LPWSAKAVLDEHIRAQDWEGAFGILG-KQINAQLVDKATGERQCAILETAMAQE 236

Query: 236 NADKGDMIASYHDAI----ESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
                  +++  +A+    ++LK   + + A +  A     +N  R+A  ++E+ W    
Sbjct: 237 KE-----LSAPDEALRLGRQALKHAPDLVPAIVLVAHLWGRKNDVRRAAKLIEREWPNIQ 291

Query: 292 HPEIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSK--IALEMGSIDQAHAKA 348
           HP+IA  Y  L   ++ + +L+RA RL  +   S ES + V+   IA    ++ +   + 
Sbjct: 292 HPDIALAYLDLRPGDSNMDRLRRAQRLARLAPGSAESRLSVAGAAIAARQFALARETMRE 351

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPL 408
           +LA +  P   +  L+A++E+  S  +  +  W   A  A  D  W++D G++S  WLP 
Sbjct: 352 LLAKEKTPTVRMCQLMAELEETESGFSGSVREWLAKASRAPRDETWVAD-GFVSPKWLPA 410

Query: 409 SPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSS 468
           SP++  L  F W+ P         E +  +L+ A   ++   +L+  +K+   + KK + 
Sbjct: 411 SPVTGQLDAFRWQRPV--------ERLVVTLDNAEAVEETALLLSEEEKHGADTSKKAAV 462

Query: 469 FE 470
            E
Sbjct: 463 QE 464


>gi|83950381|ref|ZP_00959114.1| HemY domain protein [Roseovarius nubinhibens ISM]
 gi|83838280|gb|EAP77576.1| HemY domain protein [Roseovarius nubinhibens ISM]
          Length = 525

 Score =  111 bits (277), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 94/374 (25%), Positives = 167/374 (44%), Gaps = 13/374 (3%)

Query: 63  RFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLV 122
           RF       +     +   +KGY+AL  G+M++A+    LA  M      +   H   L 
Sbjct: 74  RFINGDETAMSRYFDRNRQEKGYRALTEGMMALASGEGKLA--MSRAARAEKYLHKPELT 131

Query: 123 YLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALD 182
            LL  Q A        A E  + +L+   TR   V  L  +    GD ++A + A  A  
Sbjct: 132 NLLTAQAAELTGDRRTAEEVYKRLLKDDKTRFVGVRGLLKQKIEEGDTDTALKLAETAFG 191

Query: 183 ISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA---KEWNRNR-AILLIARSLENAD 238
           + P    V + ++Q      +W  A   LN K K+    ++ +R R AIL +A + + A 
Sbjct: 192 LKPTHEEVQDTLLQLQAGQADWKGARATLNAKLKHGSLPRDLHRRRDAILALAEARDIAA 251

Query: 239 KGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANI 298
           +   I +   AIE+ +L  + + A++ AA++ I    KR A  ++ K W+  PHP++A  
Sbjct: 252 ENSTIEAKETAIEANRLSPHLVPAAVMAAQAYIEDGSKRYATRVIRKAWESQPHPDLAAA 311

Query: 299 YTHLLSENTVG-KLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAM--KIA 355
           Y  +  + T   +LKR  +L +++ +  E+ ++ ++  L++ + D   A+  L    + A
Sbjct: 312 YAAIEPDETPDQRLKRFAKLFKLSPDHPEAKLVEAE--LQIAAEDFPAARRALGTLAETA 369

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLSSVWLPLSPISKT 414
           P      ++A IE+    N   +  W   A+ A   P WI ++  ++   W P       
Sbjct: 370 PDARSLTIMAAIERGAGANDTVVKGWLARAVAAARGPQWICENCQHIHHEWAPTCAHCHA 429

Query: 415 LCYFEWK-IPTKSP 427
           +   EW+  P  +P
Sbjct: 430 VDTLEWRNAPGAAP 443


>gi|83941980|ref|ZP_00954442.1| HemY domain protein [Sulfitobacter sp. EE-36]
 gi|83847800|gb|EAP85675.1| HemY domain protein [Sulfitobacter sp. EE-36]
          Length = 503

 Score =  110 bits (276), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 104/441 (23%), Positives = 185/441 (41%), Gaps = 19/441 (4%)

Query: 1   MLRLIRYFFVISLVI--CSFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWI- 56
           +++++ +  VI+ +    SF++ S     V++      Y   P   +++++   +  WI 
Sbjct: 5   LIKIVVFVAVIAAITWGASFLLESSGGLQVTVM--GTEYSFGPLQSVIAVVLLIVAVWIM 62

Query: 57  -----LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVS 111
                LL AV  F       L     +    KGY+AL  GLM++A+    LA  M     
Sbjct: 63  LKIFALLVAVWHFLNGDETALSRYFDRNRERKGYEALSEGLMALASGEGRLA--MAKAAK 120

Query: 112 QQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLN 171
                    L  LL  Q A        A E    ++    TR   V  +  +    GD  
Sbjct: 121 ADKYLERPDLTNLLIAQAAEMAGDRRKAEETYRKLVTNERTRFVGVRGIMKQKLAEGDTE 180

Query: 172 SAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKE----WNRNRAI 227
           +A + A KA  I P      + +++     ++W+ A   LN K KN +       R  A+
Sbjct: 181 TALKLAEKAFAIKPKHAETGDVLLKLQAEKEDWAGARQTLNTKLKNGQMPRDVHKRRDAV 240

Query: 228 LLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIW 287
           L ++ + +   +G+ I +   AIE+ +L  + I A++ AA   I Q K + A  +L+K W
Sbjct: 241 LALSEAKDVIAEGNSIEAREAAIEANRLSPDLIPAAVMAAHGYIDQGKPKYAARVLKKAW 300

Query: 288 KVNPHPEIANIYTHLLSENTVG-KLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHA 346
            V PHP++A  +  +  + T   +LKR   L  +  +  E+ ++++++ +      QA  
Sbjct: 301 DVQPHPDLAGAFAAIQPDETPKERLKRFTTLTRVQPDHPETKMLLAELNIAAEDFPQARR 360

Query: 347 KAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLSSVW 405
                ++  P      L+A IE+    +   +  W   AL     P WI D+  ++ + W
Sbjct: 361 SLGDLVETDPTARSVTLMAAIERGEGASDTIVKGWLARALTVSRGPQWICDNCQHIHASW 420

Query: 406 LPLSPISKTLCYFEWKIPTKS 426
            P+     +     WK P  S
Sbjct: 421 KPICENCHSFDTLAWKTPPMS 441


>gi|84684559|ref|ZP_01012460.1| Uncharacterized HemY-like membrane protein [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84667538|gb|EAQ14007.1| Uncharacterized HemY-like membrane protein [Rhodobacterales
           bacterium HTCC2654]
          Length = 504

 Score =  107 bits (266), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 97/439 (22%), Positives = 179/439 (40%), Gaps = 15/439 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWILL- 58
           + ++I +  +I         +      + +  G + Y       +++++   +  WILL 
Sbjct: 5   LFKIILFVVLIGAATVGATYLLETDGGIRVDIGAQEYNLGALQAVIALIVLVVTLWILLK 64

Query: 59  -----FAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
                 A  RF       +     +    KGY+AL  G+M++A+     A  +      +
Sbjct: 65  LAGLIVATIRFLNGDETAISRHFDRNRERKGYEALADGMMALASGEERTA--ITKAARAE 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  L  L+  Q A        A E  + +L    TR   V  L  +    GD ++A
Sbjct: 123 RYLRRPELTNLITAQAAEMAGDRKKATEVYKRLLADERTRFVGVRGLMKQKLEEGDTDTA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA---KEWNRNR-AILL 229
            + A KA  + P      + ++       +W  A   L +K K+    K+  + R A+L 
Sbjct: 183 MKLAEKAFALKPQHAETGDVLLALQATQNDWHGARETLGKKVKHGALPKDVGKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           +  +      G+ I +   AIE+ KL  + I  S+ AA+S + Q+ KR A  +L K WKV
Sbjct: 243 LQEAKGIFQDGNSIRAREAAIEANKLSPDLIPGSVLAARSYLEQDNKRYAARVLTKTWKV 302

Query: 290 NPHPEIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP+IA  +  +  +E    +LKR   L + + +  E+ ++++++ +     D+A    
Sbjct: 303 QPHPDIAEAFAEIEPNETPEQRLKRFKALTKEHPDHPENKMLLAELHIAAEQFDKAREAL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGY-LSSVWLP 407
                  P + +  L+A IE+       +I  W   A+ A   P W+ D  + + + W P
Sbjct: 363 GDLPTTKPTQRVLTLMAAIERGLEAPDSEIRAWLAKAVVAPRGPQWVCDKCHTVHADWGP 422

Query: 408 LSPISKTLCYFEWKIPTKS 426
           +           W  P ++
Sbjct: 423 VCENCGAFDTLSWSEPRET 441


>gi|83953029|ref|ZP_00961751.1| HemY domain protein [Sulfitobacter sp. NAS-14.1]
 gi|83841997|gb|EAP81165.1| HemY domain protein [Sulfitobacter sp. NAS-14.1]
          Length = 503

 Score =  106 bits (265), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 95/384 (24%), Positives = 160/384 (41%), Gaps = 8/384 (2%)

Query: 49  YFFLFAWILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHS 108
           +  L  + LL AV  F       L     +    KGY+AL  GLM++A+    LA  M  
Sbjct: 60  WIMLKIFALLVAVWHFLNGDETALSRYFDRNRERKGYEALSEGLMALASGEGRLA--MAK 117

Query: 109 YVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIG 168
                       L  LL  Q A        A E    ++    TR   V  +  +    G
Sbjct: 118 AAKADKYLERPDLTNLLIAQAAEMAGDRRKAEETYRKLVTNERTRFVGVRGIMKQKLAEG 177

Query: 169 DLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKE----WNRN 224
           D  +A + A KA  I P      + +++     ++W+ A   LN K KN +       R 
Sbjct: 178 DTETALKLAEKAFAIKPKHAETGDVLLKLQAEKEDWAGARQTLNTKLKNGQMPRDVHKRR 237

Query: 225 RAILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILE 284
            A+L ++ + +   +G+ I +   AIE+ +L  + I A++ AA   I Q K + A  +L+
Sbjct: 238 DAVLALSEAKDVIAEGNSIEAREAAIEANRLSPDLIPAAVMAAHGYIDQGKPKYAARVLK 297

Query: 285 KIWKVNPHPEIANIYTHLLSENTVG-KLKRALRLEEINKESVESLVIVSKIALEMGSIDQ 343
           K W V PHP++A  +  +  + T   +LKR   L  +  +  E+ ++++++ +      Q
Sbjct: 298 KAWDVQPHPDLAGAFAAIQPDETPKERLKRFTTLTRVQPDHPETKMLLAELNIAAEDFPQ 357

Query: 344 AHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLS 402
           A       ++  P      L+A IE+    +   +  W   AL     P WI D+  ++ 
Sbjct: 358 ARRSLGDLVETDPTARSVTLMAAIERGEGASDTIVKGWLARALTVSRGPQWICDNCQHIH 417

Query: 403 SVWLPLSPISKTLCYFEWKIPTKS 426
           + W P+     +     WK P  S
Sbjct: 418 ASWKPICENCHSFDTLAWKTPPMS 441


>gi|261884328|ref|ZP_06008367.1| hypothetical protein CfetvA_03481 [Campylobacter fetus subsp.
           venerealis str. Azul-94]
          Length = 266

 Score =  106 bits (265), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 70/208 (33%), Positives = 112/208 (53%), Gaps = 13/208 (6%)

Query: 222 NRNRAILLIARSLENADKGDMIASYHD-----AIESLKLCDNSIMASICAAKSLISQNKK 276
            + RA LL A+++   D      ++H      A+E+ KL  + + A++ AA++L +  + 
Sbjct: 13  KKERAALLTAKAMATLD------THHAHAKAIALEANKLAPDLVPAAVVAARALFADGEI 66

Query: 277 RKAEVILEKIWKVNPHPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIA 335
           RK   ILE  WK  PHP+IA+ Y +  S +T   +LKRA  L  +   + E  + +++ A
Sbjct: 67  RKGSKILEAAWKRFPHPDIASTYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAA 126

Query: 336 LEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWI 395
            E G    A   A   ++ APR+  +LLLA IE+A + +  K+  W   A+ A  DP W 
Sbjct: 127 YEAGEYSVARDNAEQVLRAAPRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWT 186

Query: 396 SDDGYLSSVWLPLSPISKTLCYFEWKIP 423
           + D Y+   W P+SP++  L  FEWK+P
Sbjct: 187 A-DCYVCEQWSPVSPVTGRLNSFEWKVP 213


>gi|84501232|ref|ZP_00999437.1| HemY domain protein [Oceanicola batsensis HTCC2597]
 gi|84390523|gb|EAQ03011.1| HemY domain protein [Oceanicola batsensis HTCC2597]
          Length = 502

 Score =  106 bits (265), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 119/504 (23%), Positives = 207/504 (41%), Gaps = 28/504 (5%)

Query: 4   LIRYFFVISLVICSFIIVSHYPE---DVSITWGNRLYRTSPF--VILSIL-----YFFLF 53
           L++    ++LV  + +  S+  +    V I  G      +P   VI ++L     + FL 
Sbjct: 5   LVKIIVFVALVAAATLGASYLLDMQGGVLIAMGGIEINLTPIKAVIAAVLLVLAVWLFLK 64

Query: 54  AWILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
            + LL A+ RF       L     +    KGY+AL  GLM++A+      R+  S  S+ 
Sbjct: 65  LFGLLIALLRFINGDETALSRYFDRNRERKGYEALSDGLMALASGE---GRRAMSKASRA 121

Query: 114 HTFHNE-YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNS 172
             F +   L  LL  Q A      + A    + +L    TR   V  +  +    GD ++
Sbjct: 122 ERFLDRPDLTTLLTAQAAEMVGDKDKAEAAYKKLLSDDRTRFVGVRGIMKQKLAAGDTDT 181

Query: 173 AQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA---KEWNRNR-AIL 228
           A   A KA  I P    V + +++      +W  A   L  K ++    ++ +R R A+L
Sbjct: 182 ALALAEKAFAIKPGHEEVQDTLLRLQAQRSDWKGARATLKAKLRHGNLPRDVHRRRDAVL 241

Query: 229 LIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWK 288
            ++ +     +   I S   AIE+ KL  + I A++ AA+S I Q +KR A  +L+K W+
Sbjct: 242 ALSEAKGVFSEDGTIESREAAIEANKLSPDLIPAAVMAARSYIDQGQKRYAARVLKKAWE 301

Query: 289 VNPHPEIANIYTHLLSENTVG-KLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAK 347
             PHP++A  +  +  + T   +LKR  +L +      ES ++++++ +      +A   
Sbjct: 302 AAPHPDLAAAFAEIEPDETPQERLKRFQQLVKSAPNHRESRLLMAELNIAAEDFPEARRA 361

Query: 348 AMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWL 406
                   P      ++A IE+        +  W   A+ A   P W  ++  ++ + W 
Sbjct: 362 LGDLASENPDARTLTIMAAIERGEGAPDAIVKGWLARAVSAPRGPQWTCENCHHIHAHWQ 421

Query: 407 PLSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPAD---DLQSMLNNGKKNHLPSI 463
           P+           WK P               L +    D   D     +  +   +PS 
Sbjct: 422 PICDNCGAFDTLAWKTPPMGEAQAPVGTAMLPLIVGQIEDWGADAPDRPDR-EDEDMPS- 479

Query: 464 KKVSSFEDSTIHPLDPHIRQPDDP 487
              S  ED+ I P DP  ++P+ P
Sbjct: 480 ---SEPEDAEILPSDPPSQEPEKP 500


>gi|254486881|ref|ZP_05100086.1| HemY domain protein [Roseobacter sp. GAI101]
 gi|214043750|gb|EEB84388.1| HemY domain protein [Roseobacter sp. GAI101]
          Length = 502

 Score =  105 bits (263), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 94/395 (23%), Positives = 168/395 (42%), Gaps = 14/395 (3%)

Query: 44  ILSILYFFLFAWI------LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAA 97
           +++I+   +  W+      LL AV  F       L     +    KGY+AL  GLM++A+
Sbjct: 49  VIAIIVLVIAVWLVLKIISLLIAVWHFLNGDETALSRYFDRNRERKGYEALSEGLMALAS 108

Query: 98  HNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAV 157
               LA  +              L  LL  Q A        A E  + ++   +TR   V
Sbjct: 109 GEGRLA--LSKAAKADKYLERPELTNLLIAQAAEMAGDKRKAEETYKKLVANESTRFVGV 166

Query: 158 YSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN 217
             +  +    GD ++A + A KA  + P      + +++     ++WS A   LN K KN
Sbjct: 167 RGILKQKLAEGDTDTALKLAEKAFALKPKHADTGDILLKLQAEKEDWSGARETLNTKLKN 226

Query: 218 AK----EWNRNRAILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQ 273
            +       R  A+L ++ + +   +G  I +   AIE+ +L  + I A++ AA S I Q
Sbjct: 227 GQLPRDVHKRRDAVLALSEAKDVFTEGHSIEAREAAIEANRLSPDLIPAAVMAAHSYIDQ 286

Query: 274 NKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVG-KLKRALRLEEINKESVESLVIVS 332
            K + A  +L+K W V+ HP++A+ +  +  + T   +LKR   L     +  E+ ++++
Sbjct: 287 GKPKYAARLLKKAWSVHAHPDLASAFAAIAPDETPKERLKRFTALTRTQPDDPETKMLLA 346

Query: 333 KIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDP 392
           ++ +      +A       ++  P      L+A IE+    +   +  W   AL     P
Sbjct: 347 ELNIANEDFPEARRSLGNLVETDPTARSVTLMAAIERGEGASDTVVKGWLARALTVSRGP 406

Query: 393 LWISDD-GYLSSVWLPLSPISKTLCYFEWKIPTKS 426
            WI D+  ++ + W P+     +     WK P  S
Sbjct: 407 QWICDNCQHIHTNWKPICDNCHSFDTLAWKTPPMS 441


>gi|254459948|ref|ZP_05073364.1| HemY domain protein [Rhodobacterales bacterium HTCC2083]
 gi|206676537|gb|EDZ41024.1| HemY domain protein [Rhodobacteraceae bacterium HTCC2083]
          Length = 494

 Score =  105 bits (263), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 93/373 (24%), Positives = 159/373 (42%), Gaps = 8/373 (2%)

Query: 57  LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTF 116
           LL AV  F       L     K    KGY+AL  G+M++A+ +   +  M      +   
Sbjct: 68  LLVAVLNFINGDETALSRYFSKNRERKGYQALSEGMMALASGDG--SAAMSKAAKAEKYL 125

Query: 117 HNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRY 176
               L  LL  Q A        A E  + +++  ATR   V  +  +    GD ++A   
Sbjct: 126 AKPELTNLLTAQAAEMAGDRRKAEETYKKLVKDEATRFVGVRGIMKQKLAEGDTDTALEL 185

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILLIAR 232
           A  A  + P      + +++     ++W+ A   L  K K+         R  A+L +++
Sbjct: 186 AEHAFALKPKHEETQDILLKLQAQGQDWAGARKTLAAKLKSGSLPRDVHKRREAVLALSQ 245

Query: 233 SLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPH 292
           S    D+G    +   A E+ +L  + I A++ AA+S I Q+KKR A  +L+K W V PH
Sbjct: 246 SKGVFDEGKDTEAREAATEANRLAPDLIPAAVMAARSYIEQDKKRYAVRVLKKAWDVQPH 305

Query: 293 PEIANIYTHLLSENT-VGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLA 351
           PE+A  Y  +  E T V ++KR   L + + +  E+ ++ +++ +       A       
Sbjct: 306 PELAAAYAAIEPEETPVERIKRFANLTKSHADHAETKMLNAELNIAAEDFPAARRAMGDL 365

Query: 352 MKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLSSVWLPLSP 410
           +  AP      ++A IE+    +   +  W   AL A   P W+ D   ++ + W P+  
Sbjct: 366 VDTAPDARSLTIMAAIERGEGASDAVVKGWLARALSAPRGPQWVCDACNHIHAEWEPVCG 425

Query: 411 ISKTLCYFEWKIP 423
              +     WK P
Sbjct: 426 NCASFDTLSWKSP 438


>gi|56698662|ref|YP_169039.1| HemY domain-containing protein [Ruegeria pomeroyi DSS-3]
 gi|56680399|gb|AAV97065.1| HemY domain protein [Ruegeria pomeroyi DSS-3]
          Length = 493

 Score =  105 bits (263), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 98/436 (22%), Positives = 185/436 (42%), Gaps = 15/436 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSP------FVILSILYFFLFA 54
           ML+++ +  +I+L+      +      V IT     Y   P      F +L +  +  F 
Sbjct: 1   MLKILVFVAIIALLALGAGFLMEASGGVQITVAGTEYTLGPLQSVIGFGLLVVAVWLFFK 60

Query: 55  WI-LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
            + LL A  +F       L     +    +GY+AL  GLM++A+    LA  M      +
Sbjct: 61  LLTLLIATLKFLNGDETALSRYFDRGRERRGYQALTEGLMALASGEGRLA--MAKAARAE 118

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  L  LL  Q A        A E    ++   +TR   V  +  +    GD  +A
Sbjct: 119 KLLQKPELTNLLVAQAAEMTGDTKKAAETYRKLVTDQSTRFVGVRGIMKQKLAEGDDETA 178

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
           ++ A KAL + P      + ++     A++W+ A   L  K K        + R  A+L 
Sbjct: 179 RKLAEKALALKPRHEETQDVLLTLQTRAQDWAGARATLTSKLKTGTLPRDVYKRRDAVLA 238

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ + +   +   +     AIE+ +L  + I A+  AA++ I++ K + A  IL K W+V
Sbjct: 239 LSEARDLLSETASLDQQERAIEANRLSPDLIPAAAMAARAHIAKGKPKNAAKILTKAWQV 298

Query: 290 NPHPEIANIYTHLLSENT-VGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A+ +  +  + T   ++KR   L + + +  E+ ++++++ +      +A    
Sbjct: 299 QPHPDLAHAFAEIAPDETPAARIKRFAALAKAHPQHAETRLMMAELNIVAEDFPEARRAL 358

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLSSVWLP 407
              +  AP    + L+A IE+    +   +  W   AL A   P W+ D+  ++ + W P
Sbjct: 359 GDLLDHAPDARAYTLMAAIERGEGASDAVVQGWLARALTAPRGPQWVCDNCQHIHAAWAP 418

Query: 408 LSPISKTLCYFEWKIP 423
           +     +     W+ P
Sbjct: 419 VCGNCNSFDTLSWRAP 434


>gi|259417169|ref|ZP_05741088.1| HemY domain protein [Silicibacter sp. TrichCH4B]
 gi|259346075|gb|EEW57889.1| HemY domain protein [Silicibacter sp. TrichCH4B]
          Length = 497

 Score =  105 bits (262), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 98/447 (21%), Positives = 189/447 (42%), Gaps = 16/447 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWI--- 56
           +L+++ +  +++L+     ++      V IT     Y       +++++   +  W+   
Sbjct: 5   LLKILVFVAIVALMAFGAGVLMETAGGVQITVAGIEYTLGALQSVMALVALMVLTWLFFK 64

Query: 57  ---LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
              LL A  RF       L     K    +GY+AL   LM++A      A  +      +
Sbjct: 65  LLSLLIATLRFLNGDETALSRYFDKGRERRGYQALSDSLMALAVGEGRTA--LSKAAKAE 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
               +  L  L+  Q A      + A E  + +L   +TR   V  +  +    GD  +A
Sbjct: 123 RYLQDPALTDLVVAQAAEMAGDTHKASEAYKRLLSDQSTRFVGVRGIMKQKLSEGDTETA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
           ++ A KAL + P    V + +++    A++W+ A   L  K K      + + R  A+L 
Sbjct: 183 RQLAEKALALRPKHEEVQDTLLKLQAQAEDWAGARQTLATKLKTGTLPREVFKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ S     +         AIE+ +L  + + A+  AA+S I++ K R A  IL+K W+ 
Sbjct: 243 LSSSKALLAEEATPEQQEQAIEANRLSPDLVPAAALAARSYIAKGKPRNAVRILKKAWEA 302

Query: 290 NPHPEIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A+ +  +  +E+   ++KR   L  +  +  E+ ++ +++ +      +A    
Sbjct: 303 QPHPDLAHAFAEIEPNESAQERVKRFETLLRVKPDHDETRLVRAELLIVAEDFPEARRAL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLSSVWLP 407
              +  AP      L+A IE+        +  W   AL A   P W+ +   ++ + W P
Sbjct: 363 GDLVDRAPDARALTLMAAIEKGEGGPDAMVQGWLTKALTAPRGPQWVCESCNHIHAEWAP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSEN 434
                 +     WK P ++PEY S+  
Sbjct: 423 TCENCASFDTLTWKRP-ETPEYHSATG 448


>gi|255264670|ref|ZP_05344012.1| HemY domain protein [Thalassiobium sp. R2A62]
 gi|255107005|gb|EET49679.1| HemY domain protein [Thalassiobium sp. R2A62]
          Length = 484

 Score =  104 bits (259), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 86/393 (21%), Positives = 168/393 (42%), Gaps = 14/393 (3%)

Query: 43  VILSILYFFLFAWI------LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIA 96
           ++L  +      W+      LL A  +F       +    ++    KG+ AL  G+M++A
Sbjct: 48  LVLGAIAIIFLVWLGFKIFGLLVATFKFLNGDETAISRYFNRNRERKGFDALSDGMMALA 107

Query: 97  AHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFA 156
           +    +A    S    +       L  LL  Q A        A +  + +L+   TR   
Sbjct: 108 SGEGRVALAKASRA--EKYLERPELTNLLTAQAAEMAGDRVKAEQTYKRLLEDDRTRFVG 165

Query: 157 VYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK 216
           V  +  +  + GD ++A + A KA  + P    + + +++    + +W+ A   L+ K K
Sbjct: 166 VRGIMKQKLQAGDTDTALKLAEKAFALKPKHVEIQDTLLKLQADSSDWAGARRTLSAKLK 225

Query: 217 NA---KEWNRNR-AILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLIS 272
           +    ++ +R R A+L ++ + +    G+ I +   AIE+ +L  + I A++ AA+S I 
Sbjct: 226 SGSLPRDVHRRRDAVLALSEARDILGSGESIEAREAAIEANRLSPDLIPAAVMAARSYIE 285

Query: 273 QNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENT-VGKLKRALRLEEINKESVESLVIV 331
           Q + R A  +L+K W+  PHP++   +  +  + T V ++KR   L   +    E+ +++
Sbjct: 286 QGQPRYAARVLKKTWEAQPHPDLGAAFAEIAPDETPVARIKRFRALARAHPNHAETQMLM 345

Query: 332 SKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPD 391
           +++ +      +A           P      ++A IE+    +   +  W   AL A   
Sbjct: 346 AELHIANEDFPEARRALGELATTEPTARSLAIMAAIERGAGADDAVVRGWLTRALSAPRG 405

Query: 392 PLWISDD-GYLSSVWLPLSPISKTLCYFEWKIP 423
           P WI D+   + + W P      +     WK P
Sbjct: 406 PQWICDNCSNIHAAWSPTCDNCGSFDTLTWKTP 438


>gi|126734495|ref|ZP_01750242.1| hypothetical protein RCCS2_10049 [Roseobacter sp. CCS2]
 gi|126717361|gb|EBA14225.1| hypothetical protein RCCS2_10049 [Roseobacter sp. CCS2]
          Length = 457

 Score =  103 bits (258), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 104/432 (24%), Positives = 183/432 (42%), Gaps = 29/432 (6%)

Query: 47  ILYFFLFAWILLFAVSRF-FLSCPAMLFHMLHKRNYD-KGYKALYTGLMSIAAHNIPLAR 104
           ++  +L   +L   V+ F FL+           RN + KGY+AL  G+M++A+    LA 
Sbjct: 31  VVAVWLGLKLLALCVATFKFLNGDETAISRYFDRNRERKGYEALSEGMMALASGEGHLA- 89

Query: 105 KMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFES 164
            M              L  LL  Q A        A E  + +L    TR   V  +  + 
Sbjct: 90  -MTKAARADKYLQQPQLTNLLTAQAAEMTGDRKTAEETYKKLLSDDKTRFVGVRGIMKQK 148

Query: 165 CRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA---KEW 221
              GD ++A   A KA  + P      + +++      +W+ A   L  K K+    ++ 
Sbjct: 149 LSDGDTDTAMALAQKAFALKPKHEETQDVLLRLQAEKSDWAGARKTLGAKLKSGSLPRDV 208

Query: 222 NRNR-AILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAE 280
           ++ R A+L ++ + +  D+G  I +   AIE+ +L  + I A+I AA+  I +   R A 
Sbjct: 209 HKRRDAVLALSEARDILDEGKTIEAREAAIEANRLSPDLIPAAIMAARGYIGEGNARYAT 268

Query: 281 VILEKIWKVNPHPEIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMG 339
            +L K+W   PHP+IA  +  +   E++  +LKR  +L +   +  E+ +++++  L + 
Sbjct: 269 RVLTKVWNAQPHPDIAAAFAEIAPDESSDERLKRFTKLTKTTADHPETKMLMAE--LHIA 326

Query: 340 SIDQAHAKAMLA--MKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISD 397
           + D   AK  L   ++  P      ++A IE+    +   +  W   AL A   P WI  
Sbjct: 327 AEDFPAAKRALGELVEKDPTARNLTIMAAIERGEGADDSVVRGWLTKALTAPRGPQWICG 386

Query: 398 D-GYLSSVWLPLSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADD--LQSMLNN 454
           +  ++   W        +     WK P  S             ++A PA    L  ++  
Sbjct: 387 NCQHIHPTWAATCDNCGSFDTLAWKTPPAS-------------DVAMPAGTEMLPLIVGQ 433

Query: 455 GKKNHLPSIKKV 466
            K+  LPS + V
Sbjct: 434 TKEAQLPSTEVV 445


>gi|110677862|ref|YP_680869.1| hypothetical protein RD1_0473 [Roseobacter denitrificans OCh 114]
 gi|109453978|gb|ABG30183.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 492

 Score =  103 bits (257), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 113/491 (23%), Positives = 204/491 (41%), Gaps = 32/491 (6%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF--VILSILYFFLFAWILL 58
           ++++I +   ++ +    + +      V +      +  SP   VI +++  F+  W+ L
Sbjct: 5   LIKIILFVVAVAALAMGAVYLLESEGGVQVQVMGTEFTFSPIQSVIAAVVLIFVV-WLFL 63

Query: 59  ------FAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQ 112
                  A  RF       +     +    KG++AL  GLM++A+    +A  M+     
Sbjct: 64  KLLSLLVACLRFLSGDETAISRYFDRSRERKGFQALSEGLMALASGEGRVA--MNKAAKA 121

Query: 113 QHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNS 172
           +   +   L  LL  Q A        A E  + ++   ATR   V  +  +    GD ++
Sbjct: 122 ERYLNKPELTNLLVAQAAEMAGDRRKAEETYKKLVTTDATRFVGVRGIMKQKLADGDTDT 181

Query: 173 AQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA---KEWNRNR-AIL 228
           A + A KA  I P    V + +++     ++WS A   L+ K K     ++ +R R A+L
Sbjct: 182 ALQLAEKAFAIKPKHEEVQDVLLRLQAQKEDWSGARKTLSAKLKYGNLPRDVHRRRDAVL 241

Query: 229 LIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWK 288
            ++ + +       I     AIE+ KL  + I A++ AA   + QN+ R A  +L+K W+
Sbjct: 242 ALSEAKDILSDASSIDVQEKAIEANKLSPDLIPAAVMAAGGYVEQNRPRLAVRLLKKAWE 301

Query: 289 VNPHPEIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQA-HA 346
           V+PHP++A  +  +  +E    ++KR + +  I  E+ E+ ++++++ +      +A  A
Sbjct: 302 VHPHPDLAAAFAAIEPNETPAERIKRFMAITRIKPENPETKMLLAELHIANEDFPEARRA 361

Query: 347 KAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLSSVW 405
              LA   A  + +  L+A IE+        +  W   AL     P WI D+  ++   W
Sbjct: 362 LGDLAETDATARSV-TLMAAIERGEGAPDTVVRGWLAKALTVSRGPQWICDNCQHIHREW 420

Query: 406 LPLSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKK 465
            P     ++     WK P  S             EMA P       L  G     P    
Sbjct: 421 GPFCENCESFDTLAWKTPPMS-------------EMAMPGGMQMLPLIVGALEEKPDETS 467

Query: 466 VSSFEDSTIHP 476
               ED+ I P
Sbjct: 468 GDIIEDAEIIP 478


>gi|260431926|ref|ZP_05785897.1| HemY domain protein [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415754|gb|EEX09013.1| HemY domain protein [Silicibacter lacuscaerulensis ITI-1157]
          Length = 506

 Score =  103 bits (256), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 98/450 (21%), Positives = 198/450 (44%), Gaps = 16/450 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFA-WILL- 58
           +L+++ +  ++ L+      +      V IT        SP   +  L   +FA W+ L 
Sbjct: 5   LLKILVFVVIVGLLAMGAGYLMESSGGVQITALGLEITLSPLQSVIALGVLVFAVWLGLK 64

Query: 59  -----FAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
                 A  +F       L     +    +GY+AL  GLM++A+    +A  +      +
Sbjct: 65  LLGLLIATLKFINGDETALSRYFDRSREQRGYQALADGLMALASGEGRIA--LTKARKAE 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
              +   L  LL  Q A        A E  + ++  PATR   V  +  +    GD ++A
Sbjct: 123 KLLNKPELTNLLVAQAAEMTGDTKKAAETYKKLVSDPATRFVGVRGILKQKLAEGDEDTA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
           ++ A KAL + P      + +++    A++W+ A + L  K K        + R  A+L 
Sbjct: 183 RKLAEKALQLKPRHEETQDVLLKLQTKAQDWAGARSTLTAKLKAGYLPRDVYRRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ + +  D+   +     AIE+ +L  + + A+  AA++ I++ K R A  IL+K W+ 
Sbjct: 243 LSEAKDILDESATVEQQERAIEANRLSPDLVPAAAMAARAYIAKGKPRAATKILKKAWEA 302

Query: 290 NPHPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A+ +  ++ + T   ++KR   L  I+ +  E+ +I +++ +      +A    
Sbjct: 303 QPHPDLAHAFAEIVPDETPEERIKRFATLTRIHPDHPETRLIRAELNIVAEDFPEARRAL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGY-LSSVWLP 407
              ++       + L+A IE+    +   +  W   AL+A   P W+ ++ + + + W P
Sbjct: 363 GDLVEKGADARAYTLMAAIERGEGASDAVVQGWLAKALNAPRGPQWVCENCHDIHAEWAP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINF 437
           +     +     W+ P K+PE  ++  ++ 
Sbjct: 423 VCSTCHSFDTLSWQRP-KTPEIATATGVHM 451


>gi|114765154|ref|ZP_01444298.1| HemY domain protein [Pelagibaca bermudensis HTCC2601]
 gi|114542429|gb|EAU45456.1| HemY domain protein [Roseovarius sp. HTCC2601]
          Length = 511

 Score =  103 bits (256), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 95/439 (21%), Positives = 180/439 (41%), Gaps = 15/439 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF------VILSILYFFLFA 54
           +L++I +  V++ +      V      + IT G   +   P       ++L I  + +F 
Sbjct: 5   LLKIILFVAVVAALTLGAGYVMESQGGIQITAGGYEFNLGPLQSVIAVIVLVIALYVVFK 64

Query: 55  WI-LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
            + LL AV +F       L     +    KGY+AL  G++++++    LA  M       
Sbjct: 65  LVSLLIAVLKFINGDDTALSRYFDRNRERKGYQALSEGMLALSSGEGKLA--MAKAQKAD 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
              H   L  LL  Q A        A E  + ++    TR   +  +       GD  +A
Sbjct: 123 RYLHRPGLTNLLTAQAAEMTGDTRKAEEVYKKLITNDETRFVGIRGMMKLKLAKGDTETA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILL 229
            + A +A  + P  P + + ++Q      +W  A   L+ K K+       + R  A+L 
Sbjct: 183 LKLAERAFALKPKHPEIQDTLLQLQAQKHDWRGARQTLSAKLKHGSLPRDVYRRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ + +   +   I +   AI S K   + I  +  AA++ I++ +++KA  IL+K W V
Sbjct: 243 LSEAKDIFAEDKPIEAREAAIASAKGSPDLIPGACMAARAYIARGEQKKAVRILKKTWSV 302

Query: 290 NPHPEIANIYTHLLSENTVG-KLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A  +  +  + T   ++KR   +  I  +  E+ ++ +++AL      +A    
Sbjct: 303 QPHPDLAAAFAEIAPDETPAERMKRFRTITSIRPDHRETRLLRAELALAAEDFPEARRAM 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLP 407
              +   P      ++A I +       ++  W   AL A   P W+ D   ++   W+P
Sbjct: 363 GDLVDKEPDARTLTVMAAIARGEGAPETEVRGWLAKALVAPRGPQWVCDSCHHIHGEWVP 422

Query: 408 LSPISKTLCYFEWKIPTKS 426
           +           W  P +S
Sbjct: 423 VCENCGGFDTLSWTTPPQS 441


>gi|163732926|ref|ZP_02140370.1| hypothetical protein RLO149_09710 [Roseobacter litoralis Och 149]
 gi|161393461|gb|EDQ17786.1| hypothetical protein RLO149_09710 [Roseobacter litoralis Och 149]
          Length = 495

 Score =  103 bits (256), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 105/424 (24%), Positives = 179/424 (42%), Gaps = 23/424 (5%)

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
           A  RF       +     +    KG++AL  GLM++A+    +A  M   V  +   +  
Sbjct: 71  ACLRFLSGDETAISRYFDRSRERKGFQALSEGLMALASGEGRVA--MTKAVKAERYLNKP 128

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATK 179
            L  LL  Q A        A E  + ++   ATR   V  +  +    GD ++A + A K
Sbjct: 129 ELTNLLVAQAAEMAGDRRKAEETYKKLVTTDATRFVGVRGIMKQKLADGDTDTALQLAEK 188

Query: 180 ALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA---KEWNRNR-AILLIARSLE 235
           A  I P    V + +++     ++WS A   L+ K K     ++ ++ R A+L ++ + +
Sbjct: 189 AFAIKPKHEEVQDVLLRLQAQKEDWSGARKTLSAKLKYGNLPRDVHKRRDAVLALSEAKD 248

Query: 236 NADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEI 295
                  I     AIE+ KL  + I A++ AA   + QN+ R A  +L+K W+V+PHP++
Sbjct: 249 ILSDQSSIDVQEKAIEANKLSPDLIPAAVMAAGGYVEQNRPRLAVRLLKKAWEVHPHPDL 308

Query: 296 ANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQA-HAKAMLAMK 353
           A  +  +  +E    ++KR + +  I  E+ E+ ++++++ +      +A  A   LA  
Sbjct: 309 AAAFAAIEPNETPAERIKRFMAITRIKPENPETKMLLAELHIANEDFPEARRALGDLAET 368

Query: 354 IAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLSSVWLPLSPIS 412
            A  + +  L+A IE+        +  W   AL     P WI D+  ++   W P     
Sbjct: 369 DATARSV-TLMAAIERGEGAPDTVVRGWLAKALTVSRGPQWICDNCQHIHQEWGPFCENC 427

Query: 413 KTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDS 472
           ++     WK P  S             EMA P       L  G     P  K     ED+
Sbjct: 428 ESFDTLAWKAPPLS-------------EMAMPGGVQMLPLIVGALEEKPEEKTGDIIEDA 474

Query: 473 TIHP 476
            I P
Sbjct: 475 EIIP 478


>gi|260429364|ref|ZP_05783341.1| HemY domain protein [Citreicella sp. SE45]
 gi|260419987|gb|EEX13240.1| HemY domain protein [Citreicella sp. SE45]
          Length = 514

 Score =  102 bits (255), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 95/441 (21%), Positives = 186/441 (42%), Gaps = 19/441 (4%)

Query: 1   MLRLIRYFFVISLVI--CSFIIVSHYPEDVSITWGNRLYRTSPF------VILSILYFFL 52
           +L++I +  V++ +     +++ SH    + IT G   +   P       ++L I  + +
Sbjct: 5   LLKIILFVAVVAALTLGAGYVMESHG--GIQITAGGYEFNLGPLQSVIAVIVLVIALYVV 62

Query: 53  FAWI-LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVS 111
           F  + LL A+ +F       L     +    KGY AL  G++++++    LA  M     
Sbjct: 63  FKLVSLLIALLKFINGDDTALSRYFDRNRERKGYHALAEGMLALSSGEGKLA--MAKAQK 120

Query: 112 QQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLN 171
                H   L  LL  Q A        A E  + ++    TR   +  +       GD +
Sbjct: 121 ADRYLHRPALTNLLTAQAAEMTGDTRKAEEVYKKLIANDETRFVGIRGMMKLKLAKGDTD 180

Query: 172 SAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAI 227
           +A + A +A  + P    + + ++Q      +W  A   L+ K K+       + R  A+
Sbjct: 181 TALKLAERAFALKPKHAEIQDTLLQLQAQKHDWRGARQTLSAKLKHGALPRDVYRRRDAV 240

Query: 228 LLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIW 287
           L ++ + +   +   I +   AI S K   + I  +  AA+S I++ + +KA  +L+K W
Sbjct: 241 LALSEAKDIFAEDKPIEAREAAIASAKGSPDLIPGACMAARSYIAKGEPKKAVRVLKKTW 300

Query: 288 KVNPHPEIANIYTHLLSENTVG-KLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHA 346
            V PHP++A  +  ++ + T   ++KR   L  +     E+ ++ +++AL      +A  
Sbjct: 301 SVEPHPDLAAAFAEIVPDETPAERMKRFRALTSLRVNHRETRLLKAELALAAEDFPEARR 360

Query: 347 KAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLSSVW 405
                ++  P   +  ++A I +       ++  W   AL A   P W+ D   ++ + W
Sbjct: 361 ALGDLVETEPDARVLTIMAAIARGEGAGEAEVRGWLAKALVAPRGPQWVCDSCNHIHAEW 420

Query: 406 LPLSPISKTLCYFEWKIPTKS 426
           +P+           WK P +S
Sbjct: 421 VPICENCGGFDTLSWKTPPQS 441


>gi|126724569|ref|ZP_01740412.1| HemY domain protein [Rhodobacterales bacterium HTCC2150]
 gi|126705733|gb|EBA04823.1| HemY domain protein [Rhodobacterales bacterium HTCC2150]
          Length = 488

 Score =  102 bits (253), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 101/440 (22%), Positives = 187/440 (42%), Gaps = 29/440 (6%)

Query: 8   FFVISLVICSFII--VSHYPEDVSITWGNRLYRTSPF---------VILSILYFFLFAWI 56
           FFV++++  +F +  ++     + I +GN  Y   P          V+   L   L  ++
Sbjct: 10  FFVVAIIALAFGVNYLTSMSGGIQIAFGNTEYTLGPLQSIVALILLVLTLYLILKLIGFV 69

Query: 57  LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTF 116
           L F   RF       +          KGY+AL  GLM++A+    +A  +      +   
Sbjct: 70  LAFV--RFLNGDETAISRYFSANRERKGYQALSDGLMALASGEGRVA--LSQAERARRLL 125

Query: 117 HNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRY 176
           +   L  L+  Q A  E     A +    +L+   TR   V  +  +    GD  +A++ 
Sbjct: 126 NKPELTNLISAQAAEMEGDTKKAKDIYVELLKDERTRFVGVRGIMKQKLAEGDTETAKKL 185

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA---KEWNRNR-AILLIAR 232
           A KA D+ P      + ++Q     ++W+ A   LN K  N    ++ ++ R A+L ++ 
Sbjct: 186 AEKAFDLKPKHNETGDVLLQLQAENEDWAGARKTLNTKVSNGVLPRDVHKRRDAVLALSE 245

Query: 233 SLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPH 292
           + +       + +   AIE+ +L  + I A++ AAK+ + Q K R A  +L   WK  PH
Sbjct: 246 ARDIFANAGAVEAQVAAIEANRLSPDLIPAAVMAAKAYMEQEKPRYATRVLIAAWKSQPH 305

Query: 293 PEIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLA 351
           P++A  +  ++ +E T  ++KR   L + + +  E+ +++++  L +   D A A+  L 
Sbjct: 306 PDLAAGFADIVPTETTKARIKRFAGLIKSDPDHAEARLLMAE--LHIADEDFAGARKALG 363

Query: 352 M----KIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLSSVWL 406
                 +  R     ++A IE+    +   +  W   AL A   P W  D   ++ S W 
Sbjct: 364 GLNDDYLTSRS--LTIMAAIERGEGSDDAIVRGWLTKALGASRGPQWTCDKCNHVHSNWT 421

Query: 407 PLSPISKTLCYFEWKIPTKS 426
            +           WK P + 
Sbjct: 422 AICDRCSGFDTLAWKTPAEG 441


>gi|83594895|ref|YP_428647.1| HemY-like [Rhodospirillum rubrum ATCC 11170]
 gi|83577809|gb|ABC24360.1| HemY-like [Rhodospirillum rubrum ATCC 11170]
          Length = 433

 Score =  100 bits (248), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 101/410 (24%), Positives = 179/410 (43%), Gaps = 22/410 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ +  +  L++   + ++ +P  V++ W      TS  V+L I    L   +L F 
Sbjct: 1   MLRILLFVLLAGLLVIGAVWIAEHPGIVALNWLGWHIETSIMVLL-ITLVVLIGLLLFF- 58

Query: 61  VSRFF---LSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFH 117
            SRFF   L  P       +++   +G  A+  G+ +    ++ LARK+      +    
Sbjct: 59  -SRFFGGILGIPQWWRRRRNEKKLRRGSLAVGEGIAAARGGDVHLARKL--LKDAERLLP 115

Query: 118 NEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYA 177
                  L    A A  + ++A +   +ML+ P T+      L   +   GDL+ A    
Sbjct: 116 GAAGTQQLTADTAAAAGETDVAEKAYGLMLENPRTQASGRRGLLDLALTRGDLDKAYAIV 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFL----NQKKKNAKEWNRNRAILLI--A 231
            +A+    DAPW T  + +  +L ++W+ A + L    N   K   +    +A LL   A
Sbjct: 176 REAVATGVDAPWATATLFRLQLLRRQWADAESTLAKAGNGVLKPGDDAKVVKAALLTVQA 235

Query: 232 RSLE-NADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
           R  E     GD +     A+E   L   S  A++ AA+ L +  ++RKA  +L  +W  +
Sbjct: 236 RDAELPGRGGDALRLSQQAVE---LDPTSREATLIAARQLAATGRQRKAAQLLIALWAKH 292

Query: 291 PHPEIANIYTHL-LSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAM 349
           PHP +A  Y  L   E+++  ++ A  L   N E   S  + ++ AL+     +A     
Sbjct: 293 PHPSLAQAYLALWTGEDSLKIVRHAQELTGANPEHPMSRRVFAEAALDAQLWGEARQSLE 352

Query: 350 LAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG 399
             ++  P   I  L+A++E+    +      W + AL A P+   + +DG
Sbjct: 353 PLLRDVPSATICRLMARLEEGEKGDVTAANQWLRRALEAGPE---VEEDG 399


>gi|163742569|ref|ZP_02149955.1| HemY domain protein [Phaeobacter gallaeciensis 2.10]
 gi|161384154|gb|EDQ08537.1| HemY domain protein [Phaeobacter gallaeciensis 2.10]
          Length = 507

 Score = 99.8 bits (247), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 100/447 (22%), Positives = 199/447 (44%), Gaps = 20/447 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF---VILSILYFFLFAWIL 57
           +L+++ +  +++++     +++     V IT     Y  S     + L+IL F +  W+L
Sbjct: 5   LLKILVFVAIVAVLAFGAALLTETAGGVQITVAGTEYTLSALQSVIALAILVFVV--WVL 62

Query: 58  LFAVS------RFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVS 111
              +S      RF       +     K    KGY+AL  GLM++A+    LA  M     
Sbjct: 63  FKLLSLLLATLRFLNGDETAISRYFDKGRERKGYQALSDGLMALASGEGRLA--MAKAAR 120

Query: 112 QQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLN 171
            +       L  LL  Q A        A E  + ++   +TR   V  +  +    GD +
Sbjct: 121 AEKYLEKPELTDLLTAQAAELAGDTKKAAEAYKRLVSNQSTRFVGVRGIMKQKLSEGDTD 180

Query: 172 SAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKE----WNRNRAI 227
           +A++ A KAL + P    V + ++     A++W+ A   L  K K        + R  A+
Sbjct: 181 TARQLAEKALSLRPKHEEVQDTLLTLQARAQDWAGARKTLTTKLKTGTLPRDVYKRRDAV 240

Query: 228 LLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIW 287
           L ++ S     +G  +     AIE+ +L  + + A+  AA++ ++++KKR A  +L+K W
Sbjct: 241 LALSASKAIVKEGATVEQQEQAIEANRLSPDLVPAAAMAARAYLARDKKRYAIRVLKKAW 300

Query: 288 KVNPHPEIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHA 346
           +  PHP++A+ +  +  +E    ++KR  +L  +  +  E+ ++++++ +      +A  
Sbjct: 301 EAQPHPDLAHAFAEVEPTETAQERVKRFAQLSRLAPQHDETRLVMAELHIVAEDFPEARR 360

Query: 347 KAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLSSVW 405
                ++  P      L+A IE+    +   I  W   AL+A   P W+  +  ++ + W
Sbjct: 361 ALGDLVEREPDARALTLMAAIEKGEGASDAVIQGWLARALNAPRGPQWVCGNCNHIHAEW 420

Query: 406 LPLSPISKTLCYFEWKIPTKSPEYISS 432
            P+     +     W+ P ++PE + +
Sbjct: 421 APVCENCASFDTLSWRRP-EAPEIVGA 446


>gi|163738035|ref|ZP_02145451.1| HemY-like protein [Phaeobacter gallaeciensis BS107]
 gi|161388651|gb|EDQ13004.1| HemY-like protein [Phaeobacter gallaeciensis BS107]
          Length = 507

 Score = 99.8 bits (247), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 100/447 (22%), Positives = 199/447 (44%), Gaps = 20/447 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF---VILSILYFFLFAWIL 57
           +L+++ +  +++++     +++     V IT     Y  S     + L+IL F +  W+L
Sbjct: 5   LLKILVFVAIVAVLAFGAALLTETAGGVQITVAGTEYTLSALQSVIALAILVFVV--WVL 62

Query: 58  LFAVS------RFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVS 111
              +S      RF       +     K    KGY+AL  GLM++A+    LA  M     
Sbjct: 63  FKLLSLLLATLRFLNGDETAISRYFDKGRERKGYQALSDGLMALASGEGRLA--MAKAAR 120

Query: 112 QQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLN 171
            +       L  LL  Q A        A E  + ++   +TR   V  +  +    GD +
Sbjct: 121 AEKYLEKPELTDLLTAQAAELAGDTKKAAEAYKRLVSNQSTRFVGVRGIMKQKLSEGDTD 180

Query: 172 SAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKE----WNRNRAI 227
           +A++ A KAL + P    V + ++     A++W+ A   L  K K        + R  A+
Sbjct: 181 TARQLAEKALSLRPKHEEVQDTLLTLQARAQDWAGARKTLTTKLKTGTLPRDVYKRRDAV 240

Query: 228 LLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIW 287
           L ++ S     +G  +     AIE+ +L  + + A+  AA++ ++++KKR A  +L+K W
Sbjct: 241 LALSASKAIVKEGATVEQQEQAIEANRLSPDLVPAAAMAARAYLARDKKRYAIRVLKKAW 300

Query: 288 KVNPHPEIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHA 346
           +  PHP++A+ +  +  +E    ++KR  +L  +  +  E+ ++++++ +      +A  
Sbjct: 301 EAQPHPDLAHAFAEVEPTETAQERVKRFAQLSRLAPQHDETRLVMAELHIVAEDFPEARR 360

Query: 347 KAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLSSVW 405
                ++  P      L+A IE+    +   I  W   AL+A   P W+  +  ++ + W
Sbjct: 361 ALGDLVEREPDARALTLMAAIEKGEGASDAVIQGWLARALNAPRGPQWVCGNCNHIHAEW 420

Query: 406 LPLSPISKTLCYFEWKIPTKSPEYISS 432
            P+     +     W+ P ++PE + +
Sbjct: 421 APVCENCASFDTLSWRRP-EAPEIVGA 446


>gi|21328634|gb|AAM48640.1| conserved hypothetical protein [uncultured marine proteobacterium]
          Length = 491

 Score = 99.4 bits (246), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 86/377 (22%), Positives = 163/377 (43%), Gaps = 9/377 (2%)

Query: 63  RFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLV 122
           RF       L     +    +G++AL  GLM++A+ +   A  M          +   L 
Sbjct: 74  RFINGDETALSRYFDRNRERRGFEALSDGLMALASGDGRDA--MAKARKADRLLNRPDLT 131

Query: 123 YLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALD 182
            L+  Q A+A      A    + +L+ P TR    Y L  +  + GD   A + A  A  
Sbjct: 132 NLIMAQAAVANGDRQTAKATYKKLLKDPKTRFVGTYGLLQQHLQDGDTEVALKLAEHAFG 191

Query: 183 ISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA---KEWNRNR-AILLIARSLENAD 238
           + P      + +++     ++W    T L  K K+    K+ ++ R A+  +++S +   
Sbjct: 192 LKPRHGETQDVLLKLQAGREDWRGVRTTLTAKLKHGSLPKDVHKRRDAVFALSQSRDLRA 251

Query: 239 KGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANI 298
           +G +  +   A+E+ +L    + A+I +A+    Q   ++A  IL   W++ PHP++A  
Sbjct: 252 EGKLDEAQIYAVEANRLAPGLVPAAILSAEGHREQKNVKQASRILRAAWQLAPHPDLAAG 311

Query: 299 YTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPR 357
           +  L   E +  +LKR  +  +  +   E+ ++++++ + M   D A        K  P 
Sbjct: 312 FAALAPDEASAARLKRFGQFTKGTESHPETKMLMAELYVAMADFDAARQALGDLAKTDPT 371

Query: 358 KEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLSSVWLPLSPISKTLC 416
                +LA IE+ +  +   +      A+ A  DP WI D+ G++   W P+    + + 
Sbjct: 372 MRALTILAAIERGDGADDQSVRRLLTQAISAQRDPQWICDNCGHVHHDWEPVCLNCEAID 431

Query: 417 YFEWKIPTKSPEYISSE 433
              WK P  S E +S +
Sbjct: 432 SIAWKRPPMS-EAVSPD 447


>gi|85705790|ref|ZP_01036887.1| HemY domain protein [Roseovarius sp. 217]
 gi|85669780|gb|EAQ24644.1| HemY domain protein [Roseovarius sp. 217]
          Length = 490

 Score = 99.0 bits (245), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 90/395 (22%), Positives = 166/395 (42%), Gaps = 12/395 (3%)

Query: 42  FVILSILYFFLFAWI----LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAA 97
            + L +L F ++  +    LL A  +F       L     +   DKGY+AL  G++++A+
Sbjct: 49  VIALGVLVFAIWLLMKLTGLLVASLKFINGDETALSRYFDRSRQDKGYRALSEGMLALAS 108

Query: 98  HNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAV 157
               +A  M      +       L  L+  Q A      + A E  + +L    TR   V
Sbjct: 109 GEGEVA--MAQAAKAEKYLRKPALTNLITAQAAEMAGNRSKAEEVYKRLLTNEKTRFVGV 166

Query: 158 YSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN 217
             +  +    GD  +A + A  A  + P    V + ++       +W  A   LN K K 
Sbjct: 167 RGILRQKLAEGDTETALKLAKTAFTLKPRHAEVQDTLLDLQAKTSDWKGARETLNAKLKY 226

Query: 218 A---KEWNRNR-AILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQ 273
               ++ ++ R A+L ++ + +  D+G  I +   AIE+ +L  + I A++ AA+  I Q
Sbjct: 227 GNLPRDVHKRRDAVLALSEARDVLDEGKTIEAREAAIEANRLSPDLIPAAVLAARGYIDQ 286

Query: 274 NKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVG-KLKRALRLEEINKESVESLVIVS 332
              R A  ++ K W V+PHP +A ++  +  + T   +LKR  +L +++ +  E+ ++ +
Sbjct: 287 GNTRNALRVINKAWLVHPHPNLAAVFAAIEPDETPNQRLKRFAKLLKVHPDHRETRLLAA 346

Query: 333 KIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDP 392
           ++ L       A        ++ P      ++A IE+        +  W   AL A   P
Sbjct: 347 ELNLAAEDFPAARRALGNLAEVEPDARAVTIMAAIERGEGAPDAVVKGWLARALSAPRGP 406

Query: 393 LWISDD-GYLSSVWLPLSPISKTLCYFEWKIPTKS 426
            W+ D   ++   W P      +     W+ P  S
Sbjct: 407 QWVCDKCQHIHVEWSPTCENCNSFDTLSWRAPPNS 441


>gi|114769711|ref|ZP_01447321.1| Uncharacterized HemY-like membrane protein [alpha proteobacterium
           HTCC2255]
 gi|114549416|gb|EAU52298.1| Uncharacterized HemY-like membrane protein [alpha proteobacterium
           HTCC2255]
          Length = 478

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 102/440 (23%), Positives = 183/440 (41%), Gaps = 29/440 (6%)

Query: 43  VILSILYFFLFAWI--LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNI 100
           +IL +       W+  +L A+ +FF      +    +K   ++GYKAL   ++S+AA   
Sbjct: 52  IILCMSSLLATKWLFGILVAIFKFFNGDETAITRYFNKNKEERGYKALADSMVSMAAGEG 111

Query: 101 PLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSL 160
             A  +++    +       L  L+  Q A        A +  + +L+   TR   +  L
Sbjct: 112 KDA--INNANRAERLLQRPQLTNLVSAQAAEKFGDNKRALKYYKRLLKNDQTRFVGLQGL 169

Query: 161 YFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKE 220
             +    GD  +A   A KA  I P+       +       ++W  A   +    +  K 
Sbjct: 170 LKQKLLEGDNETALLLAEKAFSIRPNHDQTLNVLFDLQTEKQDWKGAQKTIKANVRAGKL 229

Query: 221 WN----RNRAILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKK 276
                 R  AILL+A +    + G++      AI + K   + I A+I AA+  +  N K
Sbjct: 230 PKDIGLRREAILLLADAKAMLEAGEIDTGKAAAIAANKSSPDLIPAAILAAEMYMLDNNK 289

Query: 277 RKAEVILEKIWKVNPHPEIANIYTHL-LSENTVGKLKRALRLEEINKESVESLVIVSKIA 335
           R +  IL+K W +NPHP++A  +  + L E +  + KR     ++  E  E+ ++++++A
Sbjct: 290 RASTKILKKTWGLNPHPDLATAFAEINLKETSGERRKRFSSFVKLKSEHYETKLLLAELA 349

Query: 336 LEMGSIDQAHAKAMLAMK----IAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPD 391
           +     D+    A  A+K      P      L+A IE+    +   +  W   AL A   
Sbjct: 350 IG----DEDFPAARRAIKDLTSTNPTVRSLALMAAIEKGEGADEKTVRAWLNKALTASRG 405

Query: 392 PLWISDD-GYLSSVWLPLSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQS 450
           P WI +    +   W P     +T     WK P +  + I++E ++F+           +
Sbjct: 406 PQWICEKCSNIHLSWQPRCENCETFDSLSWKAPPRDAKKITNEKLDFT-----------A 454

Query: 451 MLNNGKKNHLPSIKKVSSFE 470
            +  G +N LPS+  +   E
Sbjct: 455 GILTGAENSLPSVSDIDDAE 474


>gi|254451402|ref|ZP_05064839.1| HemY domain protein [Octadecabacter antarcticus 238]
 gi|198265808|gb|EDY90078.1| HemY domain protein [Octadecabacter antarcticus 238]
          Length = 490

 Score = 98.2 bits (243), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 90/394 (22%), Positives = 171/394 (43%), Gaps = 13/394 (3%)

Query: 42  FVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRNYD-KGYKALYTGLMSIAAHNI 100
            ++L    + +F  I L   +  FL+           RN + KGY+AL  G+M++A+   
Sbjct: 52  LIVLVASIWLVFKLIGLAIATFKFLNGDETAISRYFSRNRERKGYEALSEGMMALASGEG 111

Query: 101 PLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSL 160
            LA  M      +       L  LL  Q A        A      +L+   TR   V  +
Sbjct: 112 RLA--MAKANRAEKFLERPELTNLLTAQAAELAGDRKTAELTYRKLLEDDKTRFVGVRGI 169

Query: 161 YFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA-- 218
             +  + GD ++A   A KA  I P      + +++      +W  A   L  K K    
Sbjct: 170 MKQKLQDGDTDTALLLAQKAFAIKPKHVETQDTLLRLQAEKSDWKGARETLTAKLKTGQL 229

Query: 219 -KEWNRNR-AILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKK 276
            +  +R R A+L ++ + +   +G  + +   AIE+ ++  + + A++ AA++ +++N  
Sbjct: 230 PRNVHRRRDAVLALSEAKDVFAEGATLEAQEAAIEANRMSPDLVPAAVMAAQAHVAKNSS 289

Query: 277 RKAEVILEKIWKVNPHPEIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIA 335
           R A  +++K W V PHP++A+ +  +   E+   ++KR   L +++    E+ +++++  
Sbjct: 290 RAATRVIKKAWDVAPHPDLASAFAAIAPDEDPAARVKRFSTLTKVHPNHPETRMLLAE-- 347

Query: 336 LEMGSIDQAHAKAMLAMKIA--PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPL 393
           L + + D   A+  +   +A  P      ++A IE+        +  W   AL A   P 
Sbjct: 348 LNIAAEDFPEARRAITELVAKDPTARSLTIMAAIERGEGSADAVVRGWLAKALTATRGPQ 407

Query: 394 WISDD-GYLSSVWLPLSPISKTLCYFEWKIPTKS 426
           WI D+  ++  VW P+           W+ P K 
Sbjct: 408 WICDNCQHIHPVWAPICVNCSGFDTLAWREPPKG 441


>gi|254465019|ref|ZP_05078430.1| HemY domain protein [Rhodobacterales bacterium Y4I]
 gi|206685927|gb|EDZ46409.1| HemY domain protein [Rhodobacterales bacterium Y4I]
          Length = 498

 Score = 97.4 bits (241), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 99/444 (22%), Positives = 193/444 (43%), Gaps = 16/444 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWILL- 58
           +L+++ +  +++L+     ++      V IT     Y  S    ++++    +  W+ L 
Sbjct: 5   LLKILVFVAIVALLAFGAGLLMETAGGVQITVAGTEYTLSALQSVIALGVLVVAVWLFLK 64

Query: 59  -----FAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
                 A  RF       L     K    KGY+AL  GLM++A+        +      +
Sbjct: 65  LLSLLVATLRFLNGDETALSRYWDKGRERKGYRALSEGLMALASGEG--RLALAKAARAE 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
               N  L  LL  Q A      + A +  + +L    TR   V  +  +    GD ++A
Sbjct: 123 KYLQNPELTDLLVAQAAEMSGDTHKAADAYKRLLSNQQTRFVGVRGIMKQKLSQGDTDTA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
           ++ A KAL + P    V + +++    A++W+ A   L+ K K        + R  A+L 
Sbjct: 183 RQLAEKALALRPKHEEVQDTLLRLQAQAEDWAGARKTLSTKLKTGTLPRDVYKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ S    D+   I     AIE+ +L  + + A+  AA++ +++ KKR A  +L+K W+ 
Sbjct: 243 LSASKGVIDENATIEQREQAIEANRLSPDLVPAAAMAARAYLAKGKKRPAVRLLKKTWQS 302

Query: 290 NPHPEIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A+ +  +   E+   ++ R  +L  +N +  E+ ++++++ +      +A    
Sbjct: 303 QPHPDLAHAFAEVEPDESAAERVARFDQLARLNPQDDETRLVMAELNIVAEDFPEARRWL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWI-SDDGYLSSVWLP 407
               + AP      L+A IE+    +   +  W   AL +   P W+ S+  ++   W P
Sbjct: 363 SDLTERAPDARALTLMAAIERGEGADDKVVQGWLTRALTSPRGPQWVCSNCNHIHVEWEP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYIS 431
           +     +     WK P ++PE  S
Sbjct: 423 VCEHCTSFDTLSWKRP-ETPEVAS 445


>gi|84514840|ref|ZP_01002203.1| HemY domain protein [Loktanella vestfoldensis SKA53]
 gi|84510999|gb|EAQ07453.1| HemY domain protein [Loktanella vestfoldensis SKA53]
          Length = 479

 Score = 97.1 bits (240), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 91/371 (24%), Positives = 158/371 (42%), Gaps = 21/371 (5%)

Query: 60  AVSRFFLSCPAMLFHMLHKRNYD-KGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHN 118
           A+SR+F             RN + KGY+AL  G+M++A+    LA  M      +   H 
Sbjct: 82  AISRYF------------DRNRERKGYEALAEGMMALASGEGHLA--MTKAARAEKYLHQ 127

Query: 119 EYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYAT 178
             L  LL  Q A        A E  + +L    TR   V  +  +    GD + A + A 
Sbjct: 128 PQLTNLLTAQAAEMTGDRRKAEETYKKLLADDRTRFVGVRGIMKQKLAEGDTDLALKLAQ 187

Query: 179 KALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA---KEWNRNR-AILLIARSL 234
           KA  + P      + ++Q      +W  A   L  K K+    ++ ++ R A+L ++ + 
Sbjct: 188 KAFALKPKHAETQDVLLQLQADKADWKGARQTLGAKLKSGTLPRDVHKRRDAVLALSEAR 247

Query: 235 ENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPE 294
           +  D+G+ I +   AI + +L  + I A++ AA+  I+Q   R A  +L K W   PHP+
Sbjct: 248 DILDEGNPIEAREAAIAANRLSPDLIPAAVMAARGYIAQGNARYASRVLVKTWTAQPHPD 307

Query: 295 IANIYTHLLSENT-VGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMK 353
           IA  +  ++ + T   +LKR   L +   +  E+ ++++++ +       A       ++
Sbjct: 308 IATAFAEIVPDETPQARLKRFATLTKATPDHPEAKMLMAELHVAAEDFPAARRDIADLVE 367

Query: 354 IAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLSSVWLPLSPIS 412
             P      L+A +E+    +   +  W   AL A   P WI D   ++   W P+    
Sbjct: 368 TDPTARSLALMAAVERGVGADDAVVRGWLTRALTAPRGPQWICDKCQHIHPQWGPVCGNC 427

Query: 413 KTLCYFEWKIP 423
                  WK P
Sbjct: 428 AAFDTLSWKRP 438


>gi|99082666|ref|YP_614820.1| HemY-like [Ruegeria sp. TM1040]
 gi|99038946|gb|ABF65558.1| HemY-like protein [Ruegeria sp. TM1040]
          Length = 494

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 91/391 (23%), Positives = 164/391 (41%), Gaps = 9/391 (2%)

Query: 63  RFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLV 122
           RF       L     K    +GY+AL   LM++A      A  +      +    +  L 
Sbjct: 74  RFLNGDETALSRYFDKGRERRGYQALSDSLMALAVGEGRTA--LTKAAKAERYLQDPALT 131

Query: 123 YLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALD 182
            L+  Q A      + A E  + +L   +TR   V  +  +    GD  +A++ A KAL 
Sbjct: 132 DLVVAQAAEMAGDTHKAAEAYKRLLSDQSTRFVGVRGIMKQKLSEGDTETARQLAEKALA 191

Query: 183 ISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLIARSLENAD 238
           + P    V + +++    A++W+ A   L  K K      + + R  A+L ++ S     
Sbjct: 192 LRPKHEEVQDTLLKLQAQAEDWAGARQTLATKLKTGTLPREVFKRRDAVLALSSSKALLA 251

Query: 239 KGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANI 298
           +         AIE+ +L  + + A+  AA+S I++ K R A  IL+K W+  PHP++A+ 
Sbjct: 252 EEATPEQQEQAIEANRLSPDLVPAAALAARSYIAKGKPRNAVRILKKAWEAQPHPDLAHA 311

Query: 299 YTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPR 357
           +  +  +E    ++KR   L  +  +  E+ ++ +++ +      +A       +  AP 
Sbjct: 312 FAEIEPNETAEARVKRFEPLLRLKPDHDETRLVRAELLIVAEDFPEARRALGDLVDRAPD 371

Query: 358 KEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLSSVWLPLSPISKTLC 416
                L+A IE+        +  W   AL A   P W+ +   ++ + W P      +  
Sbjct: 372 ARALTLMAAIEKGEGGPDAMVQGWLTKALTAPRGPQWVCESCNHIHAEWAPTCENCASFD 431

Query: 417 YFEWKIPTKSPEYISSENINFSLEMAYPADD 447
              WK P ++PEY S+        +A   DD
Sbjct: 432 TLTWKRP-ETPEYHSATGAAMLPLLAGRQDD 461


>gi|119384727|ref|YP_915783.1| HemY domain-containing protein [Paracoccus denitrificans PD1222]
 gi|119374494|gb|ABL70087.1| HemY domain protein [Paracoccus denitrificans PD1222]
          Length = 596

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 95/420 (22%), Positives = 170/420 (40%), Gaps = 38/420 (9%)

Query: 2   LRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWILLF- 59
           L+++ +F ++ ++    + +S     +S+ +G+  Y   P  ++++ L   L  WI +  
Sbjct: 22  LKILIFFAIVLVLTLGAMQLSETGHGLSMVYGSTEYTLGPVQLVIAALVVVLLGWITVRL 81

Query: 60  ----------------AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLA 103
                           A++R+F            +    KGY AL  G++++A+      
Sbjct: 82  LGLFLAFLRFLLGDETAINRYFA-----------RSRERKGYDALSEGMLAVASGE--GK 128

Query: 104 RKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFE 163
                           ++  LL  Q A        A E    +L  P TR   +  L  +
Sbjct: 129 LAQDKAAKAAKFLDKPHVTDLLAAQAAEVAGDSRKAGEVYRRLLSDPRTRFVGIRGLMRQ 188

Query: 164 SCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWN- 222
               GD  +A + A KA  + P    V + ++Q      +W  A   L  K++  +    
Sbjct: 189 KLDEGDTVTALKLAEKAYALKPKHAEVQDTLLQLQTRQGDWKGARAVLKDKRQQGQLPKD 248

Query: 223 ---RNRAILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKA 279
              R  A+L +  + E    G+ I++   AI + +   + I A++ AA+S I+QN  R A
Sbjct: 249 VHIRRDAVLALKEASEVLAHGNSISAREAAISANRASPDLIPAAVLAARSYIAQNDPRNA 308

Query: 280 EVILEKIWKVNPHPEIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEM 338
             +L+K W V PHP IA  Y  ++  E    +L+R   L   N +  E+ ++ +++ L  
Sbjct: 309 GRVLQKTWSVRPHPSIAATYAEIVPDEKPAARLRRFEDLMRQNPDHEETRLLRAELLLAA 368

Query: 339 GSIDQA-HAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISD 397
                A  A   LA K  P      +LA +E+    +   +      AL A   P W+ D
Sbjct: 369 EDFPGARRALGDLAEK-HPTVRSLSILAAVERGEGGDDAVVRGILARALVASRGPQWVCD 427


>gi|159045958|ref|YP_001534752.1| hypothetical protein Dshi_3418 [Dinoroseobacter shibae DFL 12]
 gi|157913718|gb|ABV95151.1| hypothetical protein Dshi_3418 [Dinoroseobacter shibae DFL 12]
          Length = 502

 Score = 94.7 bits (234), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 95/440 (21%), Positives = 183/440 (41%), Gaps = 17/440 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSP-------FVILSILYFFLF 53
           +L+++ +  +++ +     ++    E V I+  +  +  SP        V+L   Y    
Sbjct: 5   LLKILIFVTLVAALTFGATLLMETGEQVRISLASTEFTLSPVAAVVLSLVLLGAAYLLFK 64

Query: 54  AWILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
              LL A  +F       +     +    KG++AL  G+M++A+    +A  M      +
Sbjct: 65  LAGLLLATLKFLNGDETAISRYFMRNRERKGFEALAQGMMALASGEGRVA--MAKAARAE 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  L  LL  Q A        A E  + ML    T+   V  L  +    GD  +A
Sbjct: 123 RYLGRPDLTQLLTAQAAELSGDRAKATETYKKMLTDERTKFVGVRGLLHQKLSEGDTETA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA---KEWNRNR-AILL 229
              A KA  + P    V + +++     + W+ A   L  K K+    ++ ++ R A+L 
Sbjct: 183 MALAEKAFALKPRNGEVQDTLLRLQAGDENWAGARKTLAAKLKSGDLPRDVHKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
            + + +  + G M  +   A E+ +L    + ++  AA+  I   K+R+A  +L K W++
Sbjct: 243 YSEAADAVEAGKMDKAEAHANEANRLAPGLVPSAALAARMAIRAGKQRQATKLLRKAWEL 302

Query: 290 NPHPEIANIYTHLLSENT-VGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
           NPHPE+A  Y  ++ + T   ++KR   L + N    ES ++++++ +       A  KA
Sbjct: 303 NPHPELAAAYAEIVPDETAAARIKRFEALVKPNPNHDESRLLMAELFIAAEDFPAAR-KA 361

Query: 349 MLAM-KIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLSSVWL 406
           M  + +  P      ++A +E+    +   +  W   A+ A   P W  ++   + + W 
Sbjct: 362 MGDLYETKPNARSLTIMAAVERGEGSDDAIVRAWLAKAVTASRGPQWTCENCNNIHASWT 421

Query: 407 PLSPISKTLCYFEWKIPTKS 426
           P+           W  P +S
Sbjct: 422 PVCGNCGAFDSLSWVEPPES 441


>gi|126732179|ref|ZP_01747980.1| HemY domain protein [Sagittula stellata E-37]
 gi|126707261|gb|EBA06326.1| HemY domain protein [Sagittula stellata E-37]
          Length = 518

 Score = 93.2 bits (230), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 98/407 (24%), Positives = 173/407 (42%), Gaps = 23/407 (5%)

Query: 57  LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHN----IPLARKMHSYVSQ 112
            L A+ RF       L    H+    KGY AL  G+M++A+      I  A+K   Y   
Sbjct: 68  FLVALLRFINGDETALSRHFHRNRERKGYAALSDGMMALASGEGRLAIAKAQKAEKY--- 124

Query: 113 QHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNS 172
               H   L  L+  Q A        A E  + +L    TR   +  +  +    GD N+
Sbjct: 125 ---LHKPELTDLVTAQAAEMMGDRKKAEETYKKLLTRDGTRFVGIRGIMKQKLASGDTNT 181

Query: 173 AQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAIL 228
           A + A +A  + P    V + ++Q      +W+ A   L  K K+       + R  A+L
Sbjct: 182 ALQLAERAFALKPKHEEVQDTLLQLQAEKADWTGARKTLQAKLKHGTLPRDVYKRRDAVL 241

Query: 229 LIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWK 288
            ++++ E  ++ + IA+   AIE+ +   + + A+  AA++ I+Q + R A  +L+K W+
Sbjct: 242 ALSQATEIENRDESIAAAEKAIEANRNSPDLVPAAAKAARAYIAQKRPRNAIRVLKKAWE 301

Query: 289 VNPHPEIANIYTHLLSENTVG-KLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAK 347
            +PHP++A  Y  +    T   ++KR + L  IN +  E+ ++ +++ L      +A   
Sbjct: 302 THPHPDLAAAYAEIEPNETPDERIKRFVPLTRINPDHRETRLLKAELNLAAEHFPEARRS 361

Query: 348 AMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLSSVWL 406
               ++  P   +  ++A IE+        +  W   A+ A   P W+ D+   +   W 
Sbjct: 362 LGDLVEKEPDARVLAIMAAIEKGEGAPDQVVRGWLAKAVTAPRGPQWVCDNCKTIHGEWR 421

Query: 407 PLSPISKTLCYFEWKIPTKSPEYISSENINF------SLEMAYPADD 447
           P            WK P +S E +     N       +LE   PA+D
Sbjct: 422 PTCTNCGAFDTLSWKTPAQS-EVVLPAQANMLPLIIGALEDKSPAED 467


>gi|310817089|ref|YP_003965053.1| HemY domain protein [Ketogulonicigenium vulgare Y25]
 gi|308755824|gb|ADO43753.1| HemY domain protein [Ketogulonicigenium vulgare Y25]
          Length = 514

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 107/520 (20%), Positives = 198/520 (38%), Gaps = 51/520 (9%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWILLF 59
           +L+++ +  +++ V    + ++  P    +T G       P   +++I    L  W +L 
Sbjct: 5   LLKILTFVVIVTGVTAGAVWLAEMPGGAVVTLGGVEVTLRPLESVVAIAIVMLLFWAVLR 64

Query: 60  -----------------AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHN--- 99
                            AVSR+F            +    KG KAL   ++++AA     
Sbjct: 65  LLGLLLAVLRFINGDDTAVSRYF-----------SRGRERKGMKALSDSVLALAAGEAKE 113

Query: 100 -IPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVY 158
            +  A+    Y+      H      +L    A    + ++A E  + +L    TR  A+ 
Sbjct: 114 ALARAKVADKYLGAPDVTH------VLLAHTAERAGETHLAEETYKELLTSDRTRFVALQ 167

Query: 159 SLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA 218
            L  +    GD  +A + A  A    P+   V + +++    + +W+ A   L +K +  
Sbjct: 168 GLMKQKLTAGDTVTALKLAEAAFKARPENVEVQDVLLRLQAESSDWAGARATLGEKARRG 227

Query: 219 ----KEWNRNRAILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQN 274
                 + R  A+L ++ +    D    I +   AIE+ +L  + + A++ AA+S I   
Sbjct: 228 ALPRDVYRRRDAVLALSEAQAVFDDKVPIDARERAIEANRLSPDLVPAAVMAARSYIKDG 287

Query: 275 KKRKAEVILEKIWKVNPHPEIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSK 333
             R A  +L K W+V PHP++A  +  ++  E    +L R   L  +  +  E+ ++ ++
Sbjct: 288 NPRYATRVLRKAWEVQPHPDLAEAFAEIMPDERPDQRLARFETLTNLRTDHAENKMLRAE 347

Query: 334 IALEMGSIDQA-HAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDP 392
           + +  G    A  A   L            L+A IE+    +   +  W   AL A   P
Sbjct: 348 LLIANGDFPAARRALGELVEGADATSRSLALMAAIERGMGADESVVRGWLTRALTAPRGP 407

Query: 393 LWISDD-GYLSSVWLPLSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPAD--DLQ 449
            W+    G + + WLP+           W  P  S   +        L +  P    DL 
Sbjct: 408 QWVCGQCGKVHAQWLPVCASCHGFDTLAWTTPPASDFAMPGGAAMLPLIVGAPVAPVDLS 467

Query: 450 SMLNNGKKNHLPSI---KKVSSFEDSTIHPLDPHIRQPDD 486
             +        P+     KV   E+  I P  P +  P++
Sbjct: 468 GDVVEQAVKPAPTPAPQTKVEDAEEEVILPPPPDVELPEE 507


>gi|304320180|ref|YP_003853823.1| hypothetical protein PB2503_03027 [Parvularcula bermudensis
           HTCC2503]
 gi|303299083|gb|ADM08682.1| hypothetical protein PB2503_03027 [Parvularcula bermudensis
           HTCC2503]
          Length = 512

 Score = 90.5 bits (223), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 90/414 (21%), Positives = 174/414 (42%), Gaps = 20/414 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++ +  +I+++  +   ++       I +G+    T+     S+L+       +L  
Sbjct: 1   MIRILVFLTIIAVLAAAITGLASVEGFAVIRFGD----TNITARSSVLFGAALIGAVLLI 56

Query: 61  VSRFFLSC----PAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIP----LARKMHSYVSQ 112
            +   LS     P+ +     +R  ++G  AL  GL ++AA +      LAR     + Q
Sbjct: 57  CATLILSGIVRLPSSIRRQRAERRRERGLIALTRGLEAVAAGDASDAQRLARTAQKQLGQ 116

Query: 113 QHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNS 172
           Q   +   L  LL  Q A        A +    MLQ P T    +  LY ++   GD   
Sbjct: 117 QG--NEAGLSRLLTAQAAQLAGDEETAQQSFAAMLQAPETEFLGLRGLYLQAMASGDRKE 174

Query: 173 AQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWN----RNRAIL 228
           A++YA +A  + P A W  ++V    +    W  A   L + +++  E      R  A L
Sbjct: 175 ARQYAERAFKLRPGASWAFQSVYALQLERGAWGEARDALLKAQQHGLEKGEPSRRREAAL 234

Query: 229 LIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWK 288
           L A +       D   +  +A E+L+       A++ AA+      ++ +A  +L++ W 
Sbjct: 235 LTAMAYGAEAAEDTDTAIKEAEEALRKAPGFAPAAVLAAELETKAGRRSRAGKLLDEAWA 294

Query: 289 VNPHPEIANIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAK 347
           ++PHP +A     + + E    +  R + L     E+ ES +++++    +G   +A A+
Sbjct: 295 ISPHPALAKTMDEIYAKEKLERRTDRLIALANKRPEADESQLLIAEQENRLGKFTEAKAR 354

Query: 348 AMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYL 401
               +   PR   F  +A   +   + ++    W   A +A  DP+  +D  ++
Sbjct: 355 LEPLLTRNPRARTFSAMAAAVR-GLYGSEAAQIWLDRAANAPLDPVPGADGSFV 407


>gi|46201304|ref|ZP_00208051.1| hypothetical protein Magn03009978 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 426

 Score = 89.7 bits (221), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 106/428 (24%), Positives = 184/428 (42%), Gaps = 11/428 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R + +  +  L +   + ++  P +V+I W      TS  V+L++L   L A  +L  
Sbjct: 1   MRRFLAFLVLTGLAVAGAVWLADRPGEVTIRWQGWRADTSVPVLLAVLALLLLALSVLIR 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R     P      L      KGY AL  GL + A+ +   A K+     +    H+  
Sbjct: 61  LIRLVFGAPKRWLAALRLSRQRKGYAALSDGLAAAASGDAARAAKLARKADK--LLHDPA 118

Query: 121 LVYLLEVQIA-LAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATK 179
           +  LL  Q A L+   + +A E+   M +   T       L   + + GD  +A+  A K
Sbjct: 119 ITGLLSSQAARLSGDDHQLA-ERFRAMTERKETAFLGHQGLAELAVKAGDRTTARAEAAK 177

Query: 180 ALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILLIARSLE 235
           A DISP AP ++  ++  ++ A  W+ A       +++      ++ R RA++L+ R+ +
Sbjct: 178 AFDISPTAPDLSVLLLDLHMEAGAWAEAEQVARLARRHGSLSEADFTRRRALILLGRAED 237

Query: 236 NADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHP-E 294
           +   GD   +   A +S         A   AA  L  + K RKA  +L+  +K + HP  
Sbjct: 238 SMAAGDEAQALDWAQDSRDADPQFTPAVALAADLLRRRGKGRKAASLLKSAFKTHAHPLL 297

Query: 295 IANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKI 354
           IA   T    E+ + ++KR   L + N  S E  V +++ AL       A +    A+  
Sbjct: 298 IAKWLTLGEGESALDRVKRLQDLSQANPASPEGHVALAEAALAAQLWGLARSHLEKALTQ 357

Query: 355 APRKEIFLLLAQIEQANSHNTDKILYW-TQSALHAMPDPLWISDD-GYLSSVWLPLSPIS 412
            P + +F LLAQ+E+    +      W  ++   ++P+P W+    G+ S  +    P  
Sbjct: 358 RPTRTVFQLLAQVERDERKDETAAHGWLMKAGTDSVPEPAWVCGGCGHHSPDFALCCPAC 417

Query: 413 KTLCYFEW 420
                 EW
Sbjct: 418 GAAGRLEW 425


>gi|254438357|ref|ZP_05051851.1| HemY N-terminal domain protein [Octadecabacter antarcticus 307]
 gi|198253803|gb|EDY78117.1| HemY N-terminal domain protein [Octadecabacter antarcticus 307]
          Length = 475

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 88/392 (22%), Positives = 168/392 (42%), Gaps = 10/392 (2%)

Query: 43  VILSILYFFLFAWILLFAVSRF-FLSCPAMLFHMLHKRNYD-KGYKALYTGLMSIAAHNI 100
           +I+ +   +L + ++  AV+ F FL+           RN + KGY+AL  G++++A+   
Sbjct: 37  LIILVALVWLVSKLVGLAVAAFKFLNGDETAISRYFSRNRERKGYEALSEGMLALASGEG 96

Query: 101 PLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSL 160
            LA  M      +       L  LL  Q A        A      +L    TR   V  +
Sbjct: 97  RLA--MAKANRAEKFLERPELTNLLTAQAAELAGDRKTAELTYRKLLANDKTRFVGVRGI 154

Query: 161 YFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA-- 218
             +  + GD ++A   A KA  I P      + +++      +W  A   L  K K    
Sbjct: 155 MKQKLQDGDTDTALLLAQKAFAIKPKHVETQDTLLRLQAEKSDWKGARETLTAKLKTGQL 214

Query: 219 -KEWNRNR-AILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKK 276
            +  +R R A+L ++ +     +G  + +   AIE+ ++  + + A++ AA+S +++N  
Sbjct: 215 PRNVHRRRDAVLALSEAKGVFAEGATLEAQEAAIEANRMSPDLVPAAVMAAQSHVNKNAD 274

Query: 277 RKAEVILEKIWKVNPHPEIANIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIA 335
           R A  +++K W + PHP++A  +  +   E+   +LKR   L + + +  E+ ++++++ 
Sbjct: 275 RAATRVIKKAWDIAPHPDLAAAFAAIAPHEDPAVRLKRFGALTKAHPDHPETRMLLAELN 334

Query: 336 LEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWI 395
           L      +A       +   P      ++A IE+        +  W   AL A   P WI
Sbjct: 335 LAAEDFPEARRAITELVAQDPTARSLTIMAAIERGEGSTDAVVRGWLSKALIATRGPQWI 394

Query: 396 SDD-GYLSSVWLPLSPISKTLCYFEWKIPTKS 426
            D+  ++   W+P+           W+ P K 
Sbjct: 395 CDNCQHIHPAWVPVCVNCSGFDTLAWREPPKG 426


>gi|260575763|ref|ZP_05843759.1| HemY domain protein [Rhodobacter sp. SW2]
 gi|259021916|gb|EEW25216.1| HemY domain protein [Rhodobacter sp. SW2]
          Length = 491

 Score = 88.2 bits (217), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 90/385 (23%), Positives = 154/385 (40%), Gaps = 10/385 (2%)

Query: 57  LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTF 116
           LL AV +F       +     +    KGY+AL  G++++A+    +A  +      Q   
Sbjct: 69  LLVAVLKFLNGDETAVSRYFDRNRERKGYQALSEGMIALASGEARVA--LSRAAKAQKYL 126

Query: 117 HNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRY 176
               L  LL  Q A        A E  + +L    TR   V  L  +    GD  +A + 
Sbjct: 127 GKPELTTLLTAQAAELAGDSARATEAYKALLTDEKTRFVGVRGLMLQKVASGDKATALKL 186

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLIAR 232
           A KA  + P      + ++Q      +W  A T L  K +      + + R  A+L +  
Sbjct: 187 AEKAFAMKPRHTETQDVLLQLQASQADWKGARTTLGAKLRAGTLPREVFRRRDAVLALQE 246

Query: 233 SLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPH 292
           +    D+   I S   AIE+ KL  + I A+  AA+S I++   + A  +L+K W+  PH
Sbjct: 247 AKTVFDESASIESREAAIEANKLSPDLIPAAAMAARSYIAKGDAKNATRVLKKAWEARPH 306

Query: 293 PEIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLA 351
           P++A  +  +  +E+   +LKR   L  I+    E+ ++++++ L       A       
Sbjct: 307 PDLAAAFAEIEPTESAQARLKRFKLLTAIHPTHEETRLLLAELNLAAEDFPAARRIIGDL 366

Query: 352 MKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGY-LSSVWLPLSP 410
               P      ++A IE+    +   +  W   AL A   P W  D    + + W P+  
Sbjct: 367 ATSHPTGRSLAIMAAIERGEGADDAVVRGWLARALTAPRGPQWCCDKCQGIHAQWTPICD 426

Query: 411 ISKTLCYFEWKIPTKS--PEYISSE 433
                    W+ P +   P    +E
Sbjct: 427 NCGAFDTLSWREPPEGSRPSSTGTE 451


>gi|89056574|ref|YP_512025.1| HemY-like [Jannaschia sp. CCS1]
 gi|88866123|gb|ABD57000.1| HemY-like protein [Jannaschia sp. CCS1]
          Length = 509

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 104/501 (20%), Positives = 193/501 (38%), Gaps = 26/501 (5%)

Query: 4   LIRYFFVISLVICSFIIVSHYPE----DVSITWGNRLYRTSPFVILSILYFFLFAWIL-- 57
           L++    I++V+ +   ++   E     + I +G     T    ++  +   L  WIL  
Sbjct: 6   LLKIIIFIAIVVGAVFGITLLTEMDNLGILIIFGREFVITPLLAVIGAVILLLAVWILFK 65

Query: 58  ----LFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
               L A  R        L     +R+  KGY AL   +M++AA    LA  +      +
Sbjct: 66  VVGLLVAFLRMLNGDETALTRYWSRRSERKGYDALGDAMMALAAGEGRLA--IRKAERAR 123

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  L  L+  Q A       +A E  + M+    TR   V  L  +    GD ++A
Sbjct: 124 KALGRPELTNLVVAQGAEMVGDKALATETYKAMVTDDRTRFVGVRGLMQQRLDDGDTDTA 183

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA---KEWNRNR-AILL 229
            + A KAL + P    V   ++      ++W  A   L    K     ++ +R R A+L 
Sbjct: 184 LKLAEKALVLRPKNADVQTTLISLQSRQEDWQGARGTLAAALKAGNVPRDLHRRRDAVLA 243

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           +A + +   +G ++ +  D  E+ +L    + A++ + +  +    KR+A   + K W  
Sbjct: 244 LAHARDAMAEGQVVTATRDVAEANRLAPGLVPAAVMSTRLAVEAGNKRQAAKTIRKAWDQ 303

Query: 290 NPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAM 349
            PHP++A  +  L+  +    L+       + K      V + +  L + + D   A+  
Sbjct: 304 APHPDLAAAFA-LIEPDETPALRLRRFRPLLGKHPTHPEVKMLEAELHIANEDFPAARKA 362

Query: 350 LA--MKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLSSVWL 406
           L    + AP      ++A +E+        +  W   A+ A     W+ D+ G++   W 
Sbjct: 363 LGDLAESAPTARSLTIMAAVERGEGSPDRIVRGWLARAVTAPRGNQWLCDNCGHVHEDWT 422

Query: 407 PLSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKV 466
           P+    ++    +W  P +S   ++       L +    D  QS          P  ++ 
Sbjct: 423 PVCVNCESFDTLDWAEPRQSETSLAGPTQMLPLIVGALED--QSDAPEAAPEAGPDAEEE 480

Query: 467 SSFEDSTIHPLDPHIRQ--PD 485
           +   D T  P +P   Q  PD
Sbjct: 481 AEILDDT--PAEPEAAQVTPD 499


>gi|114568597|ref|YP_755277.1| HemY domain-containing protein [Maricaulis maris MCS10]
 gi|114339059|gb|ABI64339.1| HemY domain protein [Maricaulis maris MCS10]
          Length = 492

 Score = 80.9 bits (198), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 119/507 (23%), Positives = 209/507 (41%), Gaps = 43/507 (8%)

Query: 1   MLRLIRY--FFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILL 58
           M+RLI    F +++ V+ +F+ ++  P   S  +   +    PFV+ + L   L   +L+
Sbjct: 1   MIRLILAVAFALLTAVLGAFLALN--PGHASFEFLG-MQTEMPFVVAAGLVILLAFLMLV 57

Query: 59  FAVSRFFL-SCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFH 117
                + L + P  +   + +R  ++GY AL   L++ AA +   A  +           
Sbjct: 58  VWWGIYMLWTSPDKVKGFMGRRRREQGYDALEKALIASAAGDGEAA--VRQAARADALLD 115

Query: 118 NEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYA 177
              L  LL  + A +      A    E +L    TR  A   L   S   GD  +   +A
Sbjct: 116 RPALSRLLAARAAESAGNLEGAQVHYEALLNDQKTRVVARRGLAQLSNERGDFAATIDHA 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILLIARS 233
             A   +  A W  +A+    V    W  A+T L + ++  +       R R++LL A +
Sbjct: 176 GDAFQQAKGARWAFDALFDAQVAKARWRDALTTLTEGERRKQVAPDTARRRRSVLLTAAA 235

Query: 234 LENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHP 293
           +E A+  D   +   A+ + +       A+  AA+ L    + ++A  +LE  W   PHP
Sbjct: 236 VE-AEGTDSENARELAVSAHRAAPGFAPAAALAARLLADGRRHKRASEVLESAWAAAPHP 294

Query: 294 EIANIYTHLLSENTVGK-LKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAM 352
            +A  +  L   +T  K L+R   L  +N +  ES +++ +IALE G  D   A+A+L  
Sbjct: 295 ALARAFQDLRKSDTKAKRLERLKTLAALNPDHRESHLVLIQIALEEG--DAPAARALLDP 352

Query: 353 ---KIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLW--ISDDGYLSSVWLP 407
                 P   +  L A++ + +  + +    W   A HA  D  W  I  +G L      
Sbjct: 353 MMDGTPPSSRLCALAARLARLDGKD-ELARRWMTRASHAGADADWSDIDPEGRL----FA 407

Query: 408 LSPIS-KTLCY-FEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKK 465
            +P   K + Y F  +     P Y   E    ++         ++ L +  +    +  +
Sbjct: 408 YTPDDWKRMVYVFGDENRLTHPRYERFERAAGAVP--------ETALLDAPRPVRSASSR 459

Query: 466 VSSFEDSTIHPLDPHIRQPDDPGIKEQ 492
            +SF ++T        R PDDPG+ E+
Sbjct: 460 TTSFAEATP-------RMPDDPGVPEE 479


>gi|163797972|ref|ZP_02191914.1| Uncharacterized enzyme of heme biosynthesis [alpha proteobacterium
           BAL199]
 gi|159176766|gb|EDP61337.1| Uncharacterized enzyme of heme biosynthesis [alpha proteobacterium
           BAL199]
          Length = 456

 Score = 79.3 bits (194), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 97/448 (21%), Positives = 179/448 (39%), Gaps = 23/448 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITW-GNRLYRTSPFVILSILYFFLFAWI--L 57
           M R   Y   +++++   I +   P D+ I W G RL    PF +  ++   +  W+  +
Sbjct: 1   MRRSFLYIIRLAILVALAIWLVRNPGDIRIDWIGWRL--EMPFALFMVITVAV-TWVAGI 57

Query: 58  LFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFH 117
              ++   L  P  +      +  + G++AL  GL +IAA +   AR+      +     
Sbjct: 58  GLRMAAGALGAPWAVMRRRADQRRESGFRALTLGLAAIAAGDAEEARRQAREADR--LLR 115

Query: 118 NEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYA 177
           +  L  LL  Q A        A      +     T    +  L  ++   GD   +   A
Sbjct: 116 DPSLTRLLSAQAAALNGDTAAAARYFAALRDNEDTAFLGIVGLLRQALARGDEARSLELA 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNRNRAILLIARS 233
            +A  + PDAP V    +     A+ W  A   L    K      ++  R+R+ LL  R+
Sbjct: 176 EEAYAMRPDAPLVATTRLYGRARARRWFDAQVALYDAVKRRIVPEEDGRRHRSALLTERA 235

Query: 234 LEN--ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
            E   ADK D    +  A ++ +     + A    A+ L    K ++ + ++E+ W  +P
Sbjct: 236 REALAADKLDEALEF--AGKARESVPGFVPAVALEAELLGRTGKAKRGQRLIEEAWPKSP 293

Query: 292 HPEIANIYTHLLSE-NTVGKLKRALRLEEINKESVESLVIVSKIAL--EMGSIDQAHAKA 348
           HP +   Y  L++E N + + KR   L +   +  ES + +++ AL  E+    +   +A
Sbjct: 294 HPALTEAYRGLVTETNLIDRFKRLHALADHAVDHPESRMTIAEAALDAELWGEARVQLEA 353

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLSSVWLP 407
           +    +  R     L A++E A   +      W + +  A  DP W     G ++  W  
Sbjct: 354 LTGSDLTARA--CRLRARLEDAEHGDDRAARLWLERSGSAPADPAWTCGSCGAVAPDWSA 411

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENI 435
           +           W +P +    +SS+++
Sbjct: 412 VCGHCGEFDTVAWTLPPRV-SVLSSDDV 438


>gi|254292446|ref|YP_003058469.1| HemY domain protein [Hirschia baltica ATCC 49814]
 gi|254040977|gb|ACT57772.1| HemY domain protein [Hirschia baltica ATCC 49814]
          Length = 495

 Score = 78.2 bits (191), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 95/413 (23%), Positives = 171/413 (41%), Gaps = 23/413 (5%)

Query: 2   LRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFV--ILSILYFFLFA--WIL 57
           +R++    V+ L I +     + P+DVSI +    Y  S +   IL I+   L A  W +
Sbjct: 1   MRIVILLAVVILTIAAVTYAFNAPDDVSIAFNGAEYGMSRYTAGILVIVTGALVAVGWYV 60

Query: 58  LFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHN----IPLARKMHSYVSQQ 113
           L  +    L  P  L     +  + K   AL  GL++    +    +  ARK  +     
Sbjct: 61  LSTI----LRIPFALNRSAKRARFGKARNALADGLIAAEGGDSIDALKKARKSTNLAKSD 116

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
            +  +  L YLL  + A A   ++ A      + +        +  L   + + GDL  A
Sbjct: 117 AS--DRKLSYLLAARAAEANGDWSDAEHAYSDLSREKGAELVGLRGLAAAAIQRGDLRGA 174

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFL--NQKKK--NAKEWNRNRAILL 229
           + +  KAL +  +A W    + +    A +W  A   L   +K+K  + +   R RA+L 
Sbjct: 175 ETHTRKALSLKSNASWPFSTLFELQTKAADWESANETLTIGEKRKSIDLEVARRRRAVLH 234

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
            A++     K    A    A ++ ++  +   A+  AA   ++  K  KA+  +E  W++
Sbjct: 235 TAQASRIRQKAPEKAERL-AADAARMAPSFPPAAYIAASLQLAAGKASKAQASIEGAWRI 293

Query: 290 NPHPEIANIYTHL-LSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP +A ++  L  +E T  + KR   L  IN    ES +++ + A+  G  D+A    
Sbjct: 294 RPHPALALLWRDLKTNEPTSARAKRLNALAHINPSHRESRILLVEAAMIQGQWDEAEETL 353

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLW--ISDDG 399
              ++      +  L+  I      + ++   W++ A  A  +  W  I  DG
Sbjct: 354 SHVLREGETTRLCTLMEAI-VGGRGDVEQASRWSRLASSAAREADWSDIDPDG 405


>gi|294679027|ref|YP_003579642.1| HemY domain-containing protein [Rhodobacter capsulatus SB 1003]
 gi|294477847|gb|ADE87235.1| HemY domain protein [Rhodobacter capsulatus SB 1003]
          Length = 480

 Score = 75.9 bits (185), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 89/390 (22%), Positives = 158/390 (40%), Gaps = 10/390 (2%)

Query: 42  FVILSILYFFLFAWIL--LFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHN 99
            + L+IL  +L   +L  +FA  RF       +     +    KGY+AL  G++++A+  
Sbjct: 51  LIGLAILTIWLALKVLGFVFAFIRFVTGDETAISRYFDRNRERKGYEALAEGMLAVASGE 110

Query: 100 IPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYS 159
             LA    S    +       L  LL  Q A+       A E    +L    TR   V  
Sbjct: 111 SKLAASKASKA--ERYLRRPELTNLLTAQAAMMNGDTRKAEEVYRKLLADQRTRFVGVQG 168

Query: 160 LYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA- 218
           L  +    GD ++A + A KA  ++P    V   + +      +W  A   L  K +   
Sbjct: 169 LLSQKLAEGDTDTAVKLAQKAFALNPKNLEVQNTLFKLQTEVGDWKGARDVLLAKMRQGQ 228

Query: 219 --KEWNRNR-AILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNK 275
             K+ ++ R A+L +  +    D G  I +   AI + K   + I A+  AAK+   +  
Sbjct: 229 LPKDVHKRRDAVLALQEAKAVLDGGTSIEAQEAAIAAAKASPDLIPAAAMAAKAHYDKGD 288

Query: 276 KRKAEVILEKIWKVNPHPEIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKI 334
            + A  +L K W+  PHP++A ++  ++  E+   +LKR  +L  +  +  E+ ++ +++
Sbjct: 289 AKSATRVLLKAWEAQPHPDLAAVFASMVPGESATERLKRFEKLLSLRPDHEETRLLRAEL 348

Query: 335 ALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLW 394
            +       A       ++  P   +  L+A IE+    +   +  W   AL A     W
Sbjct: 349 CIAAEDFPAARRALGNLVEANPTSRVLTLMAAIERGEGEDDAVVRGWLAKALTAPRGKQW 408

Query: 395 ISDDGY-LSSVWLPLSPISKTLCYFEWKIP 423
             D    + S W P+           W+ P
Sbjct: 409 CCDKCQNIQSQWGPVCDNCGGFDTLSWREP 438


>gi|83945092|ref|ZP_00957458.1| hypothetical protein OA2633_10694 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851874|gb|EAP89729.1| hypothetical protein OA2633_10694 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 487

 Score = 73.2 bits (178), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 107/420 (25%), Positives = 173/420 (41%), Gaps = 39/420 (9%)

Query: 1   MLRLIRYFFVISLVICSFIIV--SHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILL 58
           M+RL     VI+ V+ + + V  +  P  V++ +  +  + +PF  L++    L A++L+
Sbjct: 1   MIRLT--LTVIACVLTAMLAVFLTLNPGLVTVEFLGQTTQ-APFA-LAMGALILAAFVLV 56

Query: 59  FA--VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTF 116
            A  V     S P        +R  D+G+ AL   L++ AA    LA  +      +   
Sbjct: 57  VAWWVIAKLWSAPEAWKRFSLRRRRDQGFDALERALIASAAGQGDLA--VRQAARAEALL 114

Query: 117 HNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRY 176
               L  LL  + A A      A    E ML    TR  A   L   +    D      +
Sbjct: 115 DRPALSRLLAARAAEAAGDLESAQIHYEAMLADAKTRLVAQRGLVGIAQSRSDSQGLLTH 174

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILLI-- 230
           A  A + +  A W  +A+ +  V    W++A   L + ++          R RA+LL   
Sbjct: 175 AADAFEQAGRARWAFDALFEAQVNVALWAKAEATLTEGERRGHVDRLVAARMRAVLLTAE 234

Query: 231 ARSLENADKGDMIASYHDAIESLKLCDNSIMASIC-------AAKSLISQNKKRKAEVIL 283
           AR LE+AD             + +L D +  +S         A + L  Q + R+A  IL
Sbjct: 235 ARRLESADP----------ETAARLADRAATSSPGFAPAAELAGRLLAEQRRHRRAVDIL 284

Query: 284 EKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLE---EINKESVESLVIVSKIALEMGS 340
           E  WK  PHP +A  + +L   +T  K KRA RL     +N +  ES +++ + AL+ G+
Sbjct: 285 EDAWKHAPHPALARAFANLRRSDT--KAKRAERLRGLAALNPDHRESRLLLVETALDQGN 342

Query: 341 IDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWIS-DDG 399
            + AH+     ++ +P       LA        N +    W   A HA  +  W   D+G
Sbjct: 343 REAAHSALKPVLETSPVSARACALAARLARLEENPEDAQRWMARASHAPAEADWSDIDEG 402


>gi|83313522|ref|YP_423786.1| hypothetical protein amb4423 [Magnetospirillum magneticum AMB-1]
 gi|82948363|dbj|BAE53227.1| Uncharacterized enzyme of heme biosynthesis [Magnetospirillum
           magneticum AMB-1]
          Length = 426

 Score = 68.9 bits (167), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 91/429 (21%), Positives = 173/429 (40%), Gaps = 13/429 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITW-GNRLYRTSPFVILSILYFFLFAWILLF 59
           M R + +  +  L +   + ++  P +V+I W G RL  T P ++  +    +   +L  
Sbjct: 1   MRRFLVFVVLTGLAVAGAVWLADRPGEVTIRWQGWRLDTTVPVLLAVLALLLVGLSLLAR 60

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
            V R     P             KGY AL  GL + A+ +   A K+     +     + 
Sbjct: 61  LV-RAVFGAPGRWLQSRRLGRQRKGYMALSDGLAAAASGDAARAAKLSRKADK--LLKDP 117

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATK 179
            +  LL  Q A      +   ++   M     T       L   + + GD   A+  A +
Sbjct: 118 AVTALLTTQAAQLGGDADQLRDRFRAMTGRKETAFLGHKGLAELALKSGDRAIARDEAAR 177

Query: 180 ALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILLIARSLE 235
           A ++ P A  +   ++  +V A  W+ A   L   +++      ++ R  A++L+ R+ E
Sbjct: 178 AFELQPMAADLAVQLLDLHVEAGAWAEAEQVLRLARRHGAVSEADFPRRHALILLGRAEE 237

Query: 236 NADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQ-NKKRKAEVILEKIWKVNPHPE 294
               GD   +  D  +  +  D     +I  A  L+ +  K RKA  +L+  +K +PHP 
Sbjct: 238 ALRAGDESLAL-DWAQDARDADPLFTPAITLAADLLRRRGKGRKAASLLKAAFKAHPHPL 296

Query: 295 IANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMK 353
           +   +  L   E+ + ++K    L + N  + E  + +++ AL+      A      A +
Sbjct: 297 LITEWRKLGDGESALDRVKSLQELAQANPGAPEGHMALAEAALDAQLWGLARTHLAKAQE 356

Query: 354 IAPRKEIFLLLAQIEQANSHNTDKILYWT-QSALHAMPDPLWISDD-GYLSSVWLPLSPI 411
             P + +F LLA++E+    +      WT ++A  ++P+  W     G+ +  +    P 
Sbjct: 357 QRPTRAVFALLARVERDERKDEAAANAWTLKAATDSVPESSWTCGGCGHQTPDFALSCPA 416

Query: 412 SKTLCYFEW 420
                  EW
Sbjct: 417 CGAAGRLEW 425


>gi|114798425|ref|YP_761904.1| HemY domain-containing protein [Hyphomonas neptunium ATCC 15444]
 gi|114738599|gb|ABI76724.1| HemY domain protein [Hyphomonas neptunium ATCC 15444]
          Length = 478

 Score = 67.4 bits (163), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 69/258 (26%), Positives = 115/258 (44%), Gaps = 18/258 (6%)

Query: 102 LARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLY 161
           LARK     S +H   +E L  LLE + A A   +  A     ++ ++P  +   +    
Sbjct: 109 LARK-----SMRHA-EDERLKLLLEARAAEANDDWAGAERAWGLLTRLPGGQLAGLRGSA 162

Query: 162 FESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK-- 219
             +   GD  +A+  A +AL++  DA W   ++    V   +W +A+  L   +K     
Sbjct: 163 TAASERGDPLTAETRAREALELRSDADWPFNSLFDIQVAKGDWDKALDTLAMGEKRGLVE 222

Query: 220 --EWNRNRAILLIARS--LENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNK 275
                R RA+L  AR+  L  A+K     S  DAI S     +   A+   A+ L+   K
Sbjct: 223 GINLKRRRAVLFTARAVNLPIAEKPAAQKSLADAIRS---APDFPPAAYHGARFLMVDGK 279

Query: 276 KRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALR-LEEINKESVESLVIVSKI 334
            + A+ +LE  WK  PHP +A +   L+ ++T   +   L+ L + +    ES ++ ++ 
Sbjct: 280 AKAAQGVLELGWKARPHPALAQLSRRLVPQDTRENIAARLKALVDAHPSHRESRILAAE- 338

Query: 335 ALEMGSIDQAHAKAMLAM 352
            L M S D   A   LA+
Sbjct: 339 -LSMDSADWVEAIKTLAL 355


>gi|114329085|ref|YP_746242.1| hypothetical protein GbCGDNIH1_2421 [Granulibacter bethesdensis
           CGDNIH1]
 gi|114317259|gb|ABI63319.1| hypothetical secreted protein [Granulibacter bethesdensis CGDNIH1]
          Length = 434

 Score = 66.6 bits (161), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 95/439 (21%), Positives = 177/439 (40%), Gaps = 22/439 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLY--RTSPFVILSILYFFLFAWILL 58
           M R+I+     ++V+ +   V+  P  V +T G+ L    + P  I++++   L   +LL
Sbjct: 1   MRRIIKIVLPAAVVVAAAWYVAGLPGHVGMTVGDDLTIDMSVPAAIVAVVILVLAVHLLL 60

Query: 59  FAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHN 118
            AV    L  P  +      R    G  A+   L+S+AA +   A +       +    +
Sbjct: 61  RAVG-AILGLPRTIRRWRQARTRQAGDYAVSRALVSLAAGDAGGAWREAGKA--RACLGD 117

Query: 119 EYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYAT 178
                LL  + A    + + A +    + +           L  E+    D  SA   A 
Sbjct: 118 TAQTLLLMAEAARLSGRESEATQAFHALTRTEDASFLGYRGLLREAITREDWTSAAELAR 177

Query: 179 KALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENAD 238
           KA    P A W+    V   +    W  A++     ++ A       A       L+ A+
Sbjct: 178 KAELAHPGAAWLRTERVNLAIRGGRWMDALSLAENDQQRAAF-----ATAAAQAELDQAE 232

Query: 239 KGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANI 298
           K         A ++ +L  +   A+I  A +L +  ++R+++ +L K W  +P P++A +
Sbjct: 233 K------LRTARQAFRLDPSLTSAAIAYATTLRAAGRQRRSDAVLVKAWAAHPQPDLAVV 286

Query: 299 YTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRK 358
               ++ + + +++   RL   N    ES +++++  L  G   +A + A  A ++  +K
Sbjct: 287 ALSGVT-DPLTRVRTVKRLVAGNPGHPESHLLLARENLAAGLTGEARSHAEQASRLIDQK 345

Query: 359 EIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWIS-DDGYLSSVWLPLSPISKTLCY 417
            ++LLLA IE+        +    + A  A PDP W     G+ ++ W    P   T   
Sbjct: 346 RVWLLLADIEEKEHGPGAAMQAALRRASEASPDPGWRCLHCGHATTHWAAACPACHTPGQ 405

Query: 418 FEWKIPTKS----PEYISS 432
             W  P  +    P  +SS
Sbjct: 406 IRWTTPGDAGVALPPVLSS 424


>gi|23004378|ref|ZP_00047740.1| hypothetical protein Magn03000405 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 250

 Score = 65.5 bits (158), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/235 (22%), Positives = 106/235 (45%), Gaps = 6/235 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R + +  ++++     + ++ +P  V++ W       S  + L+ +        +++A
Sbjct: 1   MWRALVFLALLAIAAYGAVWIADHPGSVTVVWNGYEIGMSLAIALTGVLVAAIIIGIIWA 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +    +  PA +     +R  +KG  +L  G++++ + + PLA + H+    +    ++ 
Sbjct: 61  IMSGVIGLPASISRSTRERRRNKGLASLSRGMIAVGSGD-PLAARRHAG-DAERLLGSQP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL+ Q A        A +  + M   P TR   +  L+ E+ R  D  +A+ YAT+A
Sbjct: 119 LTLLLKAQAAQISGDREAAEQAFKRMADDPETRVLGLRGLFVEARRREDEGAARAYATEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIA 231
             ++P   W  EAV++      EWS A   + ++      +     R RA+LL A
Sbjct: 179 ARLAPSVTWANEAVLEAQCADGEWSAATETVERRASLGLMDKSVARRQRAVLLTA 233


>gi|58616804|ref|YP_196003.1| hypothetical protein ERGA_CDS_00770 [Ehrlichia ruminantium str.
           Gardel]
 gi|58416416|emb|CAI27529.1| Hypothetical protein ERGA_CDS_00770 [Ehrlichia ruminantium str.
           Gardel]
          Length = 413

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 80/366 (21%), Positives = 158/366 (43%), Gaps = 34/366 (9%)

Query: 41  PFVILSILYFFLFAWI-LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHN 99
              I+++++ F+   I L+F V + F  C         KR  DK    L  G M +   N
Sbjct: 42  ALCIIAVIFLFVILLIRLVFYVCQCFYGCK--------KRRQDKRIILLDQGYMHLNCGN 93

Query: 100 IPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEK-LEMMLQIPATREFAVY 158
           I  A K    +++ H F +  L +LL+ +      +Y +A +  ++    +P        
Sbjct: 94  IEKADKC---ITKLHDFDHPSL-FLLKGRFYFDSNKYTLAEKYFIQFSKVVPIIDATLGI 149

Query: 159 SLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQ--KKK 216
            +     +I D +       K L+I     W     ++   ++++W+ AI  +++  K K
Sbjct: 150 HILNHIKQIEDQSKQLSLFRKMLEIFYKQAWSPIFKLEICCISRDWNSAIEEMHKIIKLK 209

Query: 217 NAKEWNRNRAILLIARSLENADKGDMIASYHDAIESLKLCDN-------SIMASICAAKS 269
               ++    + ++  +L          +Y    + L + DN         + ++  A+ 
Sbjct: 210 INVPYDTQETLCILYYAL-----AKQYYTYQKYDDGLYVFDNMKHYSKHRTVITLLRAQL 264

Query: 270 LISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLV 329
            I+ NKKRKA  +LE  ++++PHP+IA++Y  ++  ++    +   RL  IN +   S+ 
Sbjct: 265 YINTNKKRKAIQLLESEYRISPHPDIAHLYLEIMHHDS----QAIHRLYNINSDYYFSIY 320

Query: 330 IVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSA-LHA 388
           ++ + AL +G  D A        K      ++ L+ +++      T+ +LYWT  A   A
Sbjct: 321 LIVQDALNLGEYDLAMKHLNNVFKSRTYLSLYFLMLKLKVLVQDYTE-LLYWTDKASKDA 379

Query: 389 MPDPLW 394
           + D  W
Sbjct: 380 ITDQHW 385


>gi|57238815|ref|YP_179951.1| hypothetical protein Erum0840 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58578744|ref|YP_196956.1| hypothetical protein ERWE_CDS_00800 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57160894|emb|CAH57799.1| putative integral membrane protein [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417370|emb|CAI26574.1| Hypothetical protein ERWE_CDS_00800 [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 413

 Score = 60.5 bits (145), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 79/366 (21%), Positives = 158/366 (43%), Gaps = 34/366 (9%)

Query: 41  PFVILSILYFFLFAWI-LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHN 99
              I+++++ F+   I L+F V + F  C         KR  DK    L  G M +   N
Sbjct: 42  ALCIIAVIFLFVILLIRLVFYVCQCFYGCK--------KRRQDKRIILLDQGYMHLNCGN 93

Query: 100 IPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEK-LEMMLQIPATREFAVY 158
           I  A K    +++ H F +  L +LL+ +      +Y +A +  ++    +P        
Sbjct: 94  IEKADKC---ITKLHDFDHPSL-FLLKGRFYFDSNKYTLAEKYFIQFSKVVPIIDATLGI 149

Query: 159 SLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQ--KKK 216
            +     +I D +       K L+I     W     ++   ++++W+ AI  +++  K K
Sbjct: 150 HILNHIKQIEDQSKQLSLFRKMLEIFYKQAWSPIFKLEICCISRDWNSAIEEMHKIIKLK 209

Query: 217 NAKEWNRNRAILLIARSLENADKGDMIASYHDAIESLKLCDN-------SIMASICAAKS 269
               ++    + ++  +L          +Y    + L + DN         + ++  A+ 
Sbjct: 210 INVPYDTQETLCILYYAL-----AKQYYTYQKYDDGLYVFDNMKHYSKHRTVITLLRAQL 264

Query: 270 LISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLV 329
            I+ NKKRKA  +LE  ++++PHP+IA++Y  ++  ++    +   +L  IN +   S+ 
Sbjct: 265 YINTNKKRKAIQLLESEYRISPHPDIAHLYLEIMHHDS----QAIHKLYNINSDYYFSIY 320

Query: 330 IVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSA-LHA 388
           ++ + AL +G  D A        K      ++ L+ +++      T+ +LYWT  A   A
Sbjct: 321 LIVQDALNLGEYDVAMKHLNNVFKSRTYLSLYFLMLKLKVLVQDYTE-LLYWTDKASKDA 379

Query: 389 MPDPLW 394
           + D  W
Sbjct: 380 ITDQHW 385


>gi|16124330|ref|NP_418894.1| hypothetical protein CC_0075 [Caulobacter crescentus CB15]
 gi|221233012|ref|YP_002515448.1| HemY domain membrane protein [Caulobacter crescentus NA1000]
 gi|13421172|gb|AAK22062.1| hypothetical protein CC_0075 [Caulobacter crescentus CB15]
 gi|220962184|gb|ACL93540.1| HemY domain membrane protein [Caulobacter crescentus NA1000]
          Length = 511

 Score = 60.1 bits (144), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 84/317 (26%), Positives = 134/317 (42%), Gaps = 10/317 (3%)

Query: 86  KALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEM 145
           +AL  G +++AA +   AR++ +  S +       LV +L  Q A A      A      
Sbjct: 86  EALSRGFLAVAAGDGSEARRL-AQKSSELAEDAPALVRVLAAQAAEAAGDRGAAKSAYNA 144

Query: 146 MLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWS 205
           ML  P  R   +  L   +   GD  +A R+A  A  ++  A W   A+++  + A +W+
Sbjct: 145 MLGFPEMRLAGLRCLMLAAQAEGDRQTAIRHAETAYGLARTARWAWRALLEARLEAGDWA 204

Query: 206 RAITFLNQKKKN------AKEWNRNRAILLIARSLENADKGDMIASYHD-AIESLKLCDN 258
            A+  +    +         E +R   +   A SL NAD     A   D A +S+KL  +
Sbjct: 205 AALQLVQGALERKIVSPVVAERSRAALLAASAASLVNADDPKTRAQALDFATQSVKLKPD 264

Query: 259 SIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHL-LSENTVGKLKRALRL 317
                + AA+ L    K  KA  ++E  WK  PHP +   Y  L  +E    + +R   L
Sbjct: 265 FAPGVVMAARLLAEDGKTAKAGGLIETAWKAEPHPALWLAYRDLKTNETPKARAQRLAAL 324

Query: 318 EEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDK 377
             +  E+ ES ++  + AL  G    A A A L    AP      L+A++  AN  + D+
Sbjct: 325 AAMKPEARESRLLRVESALIGGDPVAARAAARLLDDEAPTARFAGLMARVAAANG-DADE 383

Query: 378 ILYWTQSALHAMPDPLW 394
              W    + A  +P W
Sbjct: 384 ARAWIARGVAAPQEPDW 400


>gi|295687520|ref|YP_003591213.1| HemY domain-containing protein [Caulobacter segnis ATCC 21756]
 gi|295429423|gb|ADG08595.1| HemY domain protein [Caulobacter segnis ATCC 21756]
          Length = 511

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 86/317 (27%), Positives = 135/317 (42%), Gaps = 10/317 (3%)

Query: 86  KALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEM 145
           +AL  G +++AA +   AR++ +  S +       LV +L  Q A A      A      
Sbjct: 86  EALTRGFLAVAAGDGSEARRL-AQKSAELAEDAPGLVRVLAAQAAEAAGDRGAAASAYNA 144

Query: 146 MLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWS 205
           ML  P  R   +  L   +   GD  +A R+A  A  ++  A W   A+++  + A +W+
Sbjct: 145 MLGFPEMRLAGLRGLMQAALADGDKITALRHAETAYGLARTARWAWRALLEARLEAGDWA 204

Query: 206 RAITF----LNQKKKNAKEWNRNRAILLIARSLENADKGDMIASYHD---AIESLKLCDN 258
            A+      L +K  +     R+RA LL A +    +  D  A       A +S+KL  +
Sbjct: 205 AALQLVQGALERKIVSPAVAERSRAALLAASAASLEESPDPKARAQALDFANQSVKLKPD 264

Query: 259 SIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHL-LSENTVGKLKRALRL 317
                I AA+ L  + K  KA  ++E  WK  PHP +   Y  L  +E    + +R   L
Sbjct: 265 FAPGVIMAARLLADEGKTAKAGQLIETAWKAQPHPALWLAYRDLKTNETPKARAQRLAAL 324

Query: 318 EEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDK 377
             +  E  ESL++  + AL  G    A A A L    AP      L+A++  AN    D+
Sbjct: 325 AAMRPEVRESLILRVEAALVGGDPIAARAAARLLDDEAPTARFAGLMARVAAANGQ-ADE 383

Query: 378 ILYWTQSALHAMPDPLW 394
              W    + A  +P W
Sbjct: 384 ARAWIARGIDAPREPDW 400


>gi|68171287|ref|ZP_00544688.1| hypothetical protein EchaDRAFT_0515 [Ehrlichia chaffeensis str.
           Sapulpa]
 gi|88658307|ref|YP_506957.1| HemY domain-containing protein [Ehrlichia chaffeensis str.
           Arkansas]
 gi|67999302|gb|EAM85950.1| hypothetical protein EchaDRAFT_0515 [Ehrlichia chaffeensis str.
           Sapulpa]
 gi|88599764|gb|ABD45233.1| HemY domain protein [Ehrlichia chaffeensis str. Arkansas]
          Length = 416

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 77/158 (48%), Gaps = 11/158 (6%)

Query: 243 IASYHDAI---ESLKLCDN--SIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIAN 297
           I  Y D +   +++K C    S   ++  AK  I  +KKRKA  ILE  +++NPHP+IAN
Sbjct: 236 IQKYDDGLRVLDNIKNCSQQCSTAVTLLKAKFYIDTDKKRKAVNILEHEYRINPHPDIAN 295

Query: 298 IYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPR 357
            Y  ++  ++        +L   N     S+ ++++ A+  G  D A      + K    
Sbjct: 296 FYLDIMQHSS----HAIHKLYSFNTGYYFSIYLIAQDAINSGEYDTAMKYLNHSFKTKTY 351

Query: 358 KEIFLLLAQIEQANSHNTDKILYWTQS-ALHAMPDPLW 394
             ++ L+ ++ +  S N +++LYWT   A  A+ D  W
Sbjct: 352 ISLYFLVLKL-KVLSQNYNELLYWTDKIAKDAIADKYW 388


>gi|73666713|ref|YP_302729.1| hypothetical protein Ecaj_0080 [Ehrlichia canis str. Jake]
 gi|72393854|gb|AAZ68131.1| putative Uncharacterized membrane-bound protein [Ehrlichia canis
           str. Jake]
          Length = 413

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 106/223 (47%), Gaps = 14/223 (6%)

Query: 179 KALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQ--KKKNAKEWNRNRAILLIARSLEN 236
           K L+I     W     ++ Y L+++WS AI  + +  K K    +N    + +   +L  
Sbjct: 170 KMLEIFYKQSWSAIFKLEIYRLSRDWSNAIEEIKKVIKLKVNLPYNVQDMLNIFYYAL-- 227

Query: 237 ADKGDMIASYHDAI---ESLKLCDN-SIMASICAAKSLISQNKKRKAEVILEKIWKVNPH 292
           A +   +  Y D +   +++K C   S    +  A+  ++ ++KRKA  ILE  ++ NPH
Sbjct: 228 AKQCYDVQRYDDGLKVLDNIKNCQKYSTPIVLLKAQCYLNTDRKRKAVSILEYEYRTNPH 287

Query: 293 PEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAM 352
           P+IAN+Y  ++  N+    K    L   N E   S+ ++++ A+ +G  D A        
Sbjct: 288 PDIANLYLDIMQHNSHAIHK----LYSFNTEYYFSIYLIARDAINLGEYDAAMKYLNNEF 343

Query: 353 KIAPRKEIFLLLAQIEQANSHNTDKILYWTQS-ALHAMPDPLW 394
           K      ++ L+ ++ +  S + +++LYWT   A  A+ +  W
Sbjct: 344 KTQTYISLYFLMLKL-KVLSQDYNELLYWTDKIAKDAISEQHW 385


>gi|329848281|ref|ZP_08263309.1| hemY protein [Asticcacaulis biprosthecum C19]
 gi|328843344|gb|EGF92913.1| hemY protein [Asticcacaulis biprosthecum C19]
          Length = 515

 Score = 56.2 bits (134), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 81/309 (26%), Positives = 128/309 (41%), Gaps = 23/309 (7%)

Query: 25  PEDVSITWGNRLYR-----TSPFVILSILYFFLFA-WILLFAVSRFFLSCPAMLFHMLHK 78
           P   S++W N  YR     T+  +I+ ++ F   A W L   ++R     P         
Sbjct: 25  PGLASLSWMN--YRIDIPATAAVIIIGVMAFCAVAFWNLALWLAR----SPQRAERARAD 78

Query: 79  RNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNI 138
           +   +G  AL  G M++A  +   AR+ H+ V       N  LV +L    A        
Sbjct: 79  QRRRQGDDALTRGFMAVAVGDGSEARR-HA-VKALDLSDNTVLVRILGAMAAEESGDAVA 136

Query: 139 AHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQY 198
                  M+ +P  +   +  L   + R GD   A + A +A +    + W  E +    
Sbjct: 137 TRTAYSAMVSVPELKLAGLRGLMQLAARQGDKAEAVKLAGEAYNQPRPSMWAFETLFAAR 196

Query: 199 VLAKEWSRAITF----LNQKKKNAKEWNRNRAILLIARS--LENADKGDMIASYHD-AIE 251
           + A EW+ A+      L +K  +     R +A L+ A +  LE +D   M     D A  
Sbjct: 197 LEAGEWAEALDLIEGALTRKLISPIFSERAKASLMAASAARLETSDDAQMRDQALDYAQR 256

Query: 252 SLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKL 311
           + KL      A+I AA+ L   NK  +AE +LE  W   PHP +   Y  L+S+ T    
Sbjct: 257 AAKLQPQFTPAAIIAARLLAKANKPGRAEDVLEAAWASRPHPAVWLAYRDLVSDET--PK 314

Query: 312 KRALRLEEI 320
           +RA RL+ +
Sbjct: 315 ERARRLQGL 323


>gi|58584738|ref|YP_198311.1| membrane-bound protoheme IX biogenesis protein, HemY [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|58419054|gb|AAW71069.1| Membrane-bound protoheme IX biogenesis protein, HemY [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 387

 Score = 53.9 bits (128), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 61/129 (47%), Gaps = 9/129 (6%)

Query: 267 AKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVE 326
           A+  I   K RKA  +LE  + VNP P+ A IY  L SE        A RL  +  +   
Sbjct: 239 AELYIRLGKIRKASAVLEAEYTVNPTPQSAKIYISLNSEG-------AERLYNLRPDYYF 291

Query: 327 SLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYW-TQSA 385
           S  +++  ++  G  D A      A+K A    I+L++ Q++       D+ +YW ++  
Sbjct: 292 SYCLLASSSISSGKYDLASQYLNTAIKKANYMSIYLIMVQLKVV-LQEQDQTIYWLSKMG 350

Query: 386 LHAMPDPLW 394
             A+PDP W
Sbjct: 351 SEALPDPCW 359


>gi|42521029|ref|NP_966944.1| hypothetical protein WD1232 [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410770|gb|AAS14878.1| hypothetical protein WD_1232 [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 233

 Score = 53.5 bits (127), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 61/129 (47%), Gaps = 9/129 (6%)

Query: 267 AKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVE 326
           A+  I   K RKA  +LE  + VNP P+ A +Y +L S       K A RL  +  +   
Sbjct: 84  AELYIKLGKIRKASAVLEAEYTVNPTPQSAKMYINLNS-------KGAERLYNLRPDCYF 136

Query: 327 SLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYW-TQSA 385
           S  +++  ++  G  D A      AMK A    I+ ++ Q+ +      DK++YW  +  
Sbjct: 137 SYCLLALSSMSSGKYDLASQYLDTAMKKANYMSIYFIVIQL-KVTLQEHDKVIYWLNKMG 195

Query: 386 LHAMPDPLW 394
             A+PDP W
Sbjct: 196 SEALPDPGW 204


>gi|99034641|ref|ZP_01314590.1| hypothetical protein Wendoof_01000593 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 155

 Score = 53.1 bits (126), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 61/129 (47%), Gaps = 9/129 (6%)

Query: 267 AKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVE 326
           A+  I   K RKA  +LE  + VNP P+ A +Y +L S       K A RL  +  +   
Sbjct: 6   AELYIKLGKIRKASAVLEAEYTVNPTPQSAKMYINLNS-------KGAERLYNLRPDYYF 58

Query: 327 SLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYW-TQSA 385
           S  +++  ++  G  D A      AMK A    I+ ++ Q+ +      DK++YW  +  
Sbjct: 59  SYCLLALSSMSSGKYDLASQYLDTAMKKANYMSIYFIVIQL-KVTLQEHDKVIYWLNKMG 117

Query: 386 LHAMPDPLW 394
             A+PDP W
Sbjct: 118 SEALPDPGW 126


>gi|225677319|ref|ZP_03788296.1| Membrane-bound protoheme IX biogenesis protein, HemY [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
 gi|225590646|gb|EEH11896.1| Membrane-bound protoheme IX biogenesis protein, HemY [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
          Length = 406

 Score = 52.8 bits (125), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 61/129 (47%), Gaps = 9/129 (6%)

Query: 267 AKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVE 326
           A+  I   K RKA  +LE  + VNP P+ A +Y +L S       K A RL  +  +   
Sbjct: 257 AELYIKLGKIRKASAVLEAEYTVNPTPQSAKMYINLNS-------KGAERLYNLRPDYYF 309

Query: 327 SLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYW-TQSA 385
           S  +++  ++  G  D A      AMK A    I+ ++ Q+ +      DK++YW  +  
Sbjct: 310 SYCLLALSSMSSGKYDLASQYLDTAMKKANYMSIYFIVIQL-KVTLQEHDKVIYWLNKMG 368

Query: 386 LHAMPDPLW 394
             A+PDP W
Sbjct: 369 SEALPDPGW 377


>gi|58698408|ref|ZP_00373319.1| conserved hypothetical protein [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225630891|ref|YP_002727682.1| Membrane-bound protoheme IX biogenesis protein, HemY [Wolbachia sp.
           wRi]
 gi|58535063|gb|EAL59151.1| conserved hypothetical protein [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225592872|gb|ACN95891.1| Membrane-bound protoheme IX biogenesis protein, HemY [Wolbachia sp.
           wRi]
          Length = 406

 Score = 52.8 bits (125), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 61/129 (47%), Gaps = 9/129 (6%)

Query: 267 AKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVE 326
           A+  I   K RKA  +LE  + VNP P+ A +Y +L S       K A RL  +  +   
Sbjct: 257 AELYIKLGKIRKASAVLEAEYTVNPTPQSAKMYINLNS-------KGAERLYNLRPDYYF 309

Query: 327 SLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYW-TQSA 385
           S  +++  ++  G  D A      AMK A    I+ ++ Q+ +      DK++YW  +  
Sbjct: 310 SYCLLALSSMSSGKYDLASQYLDTAMKKANYMSIYFIVIQL-KVTLQEHDKVIYWLNKMG 368

Query: 386 LHAMPDPLW 394
             A+PDP W
Sbjct: 369 SEALPDPGW 377


>gi|83310058|ref|YP_420322.1| hypothetical protein amb0959 [Magnetospirillum magneticum AMB-1]
 gi|82944899|dbj|BAE49763.1| Uncharacterized membrane-bound protein [Magnetospirillum magneticum
           AMB-1]
          Length = 469

 Score = 50.1 bits (118), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 85/209 (40%), Gaps = 5/209 (2%)

Query: 223 RNRAILLIARS-LENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEV 281
           R RA++L  ++ L++ D  D   S   A E+L      + A++   +  +S+ ++ +AE 
Sbjct: 228 RWRAVVLEGQACLDSQD--DPARSLRLAREALAADPGFLPAALHVLRQEVSEGRRSEAEA 285

Query: 282 ILEKIWKVNPHPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGS 340
           +L  +W+  P   +    + L  E+    +LKR   L E      E  +   + A+    
Sbjct: 286 VLAAVWRSAPARILLETCSPLWREDDAESRLKRLEVLAEWAPHDPEGHLAAGEAAVAAAK 345

Query: 341 IDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-G 399
              A    M A+KIAP      L+A+IE       ++   W +    A   P W+ +  G
Sbjct: 346 WGVARRHLMAALKIAPDALGCRLMAEIEDKEPGGAERAEIWRRREREAPAAPTWVCEACG 405

Query: 400 YLSSVWLPLSPISKTLCYFEWKIPTKSPE 428
             S  W P           +W  P   PE
Sbjct: 406 ATSGSWAPYCSACAAGAAIQWTRPAHKPE 434


>gi|111073632|emb|CAL29494.1| hypothetical protein OW2-H [Wolbachia endosymbiont of Onchocerca
           volvulus]
          Length = 420

 Score = 49.3 bits (116), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 96/213 (45%), Gaps = 21/213 (9%)

Query: 195 VQQYVLAKEWSRAITFLNQKKKNAKEWN--------RNRAILLIARSLENADKGDMIASY 246
           ++ Y+L ++W  AI     K K A ++N        +  A+   A + +  +KG+   + 
Sbjct: 195 IEGYILHEDWINAIL----KLKEAIKFNIFLPFDCEKMLAVFYCASAKQYENKGNYKKAL 250

Query: 247 HDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSEN 306
               ++   C      +   A+  I   K RKA V+LE+ + VNP P+ A IY  L S  
Sbjct: 251 RSLFKAQSYCAAFQPINYLRAELYIKLGKIRKASVVLEEEYTVNPTPQSAKIYISLNS-- 308

Query: 307 TVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQ 366
                K A +L  +  +   S  +++  ++ +   D A     +AM+ A    I+L++ Q
Sbjct: 309 -----KGAEKLYNLRSDYYFSYCLLALSSISLSKYDLASQHLDIAMRKANYVSIYLIMIQ 363

Query: 367 IEQANSHNTDKILYW-TQSALHAMPDPLWISDD 398
           ++ A     ++++YW  +    A+ DP W   D
Sbjct: 364 LKVA-LQEYEQVIYWLNKMDSEAISDPYWKCAD 395


>gi|315497774|ref|YP_004086578.1| hemy domain protein [Asticcacaulis excentricus CB 48]
 gi|315415786|gb|ADU12427.1| HemY domain protein [Asticcacaulis excentricus CB 48]
          Length = 515

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 84/383 (21%), Positives = 142/383 (37%), Gaps = 17/383 (4%)

Query: 25  PEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRNYDKG 84
           P   ++ W      T     + ++    FA +  + +  +    P             +G
Sbjct: 25  PGTATLIWLGYRIDTPAAAAVIVIGLLAFAAVCFWNLVLWMSRAPQRAERQRANARRRQG 84

Query: 85  YKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLE 144
            + L  G +++ + +   AR+        H   N  LV +L    A              
Sbjct: 85  EETLTRGFIAVVSGDGAEARRQAIKAVDLH--DNVALVRILNALAAETAHDPVATRAAWT 142

Query: 145 MMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEW 204
            ML +P  +   +  L   +   GD   A R A +  +    A W  + + +    A EW
Sbjct: 143 AMLSVPELKLAGLRGLMALAISEGDRTEAIRLAAEGYNQPKPAMWAFKTLFEARSTAGEW 202

Query: 205 SRAITF----LNQKKKNA--KEWNRNRAILLIARSLENADKGDMIASYHD-AIESLKLCD 257
           + A+      LN+K  +    E  R   +   A  LE A +G +     D A+ + KL  
Sbjct: 203 AEALDLVEGALNRKLVSPLFAERARAALMAASAARLEGAAEGQIREQALDYAVRAAKLQP 262

Query: 258 NSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRL 317
                ++ AA+ L + NK  +AE +LE  +   PHP I   Y  L+++ T     RA RL
Sbjct: 263 MFAPGAVIAARLLAAHNKLGRAEDVLEAAYAAQPHPAIWLAYRDLVNDET--PKDRARRL 320

Query: 318 EEI---NKESVES-LVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQA--N 371
           + +   N +  ES L+ V +  L     D   A A L  ++   +    L   + +A   
Sbjct: 321 QGLIDRNPQHRESRLLEVERSVLSGVRADIERATAALEDELTEERLTRRLCGLMAKAALA 380

Query: 372 SHNTDKILYWTQSALHAMPDPLW 394
             + D    W   A  A  +P W
Sbjct: 381 LQDVDGARGWVAKASLAKAEPDW 403


>gi|46202657|ref|ZP_00208607.1| hypothetical protein Magn03007324 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 471

 Score = 47.4 bits (111), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 74/193 (38%), Gaps = 9/193 (4%)

Query: 245 SYHDAIESLKLCDNSIMAS---ICAA----KSLISQNKKRKAEVILEKIWKVNPHPEIAN 297
           S  D   SL+L   ++ A    + AA    +  +S+ ++ +AE +L  +W+  P   +  
Sbjct: 244 SQDDPARSLRLAREALAADPGFLPAALHVLRQEVSEGRRSEAEAVLAAVWRSAPARILLE 303

Query: 298 IYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAP 356
               L  E+    +LKR   L E      E  +   + A+       A    M A+KIAP
Sbjct: 304 TCAPLWREDDAESRLKRLEALAEWAPHDPEGHLAAGEAAVAAAKWGVARRHLMAALKIAP 363

Query: 357 RKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLSSVWLPLSPISKTL 415
                 L+A+IE       ++   W +    A   P W+ +  G  S  W P        
Sbjct: 364 DALGCRLMAEIEDKEPGGAERAEIWRRREREAAAAPTWVCEACGATSGSWAPYCSACGAG 423

Query: 416 CYFEWKIPTKSPE 428
              +W  P   PE
Sbjct: 424 AAIQWTRPAHKPE 436


>gi|88607729|ref|YP_505844.1| hypothetical protein APH_1339 [Anaplasma phagocytophilum HZ]
 gi|88598792|gb|ABD44262.1| conserved domain protein [Anaplasma phagocytophilum HZ]
          Length = 412

 Score = 46.6 bits (109), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 78/404 (19%), Positives = 170/404 (42%), Gaps = 28/404 (6%)

Query: 4   LIRYF--FVISLVICSFIIVSHYPEDVSI-TWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           +I YF  F++  + C F +  +    + +   G  +     FV+  +   FLF    +  
Sbjct: 1   MITYFLIFIVVSLACGFAVQGYEGLALKLEVLGYSVEANVVFVVFMLCVLFLF----IVL 56

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V R   +C A+  + + + +  K Y  +      ++  ++   RK+   +S++    +  
Sbjct: 57  VGRACFAC-ALCMYRVRRGSVSKKYDEVGKSFAFLSVGHVDNVRKIVG-ISERFAKFDSP 114

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMM----LQIPATREFAVYSLYFESCRIGDLNSAQRY 176
           ++ LLE   +    QY IA +   ++    LQ      + V  L  E  R    +   R 
Sbjct: 115 VLQLLEGCASFRIGQYEIAEKHFSLIPSKALQEVDLGAWLVGILANEKSR----DCKLRV 170

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLN--QKKKNAKEWNRNRAILLIARSL 234
            ++  D+     W     ++   +  +W   +T L   +K   +  ++ N  + LIAR  
Sbjct: 171 LSRLYDVFHSRRWSVLFRLEIARMEGQWDEVLTALKLIEKYGVSHPYDLND-LELIARC- 228

Query: 235 ENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPE 294
           + A+   M   + + +  +K   + + A++  AK     N  ++A   LE  ++V+PHP+
Sbjct: 229 KLAELHYMQGDFKEGLGVIK-GSSGLQATLWRAKFNAKLNNVKRAMEELEAYYRVDPHPD 287

Query: 295 IANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKI 354
           +A++Y  ++ +  +   K    L  +N +S  S +++ +  +++   + A      A+  
Sbjct: 288 VASLYLSMVQDKNLAVEK----LNALNPDSYMSFLLMVRKYMDLKQYNAAEKHLKQALTQ 343

Query: 355 APRKEIFLLLAQIEQANSHNTDKILYWTQSALH-AMPDPLWISD 397
                ++ ++ +I      N D+I YW       ++PD  W  +
Sbjct: 344 YKYAGLYGMMLEI-MVRLGNLDEIEYWIDMMRRDSVPDMHWACE 386


>gi|197106863|ref|YP_002132240.1| hypothetical protein PHZ_c3402 [Phenylobacterium zucineum HLK1]
 gi|196480283|gb|ACG79811.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 504

 Score = 45.8 bits (107), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 66/260 (25%), Positives = 106/260 (40%), Gaps = 15/260 (5%)

Query: 88  LYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMML 147
           L  G ++ A  +   AR++    +   +     LV +L  Q A A    + A      ML
Sbjct: 88  LSRGFLAAAGGDGSEARRLARKAADLAS-DAPGLVRVLAAQAAEAAGDLDEARAAYTAML 146

Query: 148 QIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRA 207
             P  R      L   +   G   +A R+A +A   +  A W   A+++  + A +W +A
Sbjct: 147 GFPEMRLAGHKGLMQLAAAQGARETALRHAQEAYGEARTARWAWRALLEAKLEAGDWPQA 206

Query: 208 ITFLNQKKKN------AKEWNRNRAILLIARSLENAD--KGDMIASYHDAIESLKLCDNS 259
           +  +              E  R   +   A  LE+A   K   +A  H A+E+ KL    
Sbjct: 207 LDLMKGALDRKIVPPVVAERARAALLAASAAQLEHAPEPKARALAMDH-AVEAAKLAPGF 265

Query: 260 IMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEE 319
               + AA+ L    K  +A   +E  W+V PHP +   Y  L ++ T    +RA RL E
Sbjct: 266 APGVVMAARLLAQAGKVGRAAATVENAWRVAPHPALWLAYRDLRTDET--PRERAQRLSE 323

Query: 320 ---INKESVESLVIVSKIAL 336
              +N    ESL++  + AL
Sbjct: 324 LAAVNPTHRESLILHVERAL 343


>gi|56417190|ref|YP_154264.1| hypothetical protein AM1180 [Anaplasma marginale str. St. Maries]
 gi|56388422|gb|AAV87009.1| hypothetical protein AM1180 [Anaplasma marginale str. St. Maries]
          Length = 412

 Score = 43.9 bits (102), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 92/229 (40%), Gaps = 23/229 (10%)

Query: 175 RYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA------KEWNRNRAIL 228
           R   +  D+   APW     ++   +  +W   +  +    K         E   + A L
Sbjct: 169 RVLRRLCDVFHRAPWAAMFRLEIARIEGDWDTVLVEVKLAAKRGIVLPYKHERMADIACL 228

Query: 229 LIARSLENADKGDMIASYHDAIESLKLCDNS--IMASICAAKSLISQNKKRKAEVILEKI 286
           ++ARS     +GD         E LKL   +  + A+I  AK+       +KA   LE  
Sbjct: 229 MLARSCYQ--RGDYK-------EGLKLVGRATDMHAAILKAKTHEKLGNPQKARDALEAC 279

Query: 287 WKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHA 346
           +K  PHPEI   Y  +  +          RL  +N +   S+++  K  +     + A  
Sbjct: 280 YKTTPHPEIVTAYLAVSQDYDTA----TERLSSLNPDHYVSMILSVKRYMNAKQYNAAEQ 335

Query: 347 KAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYW-TQSALHAMPDPLW 394
            A  A+      E++ L+A +  A   N D+++YW T+    ++P+  W
Sbjct: 336 HAKRAIARYKYVELYCLMADV-MARIGNIDEVVYWITKMQKDSVPNMQW 383


>gi|254995360|ref|ZP_05277550.1| hypothetical protein AmarM_05429 [Anaplasma marginale str.
           Mississippi]
          Length = 411

 Score = 43.9 bits (102), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 92/229 (40%), Gaps = 23/229 (10%)

Query: 175 RYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA------KEWNRNRAIL 228
           R   +  D+   APW     ++   +  +W   +  +    K         E   + A L
Sbjct: 168 RVLRRLCDVFHRAPWAAMFRLEIARIEGDWDTVLVEVKLAAKRGIVLPYKHERMADIACL 227

Query: 229 LIARSLENADKGDMIASYHDAIESLKLCDNS--IMASICAAKSLISQNKKRKAEVILEKI 286
           ++ARS     +GD         E LKL   +  + A+I  AK+       +KA   LE  
Sbjct: 228 MLARSCYQ--RGDYK-------EGLKLVGRATDMHAAILKAKTHEKLGNPQKARDALEAC 278

Query: 287 WKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHA 346
           +K  PHPEI   Y  +  +          RL  +N +   S+++  K  +     + A  
Sbjct: 279 YKTTPHPEIVTAYLAVSQDYDTA----TERLSSLNPDHYVSMILSVKRYMNAKQYNAAEQ 334

Query: 347 KAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYW-TQSALHAMPDPLW 394
            A  A+      E++ L+A +  A   N D+++YW T+    ++P+  W
Sbjct: 335 HAKRAIARYKYVELYCLMADV-MARIGNIDEVVYWITKMQKDSVPNMQW 382


>gi|222475555|ref|YP_002563972.1| hypothetical protein AMF_890 [Anaplasma marginale str. Florida]
 gi|255004673|ref|ZP_05279474.1| hypothetical protein AmarV_05254 [Anaplasma marginale str.
           Virginia]
 gi|222419693|gb|ACM49716.1| Conserved hypothetical protein [Anaplasma marginale str. Florida]
          Length = 412

 Score = 43.9 bits (102), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 95/228 (41%), Gaps = 21/228 (9%)

Query: 175 RYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSL 234
           R   +  D+   APW     ++   +  +W    T L + K  AK     R I+L  +  
Sbjct: 169 RVLRRLCDVFHRAPWAAMFRLEIARIEGDWD---TVLVEVKLAAK-----RGIVLPYKHE 220

Query: 235 ENADKGDMI---ASYH--DAIESLKLCDNS--IMASICAAKSLISQNKKRKAEVILEKIW 287
             AD   ++   + Y   D  E LKL   +  + A+I  AK+       +KA   LE  +
Sbjct: 221 RMADIACLMLARSCYQRGDYKEGLKLVGRATDMHAAILKAKTHEKLGNPQKARDALEACY 280

Query: 288 KVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAK 347
           K  PHPEI   Y  +  +          RL  +N +   S+++  K  +     + A   
Sbjct: 281 KTTPHPEIVTAYLAVSQDYDTA----TERLSSLNPDHYVSMILSVKRYMNAKQYNAAEQH 336

Query: 348 AMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYW-TQSALHAMPDPLW 394
           A  A+      E++ L+A +  A   N D+++YW T+    ++P+  W
Sbjct: 337 AKRAIARYKYVELYCLMADV-MARIGNIDEVVYWITKMQKDSVPNMQW 383


>gi|269958417|ref|YP_003328204.1| hypothetical protein ACIS_00214 [Anaplasma centrale str. Israel]
 gi|269848246|gb|ACZ48890.1| hypothetical protein ACIS_00214 [Anaplasma centrale str. Israel]
          Length = 412

 Score = 43.1 bits (100), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 61/257 (23%), Positives = 108/257 (42%), Gaps = 26/257 (10%)

Query: 175 RYATKALDISPDAPWVTEAVVQQYVLAKEWSRAI--TFLNQKKKNAKEWNRNR----AIL 228
           R   +  D+    PW T   V+   +  +W  A+  T L  ++     +   R    A L
Sbjct: 169 RVLRRLCDVFRRVPWATMFKVEIARIEGDWDTALVETRLAARRGVVLPYKHERMGDVACL 228

Query: 229 LIARSLENADKGDMIASYHDAIESLKLCD--NSIMASICAAKSLISQNKKRKAEVILEKI 286
           ++AR+     +G+    Y    E LKL +    + A+I  A         RKA  +LE  
Sbjct: 229 MLARAC--CQRGN----YR---EGLKLVEKVTDMHATILKATIHEKLGNLRKARDVLEVC 279

Query: 287 WKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHA 346
           +K  PHPE+   Y   +S++    ++   RL  +N E   S+++  +  + +   + A  
Sbjct: 280 YKTAPHPEVVTAYLA-VSQDQDAAME---RLSSLNAEHYVSMLLAIRRYVSVKQYNAAEQ 335

Query: 347 KAMLAMKIAPRKEIFLLLAQIE-QANSHNTDKILYWTQSALH-AMPDPLW-ISDDGYLSS 403
            A  A+  A  K + L  A +E  A   N D++ YW +     ++P+  W  ++   +SS
Sbjct: 336 YAKRAL--AKYKYVELYCAMMEVMACIGNVDEVAYWLEKMRKDSLPNMQWRCTECCAVSS 393

Query: 404 VWLPLSPISKTLCYFEW 420
            W     +  T    +W
Sbjct: 394 GWSHECSVCSTFDSIQW 410


>gi|307718566|ref|YP_003874098.1| hypothetical protein STHERM_c08780 [Spirochaeta thermophila DSM
           6192]
 gi|306532291|gb|ADN01825.1| hypothetical protein STHERM_c08780 [Spirochaeta thermophila DSM
           6192]
          Length = 305

 Score = 40.8 bits (94), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 82/169 (48%), Gaps = 11/169 (6%)

Query: 233 SLENA--DKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
           SL NA  D+GD   +     ++L+   ++       A++ I   +  +AE +LE + + +
Sbjct: 34  SLGNAYYDEGDFSRAVEAYTQALRFSPHTPRIEYNLARTYIRMGEYDRAEALLEGLLERD 93

Query: 291 P-----HPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAH 345
           P        +A ++      +T     R  R  E++   V  L  ++++ +E G +D+A 
Sbjct: 94  PVNTMVLSTLAYLFICKGDPDTAEDFYR--RALELSPGDVTILYNLARLRMEEGDVDEAL 151

Query: 346 AKAMLAMKIAP-RKEIFLLLAQIEQANSHNTDKILYWTQSALHAMP-DP 392
           + A  A +I+P +KE+ LL A +   ++   ++ +   ++AL + P DP
Sbjct: 152 SYAGEAYEISPDKKEVLLLYAILRLESAPTDEEAVALGETALSSYPKDP 200


>gi|78033476|emb|CAJ30093.1| TPR-like protein [Magnetospirillum gryphiswaldense MSR-1]
 gi|144901138|emb|CAM78002.1| TPR-like protein [Magnetospirillum gryphiswaldense MSR-1]
          Length = 449

 Score = 40.0 bits (92), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 90/439 (20%), Positives = 162/439 (36%), Gaps = 19/439 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITW-GNRLYRTSPFVILSILYFFLFAWILLF 59
           +LRLI     +S V+ + +  S     V + W G  +    P ++  IL  FL  +  L 
Sbjct: 2   LLRLIVLLIFMSPVVFATLWFSDNVGSVQVEWLGWHVDSNMPVLLAVILVVFLI-FSALS 60

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
            +S      P+ L      R  +KG  AL   L +  + ++   R+  +  ++    +N 
Sbjct: 61  RLSALVADLPSKLGKSRQARGLEKGMSALLAALDAAESGDVGEGRRFAAEAAR--LLNNP 118

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATK 179
            L   L+  +     Q  +A  +LE        R FA             ++  Q    +
Sbjct: 119 GLAARLDRLLPRPPAQ-PVAPTRLEAA----KGRLFA-RKPGPPPPPTPVVDKIQPVVVE 172

Query: 180 ALDISPDAPWVTE-AVVQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILLIARSL 234
            L  +P  P   +       + A EW  A  ++ +     +       R R++ L  ++L
Sbjct: 173 KLAAAPAGPSREDLEAFSAKIRAGEWGAAQAWIGEAVLAGRLTPLVAARWRSVALEGQAL 232

Query: 235 ENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPE 294
           E A  GD       A E++      +  ++   ++ +S+ +K +AE +L  +W   P   
Sbjct: 233 E-ASPGDPARPLRLAREAMAADQTFLPPALHVIRAEVSEGRKAEAETLLASVWPHVPARV 291

Query: 295 IANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMK 353
           + +    L   E+    LKR   L  I     +  +   + A  +     A    M A+K
Sbjct: 292 LLDACAPLWRDEDQDACLKRLEALAAIAPHHPDGHLAAGEAAFAVQKWGVARRHIMAALK 351

Query: 354 IAPRKEIFLLLAQIEQANSHNTDKIL-YWTQSALHAMPDPLWISDD-GYLSSVWLPLSPI 411
           IAP      L+A+IE+     + +    W +    A   P W+      +   W    P 
Sbjct: 352 IAPDALGCRLMAEIEEREPGGSARSAEIWRRREHEASLSPAWVCGACARVVEAWAACCPS 411

Query: 412 SKTLCYFEWKIPTKSPEYI 430
              +   EW    K+ E +
Sbjct: 412 CAGVATIEWTRSVKAEEAL 430


>gi|329765153|ref|ZP_08256735.1| TPR repeat protein [Candidatus Nitrosoarchaeum limnia SFB1]
 gi|329138356|gb|EGG42610.1| TPR repeat protein [Candidatus Nitrosoarchaeum limnia SFB1]
          Length = 600

 Score = 40.0 bits (92), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 88/193 (45%), Gaps = 17/193 (8%)

Query: 239 KGDMIASYHDAIES-------LKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
           KG ++ S  +  E+       L L   +I A     KSL+  N+   A  ILE I   N 
Sbjct: 142 KGKILLSKQNTSEAINQFYHVLDLEPENIEAKFYLGKSLVESNRIENAVKILESIVSNND 201

Query: 292 HPEIANIYTHLL--SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAM 349
           H E   +   +   + N+   L    +L E++  ++++ ++V KI +    I++A A   
Sbjct: 202 HLESLLLLGQIAIKNSNSHKGLSYLNKLLEVSPNNIDAHLLVGKINMNAKIINEALAHFE 261

Query: 350 LAMKIAPRK-EIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWL-- 406
             ++I+P   E  LLL QI + + +NTD+ L   +  L   P+ +    DG  S + L  
Sbjct: 262 KVLEISPNNIEAHLLLGQI-KMDLNNTDEALAHFEKVLEISPNHM----DGLNSKIILLE 316

Query: 407 PLSPISKTLCYFE 419
            L  + + + Y E
Sbjct: 317 KLGKVDEAIEYCE 329


>gi|167644094|ref|YP_001681757.1| HemY domain-containing protein [Caulobacter sp. K31]
 gi|167346524|gb|ABZ69259.1| HemY domain protein [Caulobacter sp. K31]
          Length = 515

 Score = 39.3 bits (90), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 76/320 (23%), Positives = 135/320 (42%), Gaps = 10/320 (3%)

Query: 83  KGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEK 142
           +G +AL  G +++AA +   AR++    ++        L+ +L  Q A A   +  A + 
Sbjct: 83  QGVEALSRGFLAVAAGDGSEARRLAQKAAELAE-DAPALIRVLAAQAAEAAGDHTAARQA 141

Query: 143 LEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAK 202
              ML  P  R   +  L   +   GD   A ++A  A  ++  A W   A+++  + A 
Sbjct: 142 YNAMLGFPEMRLAGLRGLMQTALAEGDKGLALKHAETAYGLAKTARWAWRALLEARLEAG 201

Query: 203 EWSRAITFLNQKKKN------AKEWNRNRAILLIARSLENADKGDMIASYHD-AIESLKL 255
           +W  A+  +    +         E  R   +   A SLE +D    +A   D A+++ +L
Sbjct: 202 DWKAALDLVQGALERKIVPPLVAERARAALLAASAASLEESDDPKTLAQALDFAVQAARL 261

Query: 256 CDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHL-LSENTVGKLKRA 314
             +     + AA+   +  K  KA  ++E  WK++PHP +   Y  L  SE    +  R 
Sbjct: 262 KPDFAPGVVMAARLQAADGKAAKAGSLIEAAWKLSPHPALWLAYRDLKTSETPKLRAARL 321

Query: 315 LRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHN 374
             L  +  E+ ES ++  + AL  G    A A A L  +      +  L++++  AN   
Sbjct: 322 AALAGLKPEARESRLLKVESALIGGDPVAARAAARLLPEEGLTARVAGLMSRVAYANGE- 380

Query: 375 TDKILYWTQSALHAMPDPLW 394
            D+   W    + A  +P W
Sbjct: 381 ADEARAWIARGVAAAQEPDW 400


>gi|307566128|ref|ZP_07628586.1| conserved hypothetical protein [Prevotella amnii CRIS 21A-A]
 gi|307345316|gb|EFN90695.1| conserved hypothetical protein [Prevotella amnii CRIS 21A-A]
          Length = 396

 Score = 38.9 bits (89), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 6/84 (7%)

Query: 248 DAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENT 307
           + +E L  C N +M  +   +    + + R+   I++ IWK+ P P      T+ LS NT
Sbjct: 316 NNVEELSFCINDMMPLMSNTQCKYDKGQIRR---IVQDIWKLTPAPNTLTYTTYQLSYNT 372

Query: 308 ---VGKLKRALRLEEINKESVESL 328
                 ++R  R   I KE ++SL
Sbjct: 373 PQYYSPIRRTGRFYTITKEQLKSL 396


>gi|320451054|ref|YP_004203150.1| signAl transduction histidine kinase containing a receiver domain
           [Thermus scotoductus SA-01]
 gi|320151223|gb|ADW22601.1| signAl transduction histidine kinase containing a receiver domain
           [Thermus scotoductus SA-01]
          Length = 723

 Score = 38.9 bits (89), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 28/44 (63%)

Query: 261 MASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLS 304
           +A    AK+L+ Q ++ +A+V+L +  ++ PHPE+A +   +L 
Sbjct: 678 LARFTLAKALLEQGRREEAKVLLREELRLRPHPEVAELLNRVLG 721


>gi|78224662|ref|YP_386409.1| response regulator receiver modulated metal dependent
           phosphohydrolase [Geobacter metallireducens GS-15]
 gi|78195917|gb|ABB33684.1| response regulator receiver modulated metal dependent
           phosphohydrolase [Geobacter metallireducens GS-15]
          Length = 479

 Score = 38.9 bits (89), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 52/120 (43%), Gaps = 22/120 (18%)

Query: 171 NSAQRYATKALDISPDAPWVTEAVVQ-------QYVLAKEWSRAITFLNQKKKNAKEWNR 223
             A RY TK        PW  E +VQ       QY L +E  R    +N++ +  KEWN 
Sbjct: 147 GGAYRYITK--------PWNDEELVQIIRDAVNQYRLVQENRRLTEIVNKQNEELKEWNE 198

Query: 224 NRAILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLIS-QNKKRKAEVI 282
           N  + ++ ++ E   K + +   ++ + S      +   ++ A   LI    KKR AE +
Sbjct: 199 NLKVRVLEQTTEIRKKHENLKELNERLRS------NFKDTVTAFSRLIELGGKKRHAETV 252


>gi|294085039|ref|YP_003551799.1| HemY domain-containing protein [Candidatus Puniceispirillum
          marinum IMCC1322]
 gi|292664614|gb|ADE39715.1| HemY domain protein [Candidatus Puniceispirillum marinum
          IMCC1322]
          Length = 445

 Score = 38.9 bits (89), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 45/99 (45%), Gaps = 4/99 (4%)

Query: 1  MLRLIRYFFVISLVICSFIIVSHYPEDVSITW-GNRL-YRTSPFVILSILYFFLFAWILL 58
          ++RL   F  I     S   ++  P  V + W G RL  RTS  V L I+  F    +  
Sbjct: 2  LIRLAVLFLFILAAAASASWLAAQPGHVQVEWLGWRLEMRTSLAVALVII--FALGMVFF 59

Query: 59 FAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAA 97
            + R   S P  L   + KR    G+KAL  GLM+++A
Sbjct: 60 DRLYRLIKSLPGWLGSSVQKRRDVAGHKALTLGLMAVSA 98


>gi|126314383|ref|XP_001376560.1| PREDICTED: similar to transient receptor potential M8 protein
           [Monodelphis domestica]
          Length = 1341

 Score = 38.5 bits (88), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 3   RLIRYFFVISLVICSFIIVSHYPEDV--SITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++I   F+I LV C F+     P D    + W    + TSPFV+ S    F  A++LLFA
Sbjct: 931 KIILCLFLIPLVGCGFVSFRKKPMDRHRRLIWSYLAFFTSPFVVFSWNVVFYIAFLLLFA 990


>gi|219121447|ref|XP_002185947.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|209582796|gb|ACI65417.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 1133

 Score = 38.5 bits (88), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 77/181 (42%), Gaps = 18/181 (9%)

Query: 168 GDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWS----RAITFLNQKKKNAKEWNR 223
           G+   A+  + + L +   A    EAV ++Y  A+ W     RA+ F+   KK+  EW R
Sbjct: 303 GESTLARHTSRRGLGMKVLANAKKEAVEKEYQRAQTWKDYPIRALRFVGILKKDNAEWRR 362

Query: 224 NRAILLIARS------LENADKGDMIASY--HDAIESLKLCDNSIMASICAAKSLISQNK 275
             A   I R+        + D+GD ++ Y  +D     +   N+ M      KS++S   
Sbjct: 363 QLAATKIQRAWRAVLFQRHCDEGDDVSGYVSNDYAWKARSAGNNAMEKALKKKSILSHFN 422

Query: 276 KRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIA 335
           +  +  IL     +    +++++     S NT   L+R    EE+   S    +   ++A
Sbjct: 423 QMNSRGILIASGGIQ---KVSDVTVVTESTNT---LRRGPSREELKVGSAMRELTGQRVA 476

Query: 336 L 336
           L
Sbjct: 477 L 477


>gi|332707120|ref|ZP_08427178.1| glycosyltransferase [Lyngbya majuscula 3L]
 gi|332354145|gb|EGJ33627.1| glycosyltransferase [Lyngbya majuscula 3L]
          Length = 1933

 Score = 38.5 bits (88), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 50/113 (44%), Gaps = 4/113 (3%)

Query: 100 IPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQI-PATREFAVY 158
           +P + + H    Q         VYL + Q  L +RQ+  A    E  ++I P T +  VY
Sbjct: 151 VPSSSERHCKQYQSGGLLEAVTVYLQQAQTYLKQRQWQQAIAACERAIKIAPDTAQ--VY 208

Query: 159 SLYFESCR-IGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITF 210
            ++  + + +G    A  Y  +AL+I PD   V   +   Y   ++W  AI +
Sbjct: 209 KIWGNALQFMGQTTEAMGYYGQALEIEPDFAEVYANLGSLYAGQQDWQHAIAY 261


>gi|224113417|ref|XP_002316490.1| predicted protein [Populus trichocarpa]
 gi|222865530|gb|EEF02661.1| predicted protein [Populus trichocarpa]
          Length = 492

 Score = 38.5 bits (88), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 53/123 (43%), Gaps = 8/123 (6%)

Query: 89  YTGLMSIAAHNIPLARKMHSY---VSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEM 145
           Y  ++S   H + L  K  SY   ++++H      L Y   V I     +  + HE  E+
Sbjct: 304 YVAVLSACVH-VGLVDKGRSYFDLMTREHNVSPNVLHYSCMVDIL---GRGGLVHEAHEL 359

Query: 146 MLQIPATREFAVYSLYFESCRI-GDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEW 204
           M ++P     +++     SCRI G+L  A+  A    ++ PD       +   Y  +K+W
Sbjct: 360 MTKMPFAATASMWGSLLASCRIHGNLELAEIAAKNLFEMEPDRGGNYVLLANTYAASKKW 419

Query: 205 SRA 207
             A
Sbjct: 420 EEA 422


>gi|68489060|ref|XP_711643.1| hypothetical protein CaO19.13713 [Candida albicans SC5314]
 gi|68489199|ref|XP_711574.1| hypothetical protein CaO19.6356 [Candida albicans SC5314]
 gi|46432887|gb|EAK92350.1| hypothetical protein CaO19.6356 [Candida albicans SC5314]
 gi|46432961|gb|EAK92421.1| hypothetical protein CaO19.13713 [Candida albicans SC5314]
          Length = 911

 Score = 38.1 bits (87), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 43/88 (48%), Gaps = 7/88 (7%)

Query: 144 EMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKE 203
           + +LQ P   E  VY + FE  RIG+L+S Q    KAL   P  PW+   ++   ++ K 
Sbjct: 734 QAILQNPNNPEIWVYKIQFEK-RIGNLSSLQNLTNKALKQFPTDPWL--WIINLSLIPKM 790

Query: 204 WSRAITFLNQKKKNAKEWNRNRAILLIA 231
             R   FL+      K  N +  ILLI+
Sbjct: 791 SQRKTIFLDA----LKATNNSNLILLIS 814


>gi|290542313|ref|NP_001166561.1| transient receptor potential cation channel subfamily M member 8
           [Cavia porcellus]
 gi|255689716|gb|ACU30144.1| transient potential cation channel subfamily M member 8 [Cavia
           porcellus]
          Length = 1104

 Score = 38.1 bits (87), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 3   RLIRYFFVISLVICSFIIVSHYPEDV--SITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++I   F+I LV C F+     P D    + W    + TSPFV+ S    F  A++LLFA
Sbjct: 694 KIILCLFIIPLVGCGFVSFRKKPVDKHKKLLWNYVAFFTSPFVVFSWNVVFYIAFLLLFA 753


>gi|311273292|ref|XP_003133798.1| PREDICTED: transient receptor potential cation channel subfamily M
           member 8-like [Sus scrofa]
          Length = 1104

 Score = 37.7 bits (86), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 3   RLIRYFFVISLVICSFIIVSHYPEDV--SITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++I   F+I LV C F+     P D    + W    + TSPFV+ S    F  A++LLFA
Sbjct: 694 KIILCLFIIPLVGCGFVSFRKKPLDKRRQLLWSYVAFFTSPFVVFSWNVVFYIAFLLLFA 753


>gi|332995108|gb|AEF05163.1| heme biosynthesis protein [Alteromonas sp. SN2]
          Length = 390

 Score = 37.7 bits (86), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 80/391 (20%), Positives = 152/391 (38%), Gaps = 33/391 (8%)

Query: 9   FVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSC 68
           F+++L++   I+       V I+ GN    TS      I+   + +W ++  +  + LS 
Sbjct: 14  FIVALIVGPMILGDKGY--VLISLGNTAIETSLIGFCIIIICAIISWYIISKLVLWTLSL 71

Query: 69  PAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQ 128
                         K  +A Y GL S+AA ++   +  H  +SQ      E + YL   Q
Sbjct: 72  VTGSHRWFGALGERKRKRAFYHGLQSLAAGDL---KSAHKALSQTTNGDFEGVNYLAAAQ 128

Query: 129 IA-------------LAERQYNIAHEKLEM-MLQIPATREFAVYSL-YFESCRIGDLNSA 173
           +A             L   +Y+ A     + M +I  +      +L   +S    + N+ 
Sbjct: 129 VAQSQNDPQKARYFLLQAAEYDSAKVAATIVMARIDVSEGKYTDALEKLDSLDEEEANNP 188

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARS 233
           Q    KA  ++    W T   +Q+ +    W +A+      K++   W++  A   +A  
Sbjct: 189 QVIQLKASIMAEQGQWQT---LQEKLSG--WRKALP-----KEDYTAWSQRIAKGKLAEI 238

Query: 234 LENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHP 293
                  ++   +      +K  D    A I   + L+ Q    +A+ +L +  K  PHP
Sbjct: 239 ASKNGAAELKTHWEGLPRKIKQDDAYRAAYI---QQLLEQGMHAEAQTLLVEWQKRGPHP 295

Query: 294 EIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMK 353
            +   +T L   N    L+      + + E+VE    + ++A   G    A    + A+K
Sbjct: 296 ALFPYFTQLNIPNAAPSLRLLESWIKQDSENVELYSTLGRVAFNAGDDILAEKVLLKAVK 355

Query: 354 IAPRKEIFLLLAQIEQANSHNTDKILYWTQS 384
           +   K+  LLL+ I +    +T  + Y+ + 
Sbjct: 356 MESNKDDLLLLSAISERRHDSTTALQYYKEG 386


>gi|209886536|ref|YP_002290393.1| TPR repeat protein [Oligotropha carboxidovorans OM5]
 gi|209874732|gb|ACI94528.1| TPR repeat protein [Oligotropha carboxidovorans OM5]
          Length = 267

 Score = 37.7 bits (86), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 36/71 (50%)

Query: 166 RIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNR 225
           ++G  + A+RY   AL I PD P V   +   YVL KE  RA   L + ++ A   +R R
Sbjct: 149 QMGKPDEARRYYANALKIRPDEPSVLSNLGMSYVLTKELPRAEATLRRAQQLAPNDSRIR 208

Query: 226 AILLIARSLEN 236
             L +A  L+ 
Sbjct: 209 QNLGLALGLQG 219


>gi|238878343|gb|EEQ41981.1| hypothetical protein CAWG_00175 [Candida albicans WO-1]
          Length = 912

 Score = 37.7 bits (86), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 42/87 (48%), Gaps = 7/87 (8%)

Query: 144 EMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKE 203
           + +LQ P   E  VY + FE  RIG+L+S Q    KAL   P  PW+   ++   ++ K 
Sbjct: 735 QAILQNPNNPEIWVYKIQFEK-RIGNLSSLQNLTNKALKQFPTDPWL--WIINLSLIPKM 791

Query: 204 WSRAITFLNQKKKNAKEWNRNRAILLI 230
             R   FL+      K  N +  ILLI
Sbjct: 792 SQRKTIFLDA----LKATNNSNLILLI 814


>gi|110597057|ref|ZP_01385346.1| TPR repeat [Chlorobium ferrooxidans DSM 13031]
 gi|110341248|gb|EAT59713.1| TPR repeat [Chlorobium ferrooxidans DSM 13031]
          Length = 573

 Score = 37.4 bits (85), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 1/65 (1%)

Query: 153 REFAVYSLYFES-CRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFL 211
           R   VY L  +S  +  D   A+RY  KA    P  P + EA+V  Y++ KE+ +A + +
Sbjct: 327 RNGGVYLLRGQSMLQRQDAQGAERYFLKARSFVPGNPVIEEALVSAYIMQKEFRKASSII 386

Query: 212 NQKKK 216
            + KK
Sbjct: 387 VRAKK 391


>gi|149711231|ref|XP_001499536.1| PREDICTED: similar to transient receptor potential cation channel,
           subfamily M, member 8 [Equus caballus]
          Length = 1104

 Score = 37.4 bits (85), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 3   RLIRYFFVISLVICSFIIVSHYPEDV--SITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++I   F+I LV C FI     P D    + W    + TSPFV+ S    F  A++LLFA
Sbjct: 694 KIILCLFIIPLVACGFISFRKKPIDKHKKLLWYFVAFFTSPFVVFSWNVVFYIAFLLLFA 753


>gi|291410435|ref|XP_002721500.1| PREDICTED: transient receptor potential cation channel, subfamily
           M, member 8 [Oryctolagus cuniculus]
          Length = 1171

 Score = 37.4 bits (85), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 3   RLIRYFFVISLVICSFIIVSHYPEDV--SITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++I   F+I LV C F+     P D    + W    + TSPFV+ S    F  A++LLFA
Sbjct: 694 KIILCLFIIPLVGCGFVSFRKKPVDKHRRLLWHYVAFFTSPFVVFSWNVVFYIAFLLLFA 753


>gi|332815773|ref|XP_003309583.1| PREDICTED: transient receptor potential cation channel subfamily M
           member 8 [Pan troglodytes]
          Length = 1062

 Score = 37.0 bits (84), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 3   RLIRYFFVISLVICSFIIVSHYPEDV--SITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++I   F+I LV C F+     P D    + W    + TSPFV+ S    F  A++LLFA
Sbjct: 652 KIILCLFIIPLVGCGFVSFRKKPVDKHKKLLWYYVAFFTSPFVVFSWNVVFYIAFLLLFA 711


>gi|297669766|ref|XP_002813060.1| PREDICTED: transient receptor potential cation channel subfamily M
           member 8-like [Pongo abelii]
          Length = 1104

 Score = 37.0 bits (84), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 3   RLIRYFFVISLVICSFIIVSHYPEDV--SITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++I   F+I LV C F+     P D    + W    + TSPFV+ S    F  A++LLFA
Sbjct: 694 KIILCLFIIPLVGCGFVSFRKKPVDKHKKLLWYYVAFFTSPFVVFSWNVVFYIAFLLLFA 753


>gi|183396434|gb|ACC62111.1| transient receptor potential cation channel, subfamily M, member 8
           (predicted) [Rhinolophus ferrumequinum]
          Length = 1037

 Score = 37.0 bits (84), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 3   RLIRYFFVISLVICSFIIVSHYPEDV--SITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++I   F+I LV C F+     P D    + W    + TSPFV+ S    F  A++LLFA
Sbjct: 643 KIILCLFIIPLVGCGFVSFRKKPMDKPRKLLWHYVAFFTSPFVVFSWNAVFYIAFLLLFA 702


>gi|281182712|ref|NP_001162392.1| transient receptor potential cation channel subfamily M member 8
           [Papio anubis]
 gi|162415923|gb|ABX89284.1| transient receptor potential cation channel, subfamily M, member 8
           (predicted) [Papio anubis]
          Length = 1104

 Score = 37.0 bits (84), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 3   RLIRYFFVISLVICSFIIVSHYPEDV--SITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++I   F+I LV C F+     P D    + W    + TSPFV+ S    F  A++LLFA
Sbjct: 694 KIILCLFIIPLVGCGFVSFRKKPVDKHKKLLWYYVAFFTSPFVVFSWNVVFYIAFLLLFA 753


>gi|332259049|ref|XP_003278601.1| PREDICTED: transient receptor potential cation channel subfamily M
           member 8 [Nomascus leucogenys]
          Length = 1104

 Score = 37.0 bits (84), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 3   RLIRYFFVISLVICSFIIVSHYPEDV--SITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++I   F+I LV C F+     P D    + W    + TSPFV+ S    F  A++LLFA
Sbjct: 694 KIILCLFIIPLVGCGFVSFRKKPVDKHKKLLWYYVAFFTSPFVVFSWNVVFYIAFLLLFA 753


>gi|32966583|gb|AAP92167.1| transient receptor potential subfamily M member 8 variant [Homo
           sapiens]
          Length = 1104

 Score = 37.0 bits (84), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 3   RLIRYFFVISLVICSFIIVSHYPEDV--SITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++I   F+I LV C F+     P D    + W    + TSPFV+ S    F  A++LLFA
Sbjct: 694 KIILCLFIIPLVGCGFVSFRKKPVDKHKKLLWYYVAFFTSPFVVFSWNVVFYIAFLLLFA 753


>gi|109689695|ref|NP_076985.4| transient receptor potential cation channel subfamily M member 8
           [Homo sapiens]
 gi|143811469|sp|Q7Z2W7|TRPM8_HUMAN RecName: Full=Transient receptor potential cation channel subfamily
           M member 8; AltName: Full=Long transient receptor
           potential channel 6; Short=LTrpC-6; Short=LTrpC6;
           AltName: Full=Transient receptor potential p8;
           Short=Trp-p8
 gi|72537227|gb|AAZ73614.1| transient receptor potential subfamily M member 8 [Homo sapiens]
 gi|119591474|gb|EAW71068.1| transient receptor potential cation channel, subfamily M, member 8,
           isoform CRA_b [Homo sapiens]
          Length = 1104

 Score = 37.0 bits (84), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 3   RLIRYFFVISLVICSFIIVSHYPEDV--SITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++I   F+I LV C F+     P D    + W    + TSPFV+ S    F  A++LLFA
Sbjct: 694 KIILCLFIIPLVGCGFVSFRKKPVDKHKKLLWYYVAFFTSPFVVFSWNVVFYIAFLLLFA 753


>gi|20147036|gb|AAM10446.1| transient receptor potential cation channel protein [Homo sapiens]
          Length = 1104

 Score = 37.0 bits (84), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 3   RLIRYFFVISLVICSFIIVSHYPEDV--SITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++I   F+I LV C F+     P D    + W    + TSPFV+ S    F  A++LLFA
Sbjct: 694 KIILCLFIIPLVGCGFVSFRKKPVDKHKKLLWYYVAFFTSPFVVFSWNVVFYIAFLLLFA 753


>gi|19570794|dbj|BAB86335.1| LTRPC6 [Homo sapiens]
          Length = 1095

 Score = 37.0 bits (84), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 3   RLIRYFFVISLVICSFIIVSHYPEDV--SITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++I   F+I LV C F+     P D    + W    + TSPFV+ S    F  A++LLFA
Sbjct: 685 KIILCLFIIPLVGCGFVSFRKKPVDKHKKLLWYYVAFFTSPFVVFSWNVVFYIAFLLLFA 744


>gi|169409477|gb|ACA57875.1| transient receptor potential cation channel, subfamily M, member 8
           (predicted) [Callicebus moloch]
          Length = 1104

 Score = 37.0 bits (84), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 3   RLIRYFFVISLVICSFIIVSHYPEDV--SITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++I   F+I LV C F+     P D    + W    + TSPFV+ S    F  A++LLFA
Sbjct: 694 KIILCLFIIPLVGCGFVSFRKKPVDKHKKLLWYYVAFFTSPFVVFSWNVVFYIAFLLLFA 753


>gi|296205933|ref|XP_002749959.1| PREDICTED: transient receptor potential cation channel subfamily M
           member 8 [Callithrix jacchus]
 gi|166064935|gb|ABY79104.1| transient receptor potential cation channel, subfamily M, member 8
           (predicted) [Callithrix jacchus]
          Length = 1104

 Score = 37.0 bits (84), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 3   RLIRYFFVISLVICSFIIVSHYPEDV--SITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++I   F+I LV C F+     P D    + W    + TSPFV+ S    F  A++LLFA
Sbjct: 694 KIILCLFIIPLVGCGFVSFRKKPVDKHKKLLWYYVAFFTSPFVVFSWNVVFYIAFLLLFA 753


>gi|226875253|gb|ACO88994.1| transient receptor potential cation channel, subfamily M, member 8
           (predicted) [Dasypus novemcinctus]
          Length = 1104

 Score = 36.6 bits (83), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 3   RLIRYFFVISLVICSFIIVSHYPEDV--SITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++I   F+I LV C F+     P D    + W    + TSPFV+ S    F  A++LLFA
Sbjct: 694 KIILCLFIIPLVGCGFVSFRKKPIDKHKRLLWYYMAFFTSPFVVFSWNVVFYIAFLLLFA 753


>gi|313885849|ref|ZP_07819590.1| tetratricopeptide repeat protein [Porphyromonas asaccharolytica
           PR426713P-I]
 gi|312924678|gb|EFR35446.1| tetratricopeptide repeat protein [Porphyromonas asaccharolytica
           PR426713P-I]
          Length = 391

 Score = 36.6 bits (83), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 87/195 (44%), Gaps = 21/195 (10%)

Query: 207 AITFLNQKKKNAKEWNRNRAILLIARS-LENADKGDMIASYHDAIESLKLCDNSIMASIC 265
           AI +  + K N   + +N    ++A++ +E  D  + I +     E LKL       S+ 
Sbjct: 195 AIKYGEELKGNG--YRQNEVYQILAQTYIEEGDTANYITTMQ---EGLKLFPKEPYYSVN 249

Query: 266 AAKSLISQNKKRKAEVILEKIWKVNP-HPEIANIYTHLLSE-NTVGKLKRALRLEEINKE 323
              + I QNK  +A   L +  ++NP +P++ ++   L  E N    +K   +  E++  
Sbjct: 250 LINTYIVQNKYDEARTFLAQAIELNPENPQLYDVMGKLYEESNEEEAIKWFSKALEVDPN 309

Query: 324 SVESLVIVSKI----ALEMGSIDQAHAKAMLAMKIAPRKEIFLL---LAQIEQANSHNTD 376
            VESL  + +I    A+E+   ++        M  A +K   LL   L  +++A S N D
Sbjct: 310 YVESLCNIGRIYYNKAVEVSDKEEG------GMAAAQKKRTALLNKALPYLQKAYSINPD 363

Query: 377 KILYWTQSALHAMPD 391
              Y   +  +A+ D
Sbjct: 364 ASYYLLGNIYYALGD 378


>gi|332300697|ref|YP_004442618.1| Tetratricopeptide TPR_1 repeat-containing protein [Porphyromonas
           asaccharolytica DSM 20707]
 gi|332177760|gb|AEE13450.1| Tetratricopeptide TPR_1 repeat-containing protein [Porphyromonas
           asaccharolytica DSM 20707]
          Length = 400

 Score = 36.6 bits (83), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 87/195 (44%), Gaps = 21/195 (10%)

Query: 207 AITFLNQKKKNAKEWNRNRAILLIARS-LENADKGDMIASYHDAIESLKLCDNSIMASIC 265
           AI +  + K N   + +N    ++A++ +E  D  + I +     E LKL       S+ 
Sbjct: 204 AIKYGEELKGNG--YRQNEVYQILAQTYIEEGDTANYITTMQ---EGLKLFPKEPYYSVN 258

Query: 266 AAKSLISQNKKRKAEVILEKIWKVNP-HPEIANIYTHLLSE-NTVGKLKRALRLEEINKE 323
              + I QNK  +A   L +  ++NP +P++ ++   L  E N    +K   +  E++  
Sbjct: 259 LINTYIVQNKYDEARTFLAQAIELNPENPQLYDVMGKLYEESNEEEAIKWFSKALEVDPN 318

Query: 324 SVESLVIVSKI----ALEMGSIDQAHAKAMLAMKIAPRKEIFLL---LAQIEQANSHNTD 376
            VESL  + +I    A+E+   ++        M  A +K   LL   L  +++A S N D
Sbjct: 319 YVESLCNIGRIYYNKAVEVSDKEEG------GMAAAQKKRTALLNKALPYLQKAYSINPD 372

Query: 377 KILYWTQSALHAMPD 391
              Y   +  +A+ D
Sbjct: 373 ASYYLLGNIYYALGD 387


Searching..................................................done


Results from round 2




>gi|254781033|ref|YP_003065446.1| HemY domain-containing protein [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040710|gb|ACT57506.1| HemY domain-containing protein [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 492

 Score =  579 bits (1494), Expect = e-163,   Method: Composition-based stats.
 Identities = 492/492 (100%), Positives = 492/492 (100%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA
Sbjct: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY
Sbjct: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA
Sbjct: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKG 240
           LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKG
Sbjct: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKG 240

Query: 241 DMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYT 300
           DMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYT
Sbjct: 241 DMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYT 300

Query: 301 HLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEI 360
           HLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEI
Sbjct: 301 HLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEI 360

Query: 361 FLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEW 420
           FLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEW
Sbjct: 361 FLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEW 420

Query: 421 KIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDSTIHPLDPH 480
           KIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDSTIHPLDPH
Sbjct: 421 KIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDSTIHPLDPH 480

Query: 481 IRQPDDPGIKEQ 492
           IRQPDDPGIKEQ
Sbjct: 481 IRQPDDPGIKEQ 492


>gi|254486881|ref|ZP_05100086.1| HemY domain protein [Roseobacter sp. GAI101]
 gi|214043750|gb|EEB84388.1| HemY domain protein [Roseobacter sp. GAI101]
          Length = 502

 Score =  501 bits (1289), Expect = e-139,   Method: Composition-based stats.
 Identities = 107/505 (21%), Positives = 200/505 (39%), Gaps = 21/505 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWI--- 56
           +++++ +   I+ +      +      + +T     +   P   +++I+   +  W+   
Sbjct: 5   LIKIVVFVVAIAALTWGASFLLESSGGLQVTVMGTEFSFGPLQSVIAIIVLVIAVWLVLK 64

Query: 57  ---LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
              LL AV  F       L     +    KGY+AL  GLM++A+    LA  +       
Sbjct: 65  IISLLIAVWHFLNGDETALSRYFDRNRERKGYEALSEGLMALASGEGRLA--LSKAAKAD 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  L  LL  Q A        A E  + ++   +TR   V  +  +    GD ++A
Sbjct: 123 KYLERPELTNLLIAQAAEMAGDKRKAEETYKKLVANESTRFVGVRGILKQKLAEGDTDTA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
            + A KA  + P      + +++     ++WS A   LN K KN         R  A+L 
Sbjct: 183 LKLAEKAFALKPKHADTGDILLKLQAEKEDWSGARETLNTKLKNGQLPRDVHKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ + +   +G  I +   AIE+ +L  + I A++ AA S I Q K + A  +L+K W V
Sbjct: 243 LSEAKDVFTEGHSIEAREAAIEANRLSPDLIPAAVMAAHSYIDQGKPKYAARLLKKAWSV 302

Query: 290 NPHPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
           + HP++A+ +  +  + T   +LKR   L     +  E+ ++++++ +      +A    
Sbjct: 303 HAHPDLASAFAAIAPDETPKERLKRFTALTRTQPDDPETKMLLAELNIANEDFPEARRSL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLP 407
              ++  P      L+A IE+    +   +  W   AL     P WI D+  ++ + W P
Sbjct: 363 GNLVETDPTARSVTLMAAIERGEGASDTVVKGWLARALTVSRGPQWICDNCQHIHTNWKP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVS 467
           +     +     WK P  S   +        L +    D      N+G     P   +  
Sbjct: 423 ICDNCHSFDTLAWKTPPMSEVAMPGGVQMLPLIVGAIED------NSGADAKPPVATRAD 476

Query: 468 SFEDSTIHPLDPHIRQPDDPGIKEQ 492
             E   I   D    +P +P +  +
Sbjct: 477 IEEAELIVDTDEVSEKPKEPEVTTE 501


>gi|163745151|ref|ZP_02152511.1| hypothetical protein OIHEL45_06170 [Oceanibulbus indolifex HEL-45]
 gi|161381969|gb|EDQ06378.1| hypothetical protein OIHEL45_06170 [Oceanibulbus indolifex HEL-45]
          Length = 501

 Score =  499 bits (1284), Expect = e-139,   Method: Composition-based stats.
 Identities = 104/498 (20%), Positives = 202/498 (40%), Gaps = 17/498 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWILL- 58
           +++++ +  +++ +      +      + +T     Y   P   ++++L      W+LL 
Sbjct: 5   LIKIVLFVVLVAALAWGAGFLLESQGGIQLTVAGTEYTLGPLQSVIAVLLLMFAVWVLLK 64

Query: 59  -----FAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
                 A   F       L     +    KGY+AL  GLM++A+    +A  M       
Sbjct: 65  IVALLSATWHFLNGDETALSRYFDRNRERKGYEALSDGLMALASGEGQVA--MAKAAKAD 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  L  LL  Q A        A      +++   TR   V  +  +    GD  +A
Sbjct: 123 RYLKRPALTNLLTAQAAELAGDRRKAERTYRKLVEDEKTRFVGVRGIMKQKLADGDTETA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
            + A KA  + P      + +++      +W+ A   L  K KN         R  A+L 
Sbjct: 183 LKLAEKAFALKPKHEETGDTLLKLQADKHDWTGARQTLQAKYKNGHLPRDVHKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ + E   +G+ I +   AIE+ +L  + + A++ AA+S I+Q+K R A  +L+K W V
Sbjct: 243 LSEAREVIAEGNSIEAREAAIEANRLSPDLVPAAVMAARSYIAQDKPRYASKVLQKAWSV 302

Query: 290 NPHPEIANIYTHLLSENTVG-KLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
           +PHP++A  +  +  + T   ++KR   L +   +  E+ ++++++ +      +A    
Sbjct: 303 HPHPDLAAAFAEVQPDETPQQRIKRFRALTKSQPDHPETKMLLAELHIANEDFPEARRAL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGY-LSSVWLP 407
              ++  P      L+A IE+    +   +  W   AL+    P WI ++ + + + W P
Sbjct: 363 GNLVETDPSARSVTLMAAIERGEGASDTVVKGWLTRALNVSRGPQWICENCHHIHAEWKP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVS 467
           +    K+    EWK P  S   + S      L +  P           + + +   + V+
Sbjct: 423 ICENCKSFDTLEWKTPPLSEVAMPSGVQMLPLIVGTPETTPAEGALATRTDDIEEAELVT 482

Query: 468 SFEDSTIHPLDPHIRQPD 485
             ++ T    D   R PD
Sbjct: 483 DPDEPTN--SDASKRAPD 498


>gi|84501232|ref|ZP_00999437.1| HemY domain protein [Oceanicola batsensis HTCC2597]
 gi|84390523|gb|EAQ03011.1| HemY domain protein [Oceanicola batsensis HTCC2597]
          Length = 502

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 107/500 (21%), Positives = 191/500 (38%), Gaps = 17/500 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWI--- 56
           ++++I +  +++        +      V I  G      +P   +++ +   L  W+   
Sbjct: 5   LVKIIVFVALVAAATLGASYLLDMQGGVLIAMGGIEINLTPIKAVIAAVLLVLAVWLFLK 64

Query: 57  ---LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
              LL A+ RF       L     +    KGY+AL  GLM++A+     A  M      +
Sbjct: 65  LFGLLIALLRFINGDETALSRYFDRNRERKGYEALSDGLMALASGEGRRA--MSKASRAE 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  L  LL  Q A      + A    + +L    TR   V  +  +    GD ++A
Sbjct: 123 RFLDRPDLTTLLTAQAAEMVGDKDKAEAAYKKLLSDDRTRFVGVRGIMKQKLAAGDTDTA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
              A KA  I P    V + +++      +W  A   L  K ++         R  A+L 
Sbjct: 183 LALAEKAFAIKPGHEEVQDTLLRLQAQRSDWKGARATLKAKLRHGNLPRDVHRRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ +     +   I S   AIE+ KL  + I A++ AA+S I Q +KR A  +L+K W+ 
Sbjct: 243 LSEAKGVFSEDGTIESREAAIEANKLSPDLIPAAVMAARSYIDQGQKRYAARVLKKAWEA 302

Query: 290 NPHPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A  +  +  + T   +LKR  +L +      ES ++++++ +      +A    
Sbjct: 303 APHPDLAAAFAEIEPDETPQERLKRFQQLVKSAPNHRESRLLMAELNIAAEDFPEARRAL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLP 407
                  P      ++A IE+        +  W   A+ A   P W  ++  ++ + W P
Sbjct: 363 GDLASENPDARTLTIMAAIERGEGAPDAIVKGWLARAVSAPRGPQWTCENCHHIHAHWQP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVS 467
           +           WK P               L +    D      +   +         S
Sbjct: 423 ICDNCGAFDTLAWKTPPMGEAQAPVGTAMLPLIVGQIEDWGADAPDRPDREDEDMPS--S 480

Query: 468 SFEDSTIHPLDPHIRQPDDP 487
             ED+ I P DP  ++P+ P
Sbjct: 481 EPEDAEILPSDPPSQEPEKP 500


>gi|83941980|ref|ZP_00954442.1| HemY domain protein [Sulfitobacter sp. EE-36]
 gi|83847800|gb|EAP85675.1| HemY domain protein [Sulfitobacter sp. EE-36]
          Length = 503

 Score =  498 bits (1282), Expect = e-138,   Method: Composition-based stats.
 Identities = 105/501 (20%), Positives = 196/501 (39%), Gaps = 17/501 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWI--- 56
           +++++ +  VI+ +      +      + +T     Y   P   +++++   +  WI   
Sbjct: 5   LIKIVVFVAVIAAITWGASFLLESSGGLQVTVMGTEYSFGPLQSVIAVVLLIVAVWIMLK 64

Query: 57  ---LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
              LL AV  F       L     +    KGY+AL  GLM++A+    L   M       
Sbjct: 65  IFALLVAVWHFLNGDETALSRYFDRNRERKGYEALSEGLMALASGEGRL--AMAKAAKAD 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  L  LL  Q A        A E    ++    TR   V  +  +    GD  +A
Sbjct: 123 KYLERPDLTNLLIAQAAEMAGDRRKAEETYRKLVTNERTRFVGVRGIMKQKLAEGDTETA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
            + A KA  I P      + +++     ++W+ A   LN K KN         R  A+L 
Sbjct: 183 LKLAEKAFAIKPKHAETGDVLLKLQAEKEDWAGARQTLNTKLKNGQMPRDVHKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ + +   +G+ I +   AIE+ +L  + I A++ AA   I Q K + A  +L+K W V
Sbjct: 243 LSEAKDVIAEGNSIEAREAAIEANRLSPDLIPAAVMAAHGYIDQGKPKYAARVLKKAWDV 302

Query: 290 NPHPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A  +  +  + T   +LKR   L  +  +  E+ ++++++ +      QA    
Sbjct: 303 QPHPDLAGAFAAIQPDETPKERLKRFTTLTRVQPDHPETKMLLAELNIAAEDFPQARRSL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLP 407
              ++  P      L+A IE+    +   +  W   AL     P WI D+  ++ + W P
Sbjct: 363 GDLVETDPTARSVTLMAAIERGEGASDTIVKGWLARALTVSRGPQWICDNCQHIHASWKP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGK--KNHLPSIKK 465
           +     +     WK P  S   +        L +    D+  +        +  +   + 
Sbjct: 423 ICENCHSFDTLAWKTPPMSEVAMPGGVQMLPLIVGALEDNSGADAKPPVATRADIEDAEL 482

Query: 466 VSSFEDSTIHPLDPHIRQPDD 486
           +       + P++    QP+ 
Sbjct: 483 IDDTPAGAVDPVEKPATQPEK 503


>gi|83953029|ref|ZP_00961751.1| HemY domain protein [Sulfitobacter sp. NAS-14.1]
 gi|83841997|gb|EAP81165.1| HemY domain protein [Sulfitobacter sp. NAS-14.1]
          Length = 503

 Score =  491 bits (1264), Expect = e-136,   Method: Composition-based stats.
 Identities = 104/501 (20%), Positives = 195/501 (38%), Gaps = 17/501 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-------VILSILYFFLF 53
           +++++ +  VI+ +      +      + +T     Y   P        +++  ++  L 
Sbjct: 5   LIKIVVFVAVIAAITWGASFLLESSGGLQVTVMGTEYSFGPLQSVIAVVLLVVAVWIMLK 64

Query: 54  AWILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
            + LL AV  F       L     +    KGY+AL  GLM++A+    L   M       
Sbjct: 65  IFALLVAVWHFLNGDETALSRYFDRNRERKGYEALSEGLMALASGEGRL--AMAKAAKAD 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  L  LL  Q A        A E    ++    TR   V  +  +    GD  +A
Sbjct: 123 KYLERPDLTNLLIAQAAEMAGDRRKAEETYRKLVTNERTRFVGVRGIMKQKLAEGDTETA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
            + A KA  I P      + +++     ++W+ A   LN K KN         R  A+L 
Sbjct: 183 LKLAEKAFAIKPKHAETGDVLLKLQAEKEDWAGARQTLNTKLKNGQMPRDVHKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ + +   +G+ I +   AIE+ +L  + I A++ AA   I Q K + A  +L+K W V
Sbjct: 243 LSEAKDVIAEGNSIEAREAAIEANRLSPDLIPAAVMAAHGYIDQGKPKYAARVLKKAWDV 302

Query: 290 NPHPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A  +  +  + T   +LKR   L  +  +  E+ ++++++ +      QA    
Sbjct: 303 QPHPDLAGAFAAIQPDETPKERLKRFTTLTRVQPDHPETKMLLAELNIAAEDFPQARRSL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLP 407
              ++  P      L+A IE+    +   +  W   AL     P WI D+  ++ + W P
Sbjct: 363 GDLVETDPTARSVTLMAAIERGEGASDTIVKGWLARALTVSRGPQWICDNCQHIHASWKP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGK--KNHLPSIKK 465
           +     +     WK P  S   +        L +    D+  +        +  +   + 
Sbjct: 423 ICENCHSFDTLAWKTPPMSEVAMPGGVQMLPLIVGALEDNSGADAKPPVATRADIEDAEL 482

Query: 466 VSSFEDSTIHPLDPHIRQPDD 486
           +       + P++    QP+ 
Sbjct: 483 IDDTPAGAVDPVEKPATQPEK 503


>gi|315122373|ref|YP_004062862.1| HemY domain-containing protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495775|gb|ADR52374.1| HemY domain-containing protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 487

 Score =  489 bits (1258), Expect = e-136,   Method: Composition-based stats.
 Identities = 290/480 (60%), Positives = 368/480 (76%), Gaps = 4/480 (0%)

Query: 14  VICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLF 73
           +ICSFI +S+YP+D+ +TWGNR+Y+TSPFV+LSI+Y  +F ++L+  +SRFFLSCP+ + 
Sbjct: 1   MICSFIAISYYPDDIYVTWGNRIYQTSPFVMLSIVYILIFTFMLISKISRFFLSCPSTIA 60

Query: 74  HMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAE 133
           ++ HKRNY KGYK L  GL+SI A NIPLARKM SY+S +H FHNE L +LLE QIAL+E
Sbjct: 61  NIFHKRNYAKGYKELSAGLISITAQNIPLARKMFSYLSHRHIFHNESLFHLLEAQIALSE 120

Query: 134 RQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEA 193
           ++++IA EK EMMLQIP TREFA+Y+LY E  RIGDL SAQ YA KAL ISP   W  EA
Sbjct: 121 KKHHIAREKFEMMLQIPETREFAIYNLYCEFYRIGDLKSAQCYAKKALKISPYISWGIEA 180

Query: 194 VVQQYVLAKEWSRAITFLNQKKK--NAKEWNRNRAILLIARSLENADKGDMIASYHDAIE 251
           ++Q Y L KEWS+AI FLN+ KK  N + +N ++AILL ARSLENA+KGD++ASY+DA+ 
Sbjct: 181 MLQYYALEKEWSKAIDFLNKNKKYENIETYNHHQAILLTARSLENAEKGDVVASYNDAMV 240

Query: 252 SLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKL 311
            LKLC +SIMASICAAK+LI QNKK KA V+LEKIW++NPHPEIA IYT +LS N   ++
Sbjct: 241 VLKLCKHSIMASICAAKALILQNKKNKAAVVLEKIWEINPHPEIAYIYTIILSNNATERM 300

Query: 312 KRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQAN 371
            RAL+LE INK+++ESL+ V+KI+LE G+I QA  KAMLA K  PRK IFLLLA+IE+A+
Sbjct: 301 NRALKLEAINKKNIESLITVAKISLETGNIQQAQTKAMLAAKANPRKGIFLLLAKIERAS 360

Query: 372 SHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEWKIPTKSPEYIS 431
           S+N DKILYWTQ AL+  PDPLWISDDGY SS WLPLSP SK LC FEWK+P K PEY +
Sbjct: 361 SNNLDKILYWTQRALYTEPDPLWISDDGYCSSTWLPLSPTSKKLCRFEWKVPAKIPEYTT 420

Query: 432 SEN-INFSLEMAYPADDLQSMLNNGKKNHLPSI-KKVSSFEDSTIHPLDPHIRQPDDPGI 489
           +++ I++     +     ++  N   KN  PSI +     ++  I  LDP IRQPDDPG+
Sbjct: 421 NKDLISYDESETFMTHLQETKRNKNIKNPYPSIHQDYHHPKNRNILSLDPSIRQPDDPGV 480


>gi|240851346|ref|YP_002972749.1| hypothetical DNA-binding protein [Bartonella grahamii as4aup]
 gi|240268469|gb|ACS52057.1| hypothetical DNA-binding protein [Bartonella grahamii as4aup]
          Length = 519

 Score =  487 bits (1254), Expect = e-135,   Method: Composition-based stats.
 Identities = 141/510 (27%), Positives = 248/510 (48%), Gaps = 22/510 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R+  Y FV+ ++  +F  V+++     +T+ +  +  S   +LS+L       +LL+ 
Sbjct: 1   MIRVFIYTFVVCILGLAFAWVANHNGIFVLTFLHFRFSASLLTVLSVLILLFVTLVLLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +  FF S P+ L + L+KR+  +GY+AL  G+++  A +  +A+KM + V++      E 
Sbjct: 61  LLSFFFSLPSALSNYLYKRHKKRGYEALSKGILATFAGDSMVAQKMEAQVAKYLAGKQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           LV LL+ Q    +     A    E M +  +T+   +Y L+ E+ +     +AQ+YA +A
Sbjct: 121 LVKLLQAQTLSLQNNSVRAIGLYEGMRKEDSTKLVGLYGLFCEAMKSKAYEAAQQYAEEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK-------NAKEWNRNRAILLIARS 233
           L +SP   W  +AV+ +     +W +A+    + +K          E    + +LL  ++
Sbjct: 181 LTLSPALLWAHQAVLDRLSTEGKWDKALAIFERAQKALPRSVRATPERQHIQVLLLSGQA 240

Query: 234 LENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHP 293
           L   D    + +    +++ KL  + +   + AA  L   N+ RKA+ ++   W+ +PHP
Sbjct: 241 LSLFD-THPVQAREAILKAHKLAPDFVPIIVIAADILYKLNETRKADKMIIAAWQKDPHP 299

Query: 294 EIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMK 353
           ++A +Y     E  +G+LKRA  L   NK++ ES  +++K AL+ G    A  +A  A++
Sbjct: 300 DLAALYLE-REEGAIGRLKRARTLASYNKDAFESAFLIAKAALDAGETAIAREQAKKALQ 358

Query: 354 IAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISK 413
             PR+ ++LLLA IE+A  +N   +  W   AL A  DP+W+  DG + S W  +SPIS 
Sbjct: 359 YHPRESVYLLLADIEEAQGNNQGAVRQWLSLALRAERDPVWMC-DGSIFSSWSAVSPISG 417

Query: 414 TLCYFEWKIPTKSPEY-ISSENINFSLEMAYPADDLQSMLNNGKKNHLPS---------- 462
            L  FEWK P   P   + ++NI    +           + + K   L            
Sbjct: 418 RLGGFEWKAPPCMPSLTLEADNIVPKKQDKEYVTGKSDGVEDKKLEKLTPIDDSLLHNVQ 477

Query: 463 IKKVSSFEDSTIHPLDPHIRQPDDPGIKEQ 492
           ++K    E         H+   DDPG+K +
Sbjct: 478 VEKQDIKEQDVKMFSQTHL-NVDDPGVKTE 506


>gi|319899462|ref|YP_004159559.1| hypothetical protein BARCL_1326 [Bartonella clarridgeiae 73]
 gi|319403430|emb|CBI76998.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 514

 Score =  486 bits (1252), Expect = e-135,   Method: Composition-based stats.
 Identities = 130/471 (27%), Positives = 215/471 (45%), Gaps = 12/471 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R+  Y FV+ ++   F   ++    + IT+    +  S   I+S L   L   + L+ 
Sbjct: 1   MIRIFIYVFVVCVIGAVFSWCANNNSFLVITFLQMRFTVSLLTIVSGLVILLAILVFLWK 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
             R   S P  L+    +    +G KAL  GL++  A +   A+KM     +      E 
Sbjct: 61  FFRIIFSIPRSLYSFFSRHYQKQGGKALTQGLLAAFAGDYMTAQKMEVRALRYLVKDYEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LL  QI   ++    A    E M +   T+    Y L+ E+      + AQ YA +A
Sbjct: 121 LIKLLRAQILFLQKDSMNAIVLYEEMKKEELTKLAGFYGLFREAINTKAYDIAQHYAEEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN-------AKEWNRNRAILLIARS 233
           L +SP   W  + V+ +     +W++A+   ++ ++          E     A+LL   +
Sbjct: 181 LALSPTLLWAQQFVLDRLSAEGKWNKALDVFHRAQRALPRSEHCTPERKYIHALLLSGLA 240

Query: 234 LENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHP 293
           L   +   ++ +    +++ KL  + +  ++  A  L    + RKA+ I+ K W+ NPHP
Sbjct: 241 LHFVE-TQLVEARKAILKAHKLMPDFVPITVIMADILYKLKEVRKADKIIIKAWQENPHP 299

Query: 294 EIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMK 353
           +   +Y     E+ VG+LKRA +L   NK+  ES  IV+K AL+ G ++ A   A  A+ 
Sbjct: 300 DFGTLYLR-REESAVGRLKRAKKLASYNKDIFESSFIVAKAALDAGELELARECAQKALT 358

Query: 354 IAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISK 413
             PR+ ++LLLA IE+A  ++      W   AL A  DP W   DG   S W  +SPIS 
Sbjct: 359 YHPREGVYLLLADIEEAQGNDQG-SRQWLSLALRAERDPAWAC-DGSFFSSWSAVSPISG 416

Query: 414 TLCYFEWKIPTK-SPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSI 463
            L  FEWK+P + SP  +  +N+    E        +  + +       SI
Sbjct: 417 RLGRFEWKVPPRCSPITLEVDNMVLKKEDKKDTIYEKEAVKDKSFEKKSSI 467


>gi|121602299|ref|YP_988402.1| hypothetical protein BARBAKC583_0064 [Bartonella bacilliformis
           KC583]
 gi|120614476|gb|ABM45077.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 531

 Score =  485 bits (1249), Expect = e-135,   Method: Composition-based stats.
 Identities = 135/518 (26%), Positives = 240/518 (46%), Gaps = 31/518 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++ Y F + ++   F  V+++   V IT+    +  S   +LS+    L    L++ 
Sbjct: 1   MIRVVVYSFAVCVLGALFGWVANHNSIVVITFLQTRFAISLLTLLSVSIVLLVMLALVWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R     P  L      R   KG +AL  GL+++ + +   A+KM +   +    ++E 
Sbjct: 61  LLRGLFFAPNALRRYFSTRRQKKGREALSQGLLAVFSGDYVTAKKMETCALKYLANNHEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LL+ Q    ++    A    E M Q   T+   +Y LY E+  + +  +AQ YA +A
Sbjct: 121 LMKLLQAQTLFLQKDSIRAIGFYEEMRQETPTKLAGLYGLYREAVAMKEDEAAQHYAEEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRN-------RAILLIARS 233
           L +SP   W  +AV+ +     +W +A+    + +K     +R         A+LL  ++
Sbjct: 181 LALSPALLWAHQAVIDRLSAEGQWDKALDVFEKAQKALPRADRWTAERNYTYALLLSGQA 240

Query: 234 LENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHP 293
           L+   K   + +    +++ KL  + +  ++  A  L   N+ RKA+ I+   WK  PHP
Sbjct: 241 LQLF-KTHPVKARTAILKAHKLLPDFVPITVITADILYKSNEVRKADKIIFNAWKKEPHP 299

Query: 294 EIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMK 353
           ++   Y     E  V +LK+A +L   N+++ ES  +V+K AL+ G ++ A  +A  A++
Sbjct: 300 DLGACYLK-NEERAVERLKKAKKLASYNEDTFESAFLVAKAALDAGEVEFAREQAQKALQ 358

Query: 354 IAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISK 413
           + PR+ ++LLLA IE+A  ++   +  W   AL A  DP W+  DG L S W  +SPIS 
Sbjct: 359 LHPRESVYLLLADIEEAQGNDQLLVRQWLSLALRAERDPTWMC-DGTLFSSWSAVSPISG 417

Query: 414 TLCYFEWKIPTKS-PEYISSENINFSL--EMAYPADDLQSMLNNGKKNHLPSIKKVSSFE 470
            L  FEWK P +S P  +  + I      ++          +   K+     + +++   
Sbjct: 418 RLGCFEWKAPPRSLPLTLEIDPIEPKDVGDVGPMVLKNVDPVMAEKEEKEDVVTEITFVN 477

Query: 471 DSTIHPLDPHIR------------------QPDDPGIK 490
           D  ++ + P                       DDPG+K
Sbjct: 478 DELLNEISPIKDGFLPQNSAKKKISNQTRLNVDDPGVK 515


>gi|110677862|ref|YP_680869.1| hypothetical protein RD1_0473 [Roseobacter denitrificans OCh 114]
 gi|109453978|gb|ABG30183.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 492

 Score =  485 bits (1249), Expect = e-135,   Method: Composition-based stats.
 Identities = 106/498 (21%), Positives = 193/498 (38%), Gaps = 28/498 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWILL- 58
           ++++I +   ++ +    + +      V +      +  SP   +++ +      W+ L 
Sbjct: 5   LIKIILFVVAVAALAMGAVYLLESEGGVQVQVMGTEFTFSPIQSVIAAVVLIFVVWLFLK 64

Query: 59  -----FAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
                 A  RF       +     +    KG++AL  GLM++A+    +A  M+     +
Sbjct: 65  LLSLLVACLRFLSGDETAISRYFDRSRERKGFQALSEGLMALASGEGRVA--MNKAAKAE 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
              +   L  LL  Q A        A E  + ++   ATR   V  +  +    GD ++A
Sbjct: 123 RYLNKPELTNLLVAQAAEMAGDRRKAEETYKKLVTTDATRFVGVRGIMKQKLADGDTDTA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
            + A KA  I P    V + +++     ++WS A   L+ K K          R  A+L 
Sbjct: 183 LQLAEKAFAIKPKHEEVQDVLLRLQAQKEDWSGARKTLSAKLKYGNLPRDVHRRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ + +       I     AIE+ KL  + I A++ AA   + QN+ R A  +L+K W+V
Sbjct: 243 LSEAKDILSDASSIDVQEKAIEANKLSPDLIPAAVMAAGGYVEQNRPRLAVRLLKKAWEV 302

Query: 290 NPHPEIANIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
           +PHP++A  +  +   E    ++KR + +  I  E+ E+ ++++++ +      +A    
Sbjct: 303 HPHPDLAAAFAAIEPNETPAERIKRFMAITRIKPENPETKMLLAELHIANEDFPEARRAL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLP 407
               +         L+A IE+        +  W   AL     P WI D+  ++   W P
Sbjct: 363 GDLAETDATARSVTLMAAIERGEGAPDTVVRGWLAKALTVSRGPQWICDNCQHIHREWGP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVS 467
                ++     WK P  S             EMA P       L  G     P      
Sbjct: 423 FCENCESFDTLAWKTPPMS-------------EMAMPGGMQMLPLIVGALEEKPDETSGD 469

Query: 468 SFEDSTIHPLDPHIRQPD 485
             ED+ I P       P+
Sbjct: 470 IIEDAEIIPDSMDSAAPE 487


>gi|325294024|ref|YP_004279888.1| HemY domain protein [Agrobacterium sp. H13-3]
 gi|325061877|gb|ADY65568.1| HemY domain protein [Agrobacterium sp. H13-3]
          Length = 535

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 167/522 (31%), Positives = 262/522 (50%), Gaps = 34/522 (6%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R++ +  ++  +   F  ++  P  +SI W  +L   S  V  SI+   + A +L++ 
Sbjct: 1   MTRILTFVLIVLALGFGFSWLADRPGVLSIVWQGQLIEMSLMVAASIVAALVAAVMLVWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V     + P         R  D+GY+AL TGL++  A N  LARKM +      +   E 
Sbjct: 61  VVNAIWTSPNAARRYFRARKRDRGYQALSTGLIAAGAGNAILARKMTARTQGLLSADQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L++LL+ Q  L E +Y+ A  K E M + P TRE  +  LY E+ R G   +AQ+YA  A
Sbjct: 121 LIHLLDAQADLIEGKYDEARRKFEAMARDPETRELGLRGLYIEARRQGAHEAAQQYAEDA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLIARSLEN 236
            + +P  PW  +A ++      EW  AI  L+Q+K        E  R +A+LL A++ E 
Sbjct: 181 AEKAPYLPWAAQATLETRCRNGEWDDAIRLLDQQKAAGVIQRGEAERLKAVLLTAKAGEK 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            +  D + +  DA ++LKL  + + A++ AAKS + ++  RKA  ++E +WK +PH +IA
Sbjct: 241 LE-SDPVGAREDAKQALKLAKSLVPAALIAAKSYLREDNLRKAAAVMEPVWKNDPHSQIA 299

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           ++Y    S +T   +LKRA RLE +   ++ESL  V++ AL+     +A AKA  A +I 
Sbjct: 300 DLYVRARSGDTAIDRLKRAERLESLKPNNIESLFAVAQAALDAKEFAKARAKAEAAARIE 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+ IFLL+A IE+A + +  ++ YW   AL A  DP+W++ DG  S  WLP+SP++  L
Sbjct: 360 PRESIFLLMADIEEAETGDQGRVRYWMAQALRAPRDPVWVA-DGVTSEKWLPVSPVTGRL 418

Query: 416 CYFEWKIPT------------------------KSPEYISSENINFSLEMAYPADDLQSM 451
             FEWK P                         ++P  I  E     + +  PA      
Sbjct: 419 DAFEWKAPFGQLEGPVEDLTIENAIAAAPARTEQAPTPIVVEVAPQPIVVTKPAPIEVKP 478

Query: 452 LNNGKKNHLPSIKKVSS---FEDSTIHPLDPHIRQPDDPGIK 490
             +  K   P+  +V       D+   P+      PDDPG+K
Sbjct: 479 DVSTPKEKKPATNEVPVEARPADAKTEPVPFFGGAPDDPGVK 520


>gi|149912845|ref|ZP_01901379.1| hypothetical protein RAZWK3B_02615 [Roseobacter sp. AzwK-3b]
 gi|149813251|gb|EDM73077.1| hypothetical protein RAZWK3B_02615 [Roseobacter sp. AzwK-3b]
          Length = 496

 Score =  481 bits (1239), Expect = e-134,   Method: Composition-based stats.
 Identities = 105/497 (21%), Positives = 197/497 (39%), Gaps = 28/497 (5%)

Query: 2   LRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILL--- 58
           L+++ +  ++S        +      V I +G + +  +P   +  L   + A  LL   
Sbjct: 6   LKIVGFIALVSAATLGAAHLIEMEGGVRIVFGGQEFNLTPIKAVIALIVLVIALWLLLKL 65

Query: 59  ----FAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQH 114
                A  +F       +     K   +KG++AL  G+M++A+    LA  M      + 
Sbjct: 66  VSLLVATLKFINGDETAISRYFDKNRQEKGFRALSEGMMALASGEGDLA--MSKASKAEK 123

Query: 115 TFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQ 174
                 L  LL  Q A        A    + +L+   TR   V  L  +    GD  +A 
Sbjct: 124 YLRKPDLTNLLTAQAAELSGDTRKAELVYKKLLKDDRTRFVGVRGLMRQKLAAGDTETAL 183

Query: 175 RYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLI 230
           + A  A  + P    V +A+++      +W  A   LN K K          R  A+L +
Sbjct: 184 KLAKTAFALKPRHGEVQDALLRLQAQTADWKGARETLNAKLKYGSLPRDLHKRRDAVLAL 243

Query: 231 ARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
           + + +  D+G  I +   AIE+ +L  + + A++ AA+S ISQ  KR A  + +K W V+
Sbjct: 244 SEAKDVLDEGKDIEAREAAIEANRLSPDLVPAAVLAARSYISQGSKRYATRVTKKAWGVH 303

Query: 291 PHPEIANIYTHLLSENT-VGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAM 349
           PHP++A  +  +  + T   +LKR  +L  ++ ++ E+ ++ +++ L       A     
Sbjct: 304 PHPDLAAAFAEIEPDETPAQRLKRFSKLIAMHPDNRETKLLKAELHLAAEDFPAARRALG 363

Query: 350 LAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLPL 408
             ++  P   +  ++A IE+    +   +  W   AL A   P W+ D+  ++ + W P 
Sbjct: 364 DLVETDPDARVLTIMAAIERGEGSSDAVVKGWLARALSAPRGPQWVCDNCQHIHAEWAPA 423

Query: 409 SPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSS 468
                      WK P  S    S+      L +             G     P+ ++ + 
Sbjct: 424 CDHCNAFDTLTWKTPPVSTMTTSTGIEMLPLIV-------------GAIEQKPTEEEQTE 470

Query: 469 FEDSTIHPLDPHIRQPD 485
            +   +   +     P+
Sbjct: 471 PDGDDVLDAEVVDETPE 487


>gi|254510666|ref|ZP_05122733.1| HemY domain protein [Rhodobacteraceae bacterium KLH11]
 gi|221534377|gb|EEE37365.1| HemY domain protein [Rhodobacteraceae bacterium KLH11]
          Length = 498

 Score =  480 bits (1236), Expect = e-133,   Method: Composition-based stats.
 Identities = 105/496 (21%), Positives = 201/496 (40%), Gaps = 16/496 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFA------ 54
           +L+++ +  +I L+      +      V IT     Y   P      L   +FA      
Sbjct: 5   LLKILVFVAIIGLLAMGAGFLMESSGGVQITVAGTEYTLGPLQSAIALGVLVFAVWLFFK 64

Query: 55  -WILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
              LL A  +F       L     +    +GY+AL  GLM++A+    +A  M      +
Sbjct: 65  LLTLLVATLKFLNGDETALSRYFDRSREKRGYQALADGLMALASGEGRVA--MTKANKAE 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
              +   L  LL  Q A        A E  + ++   +TR   V  +  +    GD  +A
Sbjct: 123 KLLNKPELTNLLVAQAAEMTGDTKKASETYKKLVANNSTRFVGVRGIMKQKLSEGDDETA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
            + A KAL I P      + ++     A++W+ A + LN K K        + R  A+L 
Sbjct: 183 LKLAEKALAIKPRHEETQDVLLNLQTRAQDWAGARSTLNSKLKAGYLPRDVFKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ + +  D+   +     AIE+ +L  + + A+  AA++ I + K R A  IL+K W+ 
Sbjct: 243 LSEAKDILDETASVEQQEHAIEANRLSPDLVPAAAMAARAYIEKGKPRAAAKILKKAWEA 302

Query: 290 NPHPEIANIYTHLLSENTVG-KLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A+ +   + + T   ++KR   L  I+ +++E+ +I++++ +      +A    
Sbjct: 303 QPHPDLAHAFAEAVPDETPEQRIKRFTALTRIHPDNMETRLILAELNIVAEDFPEARRAL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGY-LSSVWLP 407
              ++       + L+A IE+    +   +  W   AL+A   P W+ D+ + + + W P
Sbjct: 363 GDVVEKQGDARAYTLMAAIERGEGASDAVVQGWLAKALNAPRGPQWVCDNCHDIQAEWAP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVS 467
           +     +     W+ P ++PE  S   ++    +    +D        +           
Sbjct: 423 ICQNCGSFDTLSWQTP-QTPEIASVTGVHMLPLIVGALEDQSEPEAVEEAEEPEDTATED 481

Query: 468 SFEDSTIHPLDPHIRQ 483
             E          +RQ
Sbjct: 482 VIEVHAEPATTEEVRQ 497


>gi|159185310|ref|NP_355592.2| hypothetical protein Atu2656 [Agrobacterium tumefaciens str. C58]
 gi|159140568|gb|AAK88377.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 538

 Score =  478 bits (1231), Expect = e-133,   Method: Composition-based stats.
 Identities = 165/525 (31%), Positives = 256/525 (48%), Gaps = 37/525 (7%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++ +  ++  +   F  ++  P  +SI W  +L   S  V  SI+   + A +L++ 
Sbjct: 1   MIRILTFAVIVLALGFGFSWLADRPGALSIVWQGQLIEMSLMVAASIIAALVAAVMLIWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V     + P         R  D+GY+AL TGL++  A N  LARKM +      +   E 
Sbjct: 61  VVNAVWTSPNAARRYFRARKRDRGYQALSTGLIAAGAGNAILARKMTARTQGLLSADQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L++LL+ Q  L E +Y+ A  K E M + P TRE  +  LY E+ R G   +AQ+YA  A
Sbjct: 121 LIHLLDAQADLIEGKYDEARRKFEAMARDPETRELGLRGLYIEARRQGAYEAAQQYAEDA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLIARSLEN 236
            + +P  PW  +A ++      +W  AI  L+Q+K  +     E  R +A+LL A++ E 
Sbjct: 181 AEKAPYLPWAAQATLENRCRNGQWDDAIRLLDQQKAASVIERGEAERLKAVLLTAKAGEK 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            +  D +++  DA  +LKL    + A++ AAKS + ++  RKA  +LE +WK  PHP+IA
Sbjct: 241 LE-SDPVSAREDAKHALKLAKGLVPAALIAAKSYLREDNLRKAATVLEPVWKNEPHPQIA 299

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
            +Y    S +T   +LKRA RLE +   ++ESL  V++ AL+     +A AKA  A +I 
Sbjct: 300 QLYVRARSGDTAIDRLKRAERLESLKPNNIESLFAVAQAALDAKEFAKARAKAEAAARIE 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+ IFLL+A IE+A + +  ++ YW   AL A  DP W++ DG +S  WLP+SP++  L
Sbjct: 360 PRESIFLLMADIEEAETGDQGRVRYWMAQALRAPRDPAWVA-DGIVSEKWLPVSPVTGRL 418

Query: 416 CYFEWKIP---TKSP--------------------------EYISSENINFSLEMAYPAD 446
             FEWK P    + P                          E             A P +
Sbjct: 419 DAFEWKAPFGQLEGPVEDLTIENAIAAAPARAEPAVKTIIVEAAPETRAEPKPAPATPIE 478

Query: 447 DLQSMLNNGKKNHLPSIKKVSSFEDSTIHPLDPHIR-QPDDPGIK 490
               +    +   +P    V +          P     PDDPG+K
Sbjct: 479 VKPIVSTAKENKPVPIEAPVGTDASDKKADAVPFFGGAPDDPGVK 523


>gi|163869275|ref|YP_001610531.1| hypothetical protein Btr_2583 [Bartonella tribocorum CIP 105476]
 gi|161018978|emb|CAK02536.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 520

 Score =  476 bits (1226), Expect = e-132,   Method: Composition-based stats.
 Identities = 138/514 (26%), Positives = 249/514 (48%), Gaps = 30/514 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R+  Y FV+ ++  +F+ V+++     +T+ +  +  S   +LS+L       +LL+ 
Sbjct: 1   MIRVFIYTFVVCILGLAFVWVANHNGVFVLTFLHFRFSASLLTVLSVLTLLFVTLVLLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +  FF S P+ L +  +KR   +GY+AL  G+++  A +  +A+KM + V++      E 
Sbjct: 61  LLSFFFSIPSALSNYFYKRQRKRGYEALSKGILATFAGDSMVAQKMEARVAKYLAGKQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           LV  L+ QI   +     A    E M +   T+   +Y L+ E+ +     +AQ+YA +A
Sbjct: 121 LVKFLKAQILSLQNNSVRAISLYEEMRKEDPTKLVGLYGLFREAMKSKAYEAAQQYAEEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN-------AKEWNRNRAILLIARS 233
           L +SP   W  +AV+ +     +W +A+T   + +K          E    + +LL  ++
Sbjct: 181 LTLSPALLWAHQAVLDRLGAEGKWDKALTVFERAQKALPRSVRSTPERQHIQVLLLSGQA 240

Query: 234 LENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHP 293
           L   +    + +    +++ KL  + +  +I AA  L   N+ RKA+ ++   W+  PHP
Sbjct: 241 LHLFE-THPVQAREAILKAHKLAPDFVPITIIAADILYKLNETRKADKMIIAAWQKEPHP 299

Query: 294 EIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMK 353
           ++  +Y     E  +G+LKRA  L   NK+  ES  ++SK AL+ G    A  +A  A++
Sbjct: 300 DLGTLYIE-REEGAIGRLKRAKTLASYNKDVFESAFLISKAALDAGETILAREQAQKALQ 358

Query: 354 IAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISK 413
             PR+ ++LLLA IE+A  +N   +  W   AL A  DP+W+ + G + S W  +SPIS 
Sbjct: 359 YHPRESVYLLLADIEEAQGNNQGAVRQWLSLALRAERDPVWMCE-GSIFSSWSAVSPISG 417

Query: 414 TLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDST 473
            L  FEWK P + P          ++ +     D + ++   +      ++K++  +DS 
Sbjct: 418 RLGCFEWKAPPRLPSLTLE-----AVNIVPKKQDKEDVVEESEGVEDKKLEKLTPIDDSF 472

Query: 474 IHPLDPHIR---------------QPDDPGIKEQ 492
           +H      +                 DDPG+K +
Sbjct: 473 LHNAQVEKQDIKEQDAKTFSQIHLNVDDPGVKTE 506


>gi|255264670|ref|ZP_05344012.1| HemY domain protein [Thalassiobium sp. R2A62]
 gi|255107005|gb|EET49679.1| HemY domain protein [Thalassiobium sp. R2A62]
          Length = 484

 Score =  475 bits (1224), Expect = e-132,   Method: Composition-based stats.
 Identities = 87/481 (18%), Positives = 189/481 (39%), Gaps = 15/481 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWI--- 56
           + +++ +  +++ +      +        +    + +  S   ++L  +      W+   
Sbjct: 5   LFKILFFVAIVAALALGVERLMQIEGGAVVEIAGQEFELSVLHLVLGAIAIIFLVWLGFK 64

Query: 57  ---LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
              LL A  +F       +    ++    KG+ AL  G+M++A+    +A  +      +
Sbjct: 65  IFGLLVATFKFLNGDETAISRYFNRNRERKGFDALSDGMMALASGEGRVA--LAKASRAE 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  L  LL  Q A        A +  + +L+   TR   V  +  +  + GD ++A
Sbjct: 123 KYLERPELTNLLTAQAAEMAGDRVKAEQTYKRLLEDDRTRFVGVRGIMKQKLQAGDTDTA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
            + A KA  + P    + + +++    + +W+ A   L+ K K+         R  A+L 
Sbjct: 183 LKLAEKAFALKPKHVEIQDTLLKLQADSSDWAGARRTLSAKLKSGSLPRDVHRRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ + +    G+ I +   AIE+ +L  + I A++ AA+S I Q + R A  +L+K W+ 
Sbjct: 243 LSEARDILGSGESIEAREAAIEANRLSPDLIPAAVMAARSYIEQGQPRYAARVLKKTWEA 302

Query: 290 NPHPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++   +  +  + T   ++KR   L   +    E+ ++++++ +      +A    
Sbjct: 303 QPHPDLGAAFAEIAPDETPVARIKRFRALARAHPNHAETQMLMAELHIANEDFPEARRAL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLP 407
                  P      ++A IE+    +   +  W   AL A   P WI D+   + + W P
Sbjct: 363 GELATTEPTARSLAIMAAIERGAGADDAVVRGWLTRALSAPRGPQWICDNCSNIHAAWSP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVS 467
                 +     WK P      + +      L +  P  ++           + +++  S
Sbjct: 423 TCDNCGSFDTLTWKTPPAGEVTMPAATEMLPLLVGTPQSEVVEDAVEVTHAEVIAVEDKS 482

Query: 468 S 468
            
Sbjct: 483 D 483


>gi|319406345|emb|CBI79982.1| conserved exported hypothetical protein [Bartonella sp. AR 15-3]
          Length = 481

 Score =  473 bits (1217), Expect = e-131,   Method: Composition-based stats.
 Identities = 126/471 (26%), Positives = 209/471 (44%), Gaps = 14/471 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R+  Y F +  +   F   S+    + IT+    +  S   I+S L   L   + L+ 
Sbjct: 1   MIRIFIYIFAVCAIGAVFSWGSNNNNFLVITFLQMRFTVSLLTIISGLVILLTILVFLWK 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
             R   S P  L+     R  + G KAL  GL+++ A +   A+KM     +      E 
Sbjct: 61  FFRIIFSIPGTLYSFFSGRYQEYGRKALIQGLLAVFAGDYIAAQKMEIRALKYLVKDYEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LL  QI   ++    A    E M +   T+   +Y L+ E+      + AQ YA +A
Sbjct: 121 LIKLLRAQILSLQKDSMKAIALYEEMQKEEPTKLAGLYGLFREAINTKAYDVAQHYAEEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK---NAKEWNRNRAILLIARSLENA 237
           L +SP   W  + V+ +     +W++A+   ++ ++   ++  +   R           A
Sbjct: 181 LALSPALSWAQQFVLDRLSAEGQWNKALDVFHRAQRALPHSDHYTSERKYTHALLLSGLA 240

Query: 238 D---KGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPE 294
               +  ++ +    +++ KL  + +  ++     L    + RKA+ ++ K W+ NPHP+
Sbjct: 241 LHLIETQLMEARKAILKAHKLMPDFVPITVIMVDILYRLKEVRKADKMIIKAWQKNPHPD 300

Query: 295 IANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKI 354
              +Y     E+ VG+LKRA  L   NK+  ES  IV+K AL+ G ++ A   A  A+  
Sbjct: 301 FGTLYLR-REESAVGRLKRAKTLASYNKDIFESSFIVAKAALDAGELELAREYAQRALTY 359

Query: 355 APRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKT 414
            PR+ ++LLLA IE+A  +       W   AL A  DP W   DG     W  +SPIS  
Sbjct: 360 HPRESVYLLLADIEEAQGNGQG-SRQWLSLALCAERDPAWAC-DGSFFPFWSAVSPISGR 417

Query: 415 LCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKK 465
           L   EWK+P + P      +      MA   +D +  +N  K     S +K
Sbjct: 418 LGRCEWKVPPRCPPITLEIDN-----MALKKEDKKGPVNEKKVIKDKSFEK 463


>gi|114765154|ref|ZP_01444298.1| HemY domain protein [Pelagibaca bermudensis HTCC2601]
 gi|114542429|gb|EAU45456.1| HemY domain protein [Roseovarius sp. HTCC2601]
          Length = 511

 Score =  472 bits (1215), Expect = e-131,   Method: Composition-based stats.
 Identities = 101/510 (19%), Positives = 197/510 (38%), Gaps = 23/510 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWI---- 56
           +L++I +  V++ +      V      + IT G   +   P   +  +   + A      
Sbjct: 5   LLKIILFVAVVAALTLGAGYVMESQGGIQITAGGYEFNLGPLQSVIAVIVLVIALYVVFK 64

Query: 57  ---LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
              LL AV +F       L     +    KGY+AL  G++++++    LA  M       
Sbjct: 65  LVSLLIAVLKFINGDDTALSRYFDRNRERKGYQALSEGMLALSSGEGKLA--MAKAQKAD 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
              H   L  LL  Q A        A E  + ++    TR   +  +       GD  +A
Sbjct: 123 RYLHRPGLTNLLTAQAAEMTGDTRKAEEVYKKLITNDETRFVGIRGMMKLKLAKGDTETA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
            + A +A  + P  P + + ++Q      +W  A   L+ K K+       + R  A+L 
Sbjct: 183 LKLAERAFALKPKHPEIQDTLLQLQAQKHDWRGARQTLSAKLKHGSLPRDVYRRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ + +   +   I +   AI S K   + I  +  AA++ I++ +++KA  IL+K W V
Sbjct: 243 LSEAKDIFAEDKPIEAREAAIASAKGSPDLIPGACMAARAYIARGEQKKAVRILKKTWSV 302

Query: 290 NPHPEIANIYTHLLSENT-VGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A  +  +  + T   ++KR   +  I  +  E+ ++ +++AL      +A    
Sbjct: 303 QPHPDLAAAFAEIAPDETPAERMKRFRTITSIRPDHRETRLLRAELALAAEDFPEARRAM 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLP 407
              +   P      ++A I +       ++  W   AL A   P W+ D   ++   W+P
Sbjct: 363 GDLVDKEPDARTLTVMAAIARGEGAPETEVRGWLAKALVAPRGPQWVCDSCHHIHGEWVP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSI---- 463
           +           W  P +S +   +      L +    D  +      +    P I    
Sbjct: 423 VCENCGGFDTLSWTTPPQS-DAAPAGAEMLPLIVGALEDTSKDESAQAEAEDAPEILTPN 481

Query: 464 ---KKVSSFEDSTIHPLDPHIRQPDDPGIK 490
              ++  +  + T+   +    +P+  G K
Sbjct: 482 PPTEEGKTAAEETVEDAEEVSDEPEKEGAK 511


>gi|49474780|ref|YP_032822.1| hypothetical protein BQ12990 [Bartonella quintana str. Toulouse]
 gi|49240284|emb|CAF26758.1| hypothetical protein BQ12990 [Bartonella quintana str. Toulouse]
          Length = 518

 Score =  472 bits (1214), Expect = e-131,   Method: Composition-based stats.
 Identities = 139/509 (27%), Positives = 243/509 (47%), Gaps = 22/509 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R++ Y FV+ ++  +F  V+++ + + IT+ +  +  S   +LS+L  FL   + L+ 
Sbjct: 1   MTRVLIYTFVVCMLGLAFGWVANHNDVLIITFLHFRFSISLLTLLSVLILFLGILVFLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +     S P  L +  +KR    GY+AL  G+++  A +   A+KM + V +     +E 
Sbjct: 61  LLSVLFSLPGTLSNYFYKRGQKLGYEALSQGVLAAFAGDGVAAKKMEARVVKYLAGKHEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           LV LL+ Q    +     A    E M +   T+   +Y L+ E+ +     +AQ+YA +A
Sbjct: 121 LVKLLQAQALSLQNNSARAISLYEEMRKETPTKLAGLYGLFREAMKANAYEAAQQYAQEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK-------NAKEWNRNRAILLIARS 233
           L +SP   W  + V+ +      W +A+    + +K       +  E    +A+LL  ++
Sbjct: 181 LALSPALLWAYQLVLDRLSAQGRWDKALDVFERAQKVLPRSVRSTPERQHVQALLLSGQA 240

Query: 234 LENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHP 293
           L    +     +    +++ +L  + +  ++ AA  L   N+ RKA+ ++   W+ NPHP
Sbjct: 241 LHLF-RTHPTDARKVILKAHRLVPDFVPITVIAADILYKLNETRKADKMIIAAWQKNPHP 299

Query: 294 EIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMK 353
            +  +Y     E  VG+LK+A  L   +K++ ES  +V+K AL+ G    A  +A  A++
Sbjct: 300 NLGALYLE-REEGAVGRLKKAKALASYSKDTFESAFLVAKAALDAGERVLAREQAQKALQ 358

Query: 354 IAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISK 413
              R+ ++LLLA IE+A  +N   +  W   AL A  DP+W+  DG + S WLP+SPIS 
Sbjct: 359 YHRRESVYLLLADIEEAQGNNQAAVRQWLSLALRAERDPVWMC-DGTIFSSWLPVSPISG 417

Query: 414 TLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDST 473
            L  FEWK P   P      +    L      D    M  N  ++ L  + +  + ++  
Sbjct: 418 RLGRFEWKAPPSPPPLTLETDNTIVLTKKSQEDKNDIMGKNVVEDKL--LNEFPAVKNDL 475

Query: 474 IHPLDPHIR----------QPDDPGIKEQ 492
           +H    + +            DDPGIK +
Sbjct: 476 LHSAQTNKQGARQSSKTRLNVDDPGIKTE 504


>gi|319409418|emb|CBI83064.1| conserved exported hypothetical protein [Bartonella schoenbuchensis
           R1]
          Length = 510

 Score =  472 bits (1214), Expect = e-131,   Method: Composition-based stats.
 Identities = 132/502 (26%), Positives = 230/502 (45%), Gaps = 18/502 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R+  Y FV+ ++  +F  V+ +   V+IT+ +     S    LS    FL    +L+ 
Sbjct: 1   MIRVFIYIFVVCVLGAAFGWVASHNSVVTITFMHTRLSISLLAFLSTFIVFLG---ILWG 57

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +       P   ++  + R   +G +AL  GL++    +   A+KM +   +    + E 
Sbjct: 58  LLYVVCFAPGAFYNYFYTRRQRRGREALSQGLLAAFIGDHLTAQKMETRALKYLEENCEP 117

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LL+ Q  + ++    A    E M Q  +T+   +Y L+ E+       +AQ YA +A
Sbjct: 118 LIKLLQAQTLVLQKDSIRAIHLYEEMRQKKSTKLAGLYGLFREAMDTKTYEAAQHYAQEA 177

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN-------AKEWNRNRAILLIARS 233
             +SP   W  +AV+ +     +W  A+    + +K          E N   A+LL  ++
Sbjct: 178 FTLSPSLVWAHQAVLDRLSAEGQWDEALDVFEKVQKALPRSARLTAERNHTHALLLSGKA 237

Query: 234 LENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHP 293
           L    K   + +    +++ KL  +    ++  A  L   N+ RKA+ I+ + WK +PHP
Sbjct: 238 LHVF-KIHPVKARSAILKAHKLVPDFGPITVITAGILYKLNETRKADKIIIEAWKKDPHP 296

Query: 294 EIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMK 353
           +   +Y     E  VG+LK+A +L   NK + ES  +++K AL+ G +  A  +A  A+ 
Sbjct: 297 DFGALYLG-REERAVGRLKKAKKLASYNKNTFESAFLIAKAALDAGELTLAREQAKKALN 355

Query: 354 IAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISK 413
             PR+ ++LLLA IE+   ++   +  W   A +A  DP WI D+  L S W  +SPIS 
Sbjct: 356 YHPRESVYLLLADIEEVQGNDQGLVHQWLSLARNAERDPTWICDN-TLFSSWSAVSPISG 414

Query: 414 TLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDST 473
            L  FEWK P +    ++ E  +  L+     +  +    +   +  P  +  S FE  T
Sbjct: 415 RLGCFEWKAPPRRFP-LTLEADDIVLKKEDKQNVTEIAFKDNLLSKCPPKESDSPFEVYT 473

Query: 474 IHPLDPHIRQ----PDDPGIKE 491
               +  + Q     DD  +K 
Sbjct: 474 NKQDEETLNQIHLDVDDSNVKT 495


>gi|259417169|ref|ZP_05741088.1| HemY domain protein [Silicibacter sp. TrichCH4B]
 gi|259346075|gb|EEW57889.1| HemY domain protein [Silicibacter sp. TrichCH4B]
          Length = 497

 Score =  469 bits (1208), Expect = e-130,   Method: Composition-based stats.
 Identities = 105/495 (21%), Positives = 201/495 (40%), Gaps = 16/495 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWI--- 56
           +L+++ +  +++L+     ++      V IT     Y       +++++   +  W+   
Sbjct: 5   LLKILVFVAIVALMAFGAGVLMETAGGVQITVAGIEYTLGALQSVMALVALMVLTWLFFK 64

Query: 57  ---LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
              LL A  RF       L     K    +GY+AL   LM++A      A  +      +
Sbjct: 65  LLSLLIATLRFLNGDETALSRYFDKGRERRGYQALSDSLMALAVGEGRTA--LSKAAKAE 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
               +  L  L+  Q A      + A E  + +L   +TR   V  +  +    GD  +A
Sbjct: 123 RYLQDPALTDLVVAQAAEMAGDTHKASEAYKRLLSDQSTRFVGVRGIMKQKLSEGDTETA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
           ++ A KAL + P    V + +++    A++W+ A   L  K K      + + R  A+L 
Sbjct: 183 RQLAEKALALRPKHEEVQDTLLKLQAQAEDWAGARQTLATKLKTGTLPREVFKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ S     +         AIE+ +L  + + A+  AA+S I++ K R A  IL+K W+ 
Sbjct: 243 LSSSKALLAEEATPEQQEQAIEANRLSPDLVPAAALAARSYIAKGKPRNAVRILKKAWEA 302

Query: 290 NPHPEIANIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A+ +  +   E+   ++KR   L  +  +  E+ ++ +++ +      +A    
Sbjct: 303 QPHPDLAHAFAEIEPNESAQERVKRFETLLRVKPDHDETRLVRAELLIVAEDFPEARRAL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISD-DGYLSSVWLP 407
              +  AP      L+A IE+        +  W   AL A   P W+ +   ++ + W P
Sbjct: 363 GDLVDRAPDARALTLMAAIEKGEGGPDAMVQGWLTKALTAPRGPQWVCESCNHIHAEWAP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVS 467
                 +     WK P ++PEY S+        +A  A+     L     + +     V 
Sbjct: 423 TCENCASFDTLTWKRP-ETPEYHSATGAAMLPLLAARAEAGTGALTIVDPDPIDVSDDVE 481

Query: 468 SFEDSTIHPLDPHIR 482
              D T  P    ++
Sbjct: 482 IDLDDTSEPSKGDVK 496


>gi|84684559|ref|ZP_01012460.1| Uncharacterized HemY-like membrane protein [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84667538|gb|EAQ14007.1| Uncharacterized HemY-like membrane protein [Rhodobacterales
           bacterium HTCC2654]
          Length = 504

 Score =  468 bits (1205), Expect = e-130,   Method: Composition-based stats.
 Identities = 101/488 (20%), Positives = 191/488 (39%), Gaps = 17/488 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWILL- 58
           + ++I +  +I         +      + +  G + Y       +++++   +  WILL 
Sbjct: 5   LFKIILFVVLIGAATVGATYLLETDGGIRVDIGAQEYNLGALQAVIALIVLVVTLWILLK 64

Query: 59  -----FAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
                 A  RF       +     +    KGY+AL  G+M++A+     A  +      +
Sbjct: 65  LAGLIVATIRFLNGDETAISRHFDRNRERKGYEALADGMMALASGEERTA--ITKAARAE 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  L  L+  Q A        A E  + +L    TR   V  L  +    GD ++A
Sbjct: 123 RYLRRPELTNLITAQAAEMAGDRKKATEVYKRLLADERTRFVGVRGLMKQKLEEGDTDTA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILL 229
            + A KA  + P      + ++       +W  A   L +K K+         R  A+L 
Sbjct: 183 MKLAEKAFALKPQHAETGDVLLALQATQNDWHGARETLGKKVKHGALPKDVGKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           +  +      G+ I +   AIE+ KL  + I  S+ AA+S + Q+ KR A  +L K WKV
Sbjct: 243 LQEAKGIFQDGNSIRAREAAIEANKLSPDLIPGSVLAARSYLEQDNKRYAARVLTKTWKV 302

Query: 290 NPHPEIANIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP+IA  +  +   E    +LKR   L + + +  E+ ++++++ +     D+A    
Sbjct: 303 QPHPDIAEAFAEIEPNETPEQRLKRFKALTKEHPDHPENKMLLAELHIAAEQFDKAREAL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGY-LSSVWLP 407
                  P + +  L+A IE+       +I  W   A+ A   P W+ D  + + + W P
Sbjct: 363 GDLPTTKPTQRVLTLMAAIERGLEAPDSEIRAWLAKAVVAPRGPQWVCDKCHTVHADWGP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYP--ADDLQSMLNNGKKNHLPSIKK 465
           +           W  P ++   +       +L +  P  A D + +     ++H   +  
Sbjct: 423 VCENCGAFDTLSWSEPRETDMKMPGGTRMDALLVGAPDIAPDREMVAEARAEDHEALVGG 482

Query: 466 VSSFEDST 473
               +++ 
Sbjct: 483 SDPADEAV 490


>gi|163732926|ref|ZP_02140370.1| hypothetical protein RLO149_09710 [Roseobacter litoralis Och 149]
 gi|161393461|gb|EDQ17786.1| hypothetical protein RLO149_09710 [Roseobacter litoralis Och 149]
          Length = 495

 Score =  468 bits (1204), Expect = e-129,   Method: Composition-based stats.
 Identities = 107/489 (21%), Positives = 191/489 (39%), Gaps = 28/489 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWILL- 58
           ++++I +   ++ +    + +      V +      +  SP   +++        W+ L 
Sbjct: 5   LIKIILFVVAVAALALGAVYLLESEGGVQVQVMGTEFTFSPIQSVIAAAVLVFAVWLFLK 64

Query: 59  -----FAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
                 A  RF       +     +    KG++AL  GLM++A+    +A  M   V  +
Sbjct: 65  LLSLLVACLRFLSGDETAISRYFDRSRERKGFQALSEGLMALASGEGRVA--MTKAVKAE 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
              +   L  LL  Q A        A E  + ++   ATR   V  +  +    GD ++A
Sbjct: 123 RYLNKPELTNLLVAQAAEMAGDRRKAEETYKKLVTTDATRFVGVRGIMKQKLADGDTDTA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
            + A KA  I P    V + +++     ++WS A   L+ K K          R  A+L 
Sbjct: 183 LQLAEKAFAIKPKHEEVQDVLLRLQAQKEDWSGARKTLSAKLKYGNLPRDVHKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ + +       I     AIE+ KL  + I A++ AA   + QN+ R A  +L+K W+V
Sbjct: 243 LSEAKDILSDQSSIDVQEKAIEANKLSPDLIPAAVMAAGGYVEQNRPRLAVRLLKKAWEV 302

Query: 290 NPHPEIANIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
           +PHP++A  +  +   E    ++KR + +  I  E+ E+ ++++++ +      +A    
Sbjct: 303 HPHPDLAAAFAAIEPNETPAERIKRFMAITRIKPENPETKMLLAELHIANEDFPEARRAL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLP 407
               +         L+A IE+        +  W   AL     P WI D+  ++   W P
Sbjct: 363 GDLAETDATARSVTLMAAIERGEGAPDTVVRGWLAKALTVSRGPQWICDNCQHIHQEWGP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVS 467
                ++     WK P  S             EMA P       L  G     P  K   
Sbjct: 423 FCENCESFDTLAWKAPPLS-------------EMAMPGGVQMLPLIVGALEEKPEEKTGD 469

Query: 468 SFEDSTIHP 476
             ED+ I P
Sbjct: 470 IIEDAEIIP 478


>gi|149204332|ref|ZP_01881299.1| HemY domain protein [Roseovarius sp. TM1035]
 gi|149142217|gb|EDM30264.1| HemY domain protein [Roseovarius sp. TM1035]
          Length = 490

 Score =  467 bits (1203), Expect = e-129,   Method: Composition-based stats.
 Identities = 96/485 (19%), Positives = 182/485 (37%), Gaps = 15/485 (3%)

Query: 2   LRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWIL--- 57
           +++  +  +++ V      +      V I         +P   ++++       W+L   
Sbjct: 6   IKIAVFIALVAGVTLGASFLLELDGGVRIVMAGVEINLTPIKAVIALGVLVFIIWLLMKL 65

Query: 58  ---LFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQH 114
              L A  +F       L     +   DKGY+AL  G++++A+    +A  M      + 
Sbjct: 66  TGLLVASLKFINGDETALSRYFDRSRQDKGYRALSEGMLALASGEGEVA--MAQVAKAEK 123

Query: 115 TFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQ 174
                 L  L+  Q A        A E  + +L    TR   V  +  +    GD  +A 
Sbjct: 124 YLRKPALTNLITAQAAEMAGNRRKAEEVYKQLLTNEKTRFVGVRGILRQKLAEGDTETAL 183

Query: 175 RYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLI 230
           + A  A  + P    V + ++       +W  A   LN K K          R  A+L +
Sbjct: 184 KLAKTAFALKPRHAEVQDTLLDLQAKTSDWKGARETLNAKLKYGSLPRDVHKRRDAVLAL 243

Query: 231 ARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
           + + +  D+G  I +   AIE+ +L  + I A++ AA+  I Q   R A  ++ K W V 
Sbjct: 244 SEARDVLDEGKTIEAREAAIEANRLSPDLIPAAVLAARGYIDQGNTRNALRVINKAWLVR 303

Query: 291 PHPEIANIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAM 349
           PHP++A  +  +   E+   +LKR  +L +++ E+ E+ ++ +++ L       A     
Sbjct: 304 PHPDLAAAFAAIEPNESPRQRLKRFAKLLKVHPENRETRLLEAELNLAAEDFPAARRALG 363

Query: 350 LAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISD-DGYLSSVWLPL 408
              ++ P      ++A IE+    +   +  W   AL A   P W+ D   ++ + W P 
Sbjct: 364 TLAEVEPDARALTIMAAIERGEGASDAVVKGWLARALSAPRGPQWVCDKCQHIHAEWAPA 423

Query: 409 SPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSS 468
                +     W+ P  SP    +      L +    +     +         +      
Sbjct: 424 CENCNSFDTLSWRAPPNSPIATPTGLEMLPLIVGALDEPNSEPVKTEDDTVPDAEIVEEE 483

Query: 469 FEDST 473
             D  
Sbjct: 484 HMDRA 488


>gi|254459948|ref|ZP_05073364.1| HemY domain protein [Rhodobacterales bacterium HTCC2083]
 gi|206676537|gb|EDZ41024.1| HemY domain protein [Rhodobacteraceae bacterium HTCC2083]
          Length = 494

 Score =  466 bits (1199), Expect = e-129,   Method: Composition-based stats.
 Identities = 105/490 (21%), Positives = 188/490 (38%), Gaps = 15/490 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLF------- 53
           +L+++ +  +I+ +      +        +  G   +  SP  I+  L   L        
Sbjct: 5   LLKVLVFVAIIAGLTLGAGYLMEMGGGAVVNMGGTEFSLSPLQIILGLVLLLVALWVFLK 64

Query: 54  AWILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
              LL AV  F       L     K    KGY+AL  G+M++A+ +      M      +
Sbjct: 65  LLSLLVAVLNFINGDETALSRYFSKNRERKGYQALSEGMMALASGDGSA--AMSKAAKAE 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  L  LL  Q A        A E  + +++  ATR   V  +  +    GD ++A
Sbjct: 123 KYLAKPELTNLLTAQAAEMAGDRRKAEETYKKLVKDEATRFVGVRGIMKQKLAEGDTDTA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
              A  A  + P      + +++     ++W+ A   L  K K+         R  A+L 
Sbjct: 183 LELAEHAFALKPKHEETQDILLKLQAQGQDWAGARKTLAAKLKSGSLPRDVHKRREAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           +++S    D+G    +   A E+ +L  + I A++ AA+S I Q+KKR A  +L+K W V
Sbjct: 243 LSQSKGVFDEGKDTEAREAATEANRLAPDLIPAAVMAARSYIEQDKKRYAVRVLKKAWDV 302

Query: 290 NPHPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHPE+A  Y  +  E T   ++KR   L + + +  E+ ++ +++ +       A    
Sbjct: 303 QPHPELAAAYAAIEPEETPVERIKRFANLTKSHADHAETKMLNAELNIAAEDFPAARRAM 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISD-DGYLSSVWLP 407
              +  AP      ++A IE+    +   +  W   AL A   P W+ D   ++ + W P
Sbjct: 363 GDLVDTAPDARSLTIMAAIERGEGASDAVVKGWLARALSAPRGPQWVCDACNHIHAEWEP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVS 467
           +     +     WK P  S     +      L +    D  +  + +      P     +
Sbjct: 423 VCGNCASFDTLSWKSPPVSEAVAPTGVAMLPLIVGALEDHSRVDVVDLDDIVEPEEVVDA 482

Query: 468 SFEDSTIHPL 477
                 I   
Sbjct: 483 EVVSEDIEDA 492


>gi|260429364|ref|ZP_05783341.1| HemY domain protein [Citreicella sp. SE45]
 gi|260419987|gb|EEX13240.1| HemY domain protein [Citreicella sp. SE45]
          Length = 514

 Score =  465 bits (1197), Expect = e-129,   Method: Composition-based stats.
 Identities = 98/499 (19%), Positives = 191/499 (38%), Gaps = 16/499 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWI---- 56
           +L++I +  V++ +      V      + IT G   +   P   +  +   + A      
Sbjct: 5   LLKIILFVAVVAALTLGAGYVMESHGGIQITAGGYEFNLGPLQSVIAVIVLVIALYVVFK 64

Query: 57  ---LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
              LL A+ +F       L     +    KGY AL  G++++++    LA  M       
Sbjct: 65  LVSLLIALLKFINGDDTALSRYFDRNRERKGYHALAEGMLALSSGEGKLA--MAKAQKAD 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
              H   L  LL  Q A        A E  + ++    TR   +  +       GD ++A
Sbjct: 123 RYLHRPALTNLLTAQAAEMTGDTRKAEEVYKKLIANDETRFVGIRGMMKLKLAKGDTDTA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
            + A +A  + P    + + ++Q      +W  A   L+ K K+       + R  A+L 
Sbjct: 183 LKLAERAFALKPKHAEIQDTLLQLQAQKHDWRGARQTLSAKLKHGALPRDVYRRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ + +   +   I +   AI S K   + I  +  AA+S I++ + +KA  +L+K W V
Sbjct: 243 LSEAKDIFAEDKPIEAREAAIASAKGSPDLIPGACMAARSYIAKGEPKKAVRVLKKTWSV 302

Query: 290 NPHPEIANIYTHLLSENT-VGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A  +  ++ + T   ++KR   L  +     E+ ++ +++AL      +A    
Sbjct: 303 EPHPDLAAAFAEIVPDETPAERMKRFRALTSLRVNHRETRLLKAELALAAEDFPEARRAL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISD-DGYLSSVWLP 407
              ++  P   +  ++A I +       ++  W   AL A   P W+ D   ++ + W+P
Sbjct: 363 GDLVETEPDARVLTIMAAIARGEGAGEAEVRGWLAKALVAPRGPQWVCDSCNHIHAEWVP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVS 467
           +           WK P +S + +        L +    D              P I   +
Sbjct: 423 ICENCGGFDTLSWKTPPQS-DAVPPGAEMLPLIVGAIDDKADEKSAAEAAAEAPEILTPN 481

Query: 468 SFEDSTIHPLDPHIRQPDD 486
              D+          + +D
Sbjct: 482 PPSDTGAAAATAPATEVED 500


>gi|254451402|ref|ZP_05064839.1| HemY domain protein [Octadecabacter antarcticus 238]
 gi|198265808|gb|EDY90078.1| HemY domain protein [Octadecabacter antarcticus 238]
          Length = 490

 Score =  463 bits (1192), Expect = e-128,   Method: Composition-based stats.
 Identities = 97/499 (19%), Positives = 192/499 (38%), Gaps = 28/499 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLF- 59
           +++++ +   +       I++       +I  G +    S   ++  L   + +  L+F 
Sbjct: 5   LVKILVFVAAVMAATFGAIMLLEMEGSATIDIGGQAASFSVIEMVIGLIVLVASIWLVFK 64

Query: 60  ------AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
                 A  +F       +     +    KGY+AL  G+M++A+    LA  M      +
Sbjct: 65  LIGLAIATFKFLNGDETAISRYFSRNRERKGYEALSEGMMALASGEGRLA--MAKANRAE 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  L  LL  Q A        A      +L+   TR   V  +  +  + GD ++A
Sbjct: 123 KFLERPELTNLLTAQAAELAGDRKTAELTYRKLLEDDKTRFVGVRGIMKQKLQDGDTDTA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILL 229
              A KA  I P      + +++      +W  A   L  K K  +       R  A+L 
Sbjct: 183 LLLAQKAFAIKPKHVETQDTLLRLQAEKSDWKGARETLTAKLKTGQLPRNVHRRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ + +   +G  + +   AIE+ ++  + + A++ AA++ +++N  R A  +++K W V
Sbjct: 243 LSEAKDVFAEGATLEAQEAAIEANRMSPDLVPAAVMAAQAHVAKNSSRAATRVIKKAWDV 302

Query: 290 NPHPEIANIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A+ +  +   E+   ++KR   L +++    E+ ++++++ +      +A    
Sbjct: 303 APHPDLASAFAAIAPDEDPAARVKRFSTLTKVHPNHPETRMLLAELNIAAEDFPEARRAI 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLP 407
              +   P      ++A IE+        +  W   AL A   P WI D+  ++  VW P
Sbjct: 363 TELVAKDPTARSLTIMAAIERGEGSADAVVRGWLAKALTATRGPQWICDNCQHIHPVWAP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVS 467
           +           W+ P K              E+A PA      L  G+         V 
Sbjct: 423 ICVNCSGFDTLAWREPPKG-------------EVAMPAGVEMLPLIVGQVESPSDTLDVE 469

Query: 468 SFEDSTIHPLDPHIRQPDD 486
             E   +      +   DD
Sbjct: 470 IVEAEIVEDDGAIVSSTDD 488


>gi|86136714|ref|ZP_01055292.1| HemY domain protein [Roseobacter sp. MED193]
 gi|85826038|gb|EAQ46235.1| HemY domain protein [Roseobacter sp. MED193]
          Length = 503

 Score =  463 bits (1192), Expect = e-128,   Method: Composition-based stats.
 Identities = 110/498 (22%), Positives = 212/498 (42%), Gaps = 24/498 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-------VILSILYFFLF 53
           +L+++ +  +++L+     I+      V IT     Y            V++  ++ FL 
Sbjct: 5   LLKILVFVALVALIAFGAGILMETAGGVQITVAGTEYTLGALQSVLALGVLVLSVWIFLK 64

Query: 54  AWILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
              LL A  +F       +     K    KGY+AL  G+M++A+    LA  +       
Sbjct: 65  LLTLLVATLKFLNGDETAMSRYFDKGRERKGYQALSDGMMALASGEGRLA--LTKASKAA 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
               N  L  LL  Q A      + A E  + +L    TR   V  +  +    GD ++A
Sbjct: 123 RYLDNPQLTDLLTAQAAEMAGDTHKAAEAYKRLLSDQTTRFVGVRGIMKQKLSEGDKDTA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
            + A KAL + P    V + ++Q    A++W+ A   L+ K K+       + R  A+L 
Sbjct: 183 LQLAEKALALRPKHEEVQDTLLQLQAQAEDWAGARKTLSAKLKSGSLPRDVFKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ S E AD+   +     AIE+ +L  + + A+  AA++ + Q KKR A  +L+K W+ 
Sbjct: 243 LSASREVADEAASLEQREQAIEANRLSPDLVPAAAMAARAYLEQGKKRNAIKVLKKAWEA 302

Query: 290 NPHPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A+++  +  E T   ++KR  +L  +  +  E+ ++++++ +      +A    
Sbjct: 303 QPHPDLAHVFAEVEPEETAPQRVKRFDQLARLKPQDDETRLVMAELHIVAEDFPEARRAL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLP 407
              ++ AP   +  L+A IE+    +      W   AL A   P W+  +  ++ + W P
Sbjct: 363 GDLVERAPDARVLTLMAAIEKGEGADNAVTQAWLARALTAPRGPQWLCTNCNHIHAEWAP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVS 467
           +     +     W+ P ++PE  S+  ++    +        S  +      +  ++   
Sbjct: 423 VCEHCTSFDTLSWQRP-ETPEVASATGVHMLPLITGATAAADSASDAVVVQDIVDVED-- 479

Query: 468 SFEDSTIHPLDPHIRQPD 485
                 I P+ P  +  D
Sbjct: 480 ------IEPVSPEGQASD 491


>gi|56698662|ref|YP_169039.1| HemY domain-containing protein [Ruegeria pomeroyi DSS-3]
 gi|56680399|gb|AAV97065.1| HemY domain protein [Ruegeria pomeroyi DSS-3]
          Length = 493

 Score =  463 bits (1191), Expect = e-128,   Method: Composition-based stats.
 Identities = 101/495 (20%), Positives = 195/495 (39%), Gaps = 15/495 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-------VILSILYFFLF 53
           ML+++ +  +I+L+      +      V IT     Y   P        +++  ++ F  
Sbjct: 1   MLKILVFVAIIALLALGAGFLMEASGGVQITVAGTEYTLGPLQSVIGFGLLVVAVWLFFK 60

Query: 54  AWILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
              LL A  +F       L     +    +GY+AL  GLM++A+    LA  M      +
Sbjct: 61  LLTLLIATLKFLNGDETALSRYFDRGRERRGYQALTEGLMALASGEGRLA--MAKAARAE 118

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  L  LL  Q A        A E    ++   +TR   V  +  +    GD  +A
Sbjct: 119 KLLQKPELTNLLVAQAAEMTGDTKKAAETYRKLVTDQSTRFVGVRGIMKQKLAEGDDETA 178

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
           ++ A KAL + P      + ++     A++W+ A   L  K K        + R  A+L 
Sbjct: 179 RKLAEKALALKPRHEETQDVLLTLQTRAQDWAGARATLTSKLKTGTLPRDVYKRRDAVLA 238

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ + +   +   +     AIE+ +L  + I A+  AA++ I++ K + A  IL K W+V
Sbjct: 239 LSEARDLLSETASLDQQERAIEANRLSPDLIPAAAMAARAHIAKGKPKNAAKILTKAWQV 298

Query: 290 NPHPEIANIYTHLLSENT-VGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A+ +  +  + T   ++KR   L + + +  E+ ++++++ +      +A    
Sbjct: 299 QPHPDLAHAFAEIAPDETPAARIKRFAALAKAHPQHAETRLMMAELNIVAEDFPEARRAL 358

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLP 407
              +  AP    + L+A IE+    +   +  W   AL A   P W+ D+  ++ + W P
Sbjct: 359 GDLLDHAPDARAYTLMAAIERGEGASDAVVQGWLARALTAPRGPQWVCDNCQHIHAAWAP 418

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVS 467
           +     +     W+ P  +     +      L +         +     +    S   V 
Sbjct: 419 VCGNCNSFDTLSWRAPQDTDAGAMTTANMLPLIVGAIEQKAPDVEEVDFETDADSDDSVE 478

Query: 468 SFEDSTIHPLDPHIR 482
                     +P  R
Sbjct: 479 GTAKEVDGANEPVSR 493


>gi|260431926|ref|ZP_05785897.1| HemY domain protein [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415754|gb|EEX09013.1| HemY domain protein [Silicibacter lacuscaerulensis ITI-1157]
          Length = 506

 Score =  463 bits (1191), Expect = e-128,   Method: Composition-based stats.
 Identities = 102/502 (20%), Positives = 212/502 (42%), Gaps = 17/502 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILL-- 58
           +L+++ +  ++ L+      +      V IT        SP   +  L   +FA  L   
Sbjct: 5   LLKILVFVVIVGLLAMGAGYLMESSGGVQITALGLEITLSPLQSVIALGVLVFAVWLGLK 64

Query: 59  -----FAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
                 A  +F       L     +    +GY+AL  GLM++A+    +A  +      +
Sbjct: 65  LLGLLIATLKFINGDETALSRYFDRSREQRGYQALADGLMALASGEGRIA--LTKARKAE 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
              +   L  LL  Q A        A E  + ++  PATR   V  +  +    GD ++A
Sbjct: 123 KLLNKPELTNLLVAQAAEMTGDTKKAAETYKKLVSDPATRFVGVRGILKQKLAEGDEDTA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
           ++ A KAL + P      + +++    A++W+ A + L  K K        + R  A+L 
Sbjct: 183 RKLAEKALQLKPRHEETQDVLLKLQTKAQDWAGARSTLTAKLKAGYLPRDVYRRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ + +  D+   +     AIE+ +L  + + A+  AA++ I++ K R A  IL+K W+ 
Sbjct: 243 LSEAKDILDESATVEQQERAIEANRLSPDLVPAAAMAARAYIAKGKPRAATKILKKAWEA 302

Query: 290 NPHPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A+ +  ++ + T   ++KR   L  I+ +  E+ +I +++ +      +A    
Sbjct: 303 QPHPDLAHAFAEIVPDETPEERIKRFATLTRIHPDHPETRLIRAELNIVAEDFPEARRAL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGY-LSSVWLP 407
              ++       + L+A IE+    +   +  W   AL+A   P W+ ++ + + + W P
Sbjct: 363 GDLVEKGADARAYTLMAAIERGEGASDAVVQGWLAKALNAPRGPQWVCENCHDIHAEWAP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVS 467
           +     +     W+ P K+PE  ++  ++    +    +D    +   +     + + + 
Sbjct: 423 VCSTCHSFDTLSWQRP-KTPEIATATGVHMLPLIVGALEDQSDEVEEAEIEDAEAPEVIE 481

Query: 468 SFEDSTIHPLDPHIRQ-PDDPG 488
              +    P +   +  P+D G
Sbjct: 482 PEPEGAAAPDEAGAKPVPEDTG 503


>gi|90421076|ref|ZP_01228979.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90334711|gb|EAS48488.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 541

 Score =  462 bits (1189), Expect = e-128,   Method: Composition-based stats.
 Identities = 132/431 (30%), Positives = 220/431 (51%), Gaps = 8/431 (1%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ +  V+      F  ++  P  V+  W  +   TS  V L  L   +FA +L+  
Sbjct: 1   MLRILAFLLVVLAAGIGFAWLADNPGSVTFVWQGQQVGTSLMVFLIGLGVLIFAVLLVVW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R F   P  + +       D+GYKAL +G+++  A +  LAR+M     +      E 
Sbjct: 61  LVRAFFKTPGAIGNWWSTSRRDRGYKALSSGIIAAGAGDAVLARRMTKRSDKLLGTRREP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+  L+ Q A+ E  +  A    E M + P TR  A+  L+ E+ R+GD ++A+ YA +A
Sbjct: 121 LIRFLDAQTAMIEGDHARARSAFEQMERDPETRLLALRGLFLEAERVGDESAARHYAERA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQK----KKNAKEWNRNRAILLIARSLEN 236
           + I+P  PW   AV++   LA +W  A+  L+ +      +  E  R RA+LL A+++  
Sbjct: 181 VRIAPHVPWAGGAVLESKCLAGDWDGALAILDAQKNTRLVDRDESKRMRAVLLTAKAMTL 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
           +++ D   +    +E+ KL  +   A++ AA++L      R+   +LE  W   PHP+IA
Sbjct: 241 SER-DPAGAKTAGLEAQKLAPDLPPAALVAAEALFRLGDLRRGSKVLETSWISQPHPDIA 299

Query: 297 NIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             Y H    ++   +LKRA +L  ++    E+ + +++ AL+ G  D A   AM A    
Sbjct: 300 EAYVHARPGDSPEDRLKRARKLHGLHSG-AEAEMSLARAALDAGEFDLARKSAMAAADAE 358

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  +LLLA IE+A +    ++  W   A+ A  DP W + DG +S  W P+SP++  L
Sbjct: 359 PRESTYLLLADIEEAQTGEVGRVREWLGRAIRAPRDPAWTA-DGVVSRNWAPISPVTGRL 417

Query: 416 CYFEWKIPTKS 426
             FEWK+P + 
Sbjct: 418 DAFEWKVPVER 428


>gi|146278943|ref|YP_001169102.1| HemY domain-containing protein [Rhodobacter sphaeroides ATCC 17025]
 gi|145557184|gb|ABP71797.1| HemY domain protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 482

 Score =  462 bits (1188), Expect = e-128,   Method: Composition-based stats.
 Identities = 99/480 (20%), Positives = 191/480 (39%), Gaps = 17/480 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWILL- 58
           +++++ +  ++  +     ++      + +  GN      P   +++ L      W+ L 
Sbjct: 5   LIKILIFVALVVGLTFGASMLMESGGALRLAVGNLELNLGPLQAVIAALLLIFTVWLFLK 64

Query: 59  -----FAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
                FAV RF       +     +    KG +AL  G+M++AA    +A  M      +
Sbjct: 65  IMGFLFAVLRFLNGDETAVSRYFDRSREQKGLRALSEGMMALAAGEPRMA--MSRASKAR 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  +  LL  Q A        A E  +++LQ   T+   +  L  +    GD  +A
Sbjct: 123 KYLGQNAMTTLLNAQAAQQAGDSRRAQESYKLLLQDERTKFVGIRGLLKQKLDEGDTETA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
              A KA +I+P      + +++      +WS A + L  K K+       + R  A+L 
Sbjct: 183 LALAQKAFEINPKHSETQDILLKLQADRHDWSGARSTLTAKMKSGALPKAVYKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           +  + +  D+   I +   AI + K   + I A+  AA+S ++Q  K+ A  +L+K W+ 
Sbjct: 243 LQTAKDVFDENASIEAREAAILANKQSPDLIPAAAMAARSYLAQGNKKYATRVLKKAWEA 302

Query: 290 NPHPEIANIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A  +  +   E  V +LKR   L  IN +  ES ++ ++++L       A    
Sbjct: 303 EPHPDLAAAFAEIEPNETPVERLKRFRTLTSINPDHEESRLLTAELSLAAEDFPAARRAL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLP 407
              +   P +    ++A +E+    +   +  W   AL A   P W  D+   + + W P
Sbjct: 363 GDIVSRHPTQRSLTIMAAVERGEGGDEAVVRGWLARALSAPRGPQWCCDNCQTVHANWAP 422

Query: 408 LSPISKTLCYFEWKIPTK--SPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKK 465
           +           W+ PT+  +P    +E +   +     A       +   +  +    K
Sbjct: 423 ICDNCGGFDTLSWREPTRKSTPSATGTELLPLIVGAPAAAQAAAVDDDVIDEKAVEPASK 482


>gi|126734495|ref|ZP_01750242.1| hypothetical protein RCCS2_10049 [Roseobacter sp. CCS2]
 gi|126717361|gb|EBA14225.1| hypothetical protein RCCS2_10049 [Roseobacter sp. CCS2]
          Length = 457

 Score =  462 bits (1188), Expect = e-128,   Method: Composition-based stats.
 Identities = 89/450 (19%), Positives = 167/450 (37%), Gaps = 15/450 (3%)

Query: 22  SHYPEDVSITWGNRLYRTSPFVILSILYFFLFA-------WILLFAVSRFFLSCPAMLFH 74
                  ++    + +  S   ++  L   + A         L  A  +F       +  
Sbjct: 1   MEVDGGATVDVAGQEFTLSTLEMVFALGALVVAVWLGLKLLALCVATFKFLNGDETAISR 60

Query: 75  MLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAER 134
              +    KGY+AL  G+M++A+    LA  M              L  LL  Q A    
Sbjct: 61  YFDRNRERKGYEALSEGMMALASGEGHLA--MTKAARADKYLQQPQLTNLLTAQAAEMTG 118

Query: 135 QYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAV 194
               A E  + +L    TR   V  +  +    GD ++A   A KA  + P      + +
Sbjct: 119 DRKTAEETYKKLLSDDKTRFVGVRGIMKQKLSDGDTDTAMALAQKAFALKPKHEETQDVL 178

Query: 195 VQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLIARSLENADKGDMIASYHDAI 250
           ++      +W+ A   L  K K+         R  A+L ++ + +  D+G  I +   AI
Sbjct: 179 LRLQAEKSDWAGARKTLGAKLKSGSLPRDVHKRRDAVLALSEARDILDEGKTIEAREAAI 238

Query: 251 ESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVG- 309
           E+ +L  + I A+I AA+  I +   R A  +L K+W   PHP+IA  +  +  + +   
Sbjct: 239 EANRLSPDLIPAAIMAARGYIGEGNARYATRVLTKVWNAQPHPDIAAAFAEIAPDESSDE 298

Query: 310 KLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQ 369
           +LKR  +L +   +  E+ ++++++ +       A       ++  P      ++A IE+
Sbjct: 299 RLKRFTKLTKTTADHPETKMLMAELHIAAEDFPAAKRALGELVEKDPTARNLTIMAAIER 358

Query: 370 ANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLPLSPISKTLCYFEWKIPTKSPE 428
               +   +  W   AL A   P WI  +  ++   W        +     WK P  S  
Sbjct: 359 GEGADDSVVRGWLTKALTAPRGPQWICGNCQHIHPTWAATCDNCGSFDTLAWKTPPASDV 418

Query: 429 YISSENINFSLEMAYPADDLQSMLNNGKKN 458
            + +      L +    +         ++ 
Sbjct: 419 AMPAGTEMLPLIVGQTKEAQLPSTEVVEEA 448


>gi|222087479|ref|YP_002546016.1| hypothetical protein Arad_4359 [Agrobacterium radiobacter K84]
 gi|221724927|gb|ACM28083.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 532

 Score =  461 bits (1187), Expect = e-128,   Method: Composition-based stats.
 Identities = 173/519 (33%), Positives = 264/519 (50%), Gaps = 31/519 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RL+ +  ++  +   F  ++  P D+S+ W  +LY+T   V   IL   + A ++++ 
Sbjct: 1   MIRLLIFALLVLALGYGFSWLADRPGDLSLVWEGQLYQTKLIVAAGILIALVAATMIVWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
             R   + P  +      R  D+GY+AL TGL++  A N  LARKM +          E 
Sbjct: 61  FIRLIWNSPHSVTRYFRARKRDRGYQALSTGLIAAGAGNALLARKMAARTRGLIRADQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q AL E +++ A +K E+M   P TRE  +  LY E+ R+G   +A++YA KA
Sbjct: 121 LINLLEAQAALIEGKHDEARQKFELMANDPETRELGLRGLYLEAKRLGANEAARQYAEKA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKK----KNAKEWNRNRAILLIARSLEN 236
            D +P  PW  +A ++    A  W  AI  L+Q+K     + +  NR RA+LL AR+ + 
Sbjct: 181 ADHAPYLPWAAQATLEYRSQAGNWDDAIKLLDQQKVAHVVDKETANRQRAVLLTARANDK 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            +  D   +  DA+ +LKL  + + A++ AAK+L  ++K RKA  +LE++WK  PHPEI 
Sbjct: 241 LE-SDPAGARDDALAALKLSADFVPAALTAAKALFREDKVRKAASMLEQVWKAKPHPEIG 299

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             Y    S ++V  +LKRA RLE I   +VE+L++ +K AL+     +A AKA  A +I 
Sbjct: 300 KAYVRARSGDSVTDRLKRAERLEAIRPNNVEALLVTAKAALDAHDFAKARAKAEAAARID 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
            R+  FLLLA IE+A +++  ++ +W   AL A  DP W++ DG++S  WLPLSPI+  L
Sbjct: 360 AREGAFLLLADIEEAETNDQGRVRHWMAQALRAPRDPAWVA-DGFVSDKWLPLSPITGRL 418

Query: 416 CYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDST-- 473
             FEWK P    E    E    S++ A  +                +   V+S    T  
Sbjct: 419 DAFEWKAPFGQIEGPLEEGTAVSVDAALKSLPPMREATPATAAAKATSPIVASPTTRTSV 478

Query: 474 ----------------------IHPLDPHIRQPDDPGIK 490
                                   P       PDDPG+K
Sbjct: 479 IELEPIAAKPATAAAATEPAKEPEPRPFFGGAPDDPGVK 517


>gi|319404858|emb|CBI78459.1| conserved exported hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 514

 Score =  460 bits (1185), Expect = e-127,   Method: Composition-based stats.
 Identities = 132/480 (27%), Positives = 214/480 (44%), Gaps = 10/480 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R+  Y FV+ ++   F   ++    + IT+    +  S   I+S +   L   + L+ 
Sbjct: 1   MIRIFIYIFVVCVIGAVFSWGANNNSFLVITFLQMRFTVSLLTIISGIVILLMVLVFLWK 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
             R   S P  L+     R  + G KAL  GL++  A +   A+KM     +      E 
Sbjct: 61  FFRIIFSIPRTLYSFFSGRYQECGRKALTQGLLAAFAGDYAAAQKMERRALKYFIKDYEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LL  QI   ++    A    E M +  +T+   +Y L+ E+      + AQ YA +A
Sbjct: 121 LIKLLRAQILSLQKNSMKAIALYEEMQKDESTKLAGLYGLFREAMNTKAYDVAQHYAEEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNR---NRAILLIARSLENA 237
           LD+SP   W  + V+ +     +W++A+    + ++           R           A
Sbjct: 181 LDLSPALLWAQQFVLDRLSAEGQWNKALDVFYRAQRALPRSEHCTSERKYTHALLLSGLA 240

Query: 238 D---KGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPE 294
               +  +  +    +++ KL  + +  ++     L    + RKA+ I+ K W+ NPHP+
Sbjct: 241 LHLTETQLAGARKAILKAHKLMPDFVPITVLMVDILYQLKEVRKADKIIIKAWQENPHPD 300

Query: 295 IANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKI 354
           +  +Y     E+ VG+LKRA  L   NKE  ES  IV+K AL+ G ++ A   A  A+  
Sbjct: 301 LGALYLR-REESAVGRLKRAKTLAFYNKEIFESAFIVAKAALDAGELELAREYAQKALTY 359

Query: 355 APRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKT 414
            PR+ ++LLLA IE+A  +       W   AL A PDP W   DG   S WL +SPIS  
Sbjct: 360 HPRESVYLLLADIEEAKGNGQG-SRQWLSLALRAEPDPAWAC-DGSFFSSWLIVSPISGR 417

Query: 415 LCYFEWKIPTK-SPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDST 473
           L   EWK+P + SP  +  +N+    E      D + ++ N       SI      +  T
Sbjct: 418 LGRCEWKVPPRCSPITLEVDNVMLKRECKKGVVDEKGVIKNKSFEEKSSIGPDFLLKSRT 477


>gi|86359488|ref|YP_471380.1| hypothetical protein RHE_CH03907 [Rhizobium etli CFN 42]
 gi|86283590|gb|ABC92653.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 535

 Score =  460 bits (1185), Expect = e-127,   Method: Composition-based stats.
 Identities = 165/523 (31%), Positives = 260/523 (49%), Gaps = 34/523 (6%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RL+ +   + L+   F   +  P D+S+ W  ++Y+T   V +S +   + A ++++ 
Sbjct: 1   MIRLVVFALFVLLLAYGFSWFADRPGDLSLIWEGQIYQTKLIVAVSAIIALIAAVMIVWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
             R   + P  +      R  D+GY+AL TGL++  A N  LARKM +          E 
Sbjct: 61  FVRLIWTSPHSVTRYFRARKRDRGYQALSTGLIAAGAGNALLARKMAARSRGLIRADQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q AL E +++ A  K E M   P TRE  +  LY E+ R+G   +A++YA KA
Sbjct: 121 LINLLEAQAALIEGRHDEARAKFEAMANDPETRELGLRGLYLEARRLGANEAARQYAEKA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLEN 236
            D +P  PW  +A ++    A  W  AI  L Q+K        E NR  A+LL AR+ E 
Sbjct: 181 ADNAPYLPWAAQATLEYRSQAGRWDDAIRLLEQQKAARVVEKAEANRLLAVLLTARAAEK 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            + G+   +  DA+++LKL  + + A++ AAK+L  +   RKA  ILE+ WK  PHPEI 
Sbjct: 241 LE-GNPAGARDDALQALKLAVDLVPAALIAAKALFREGGLRKAASILEQAWKSAPHPEIG 299

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             Y      ++T+ +LKRA RLE +   +VESL++V++ AL+     +A +KA  A +I 
Sbjct: 300 QTYVRARSGDSTLDRLKRAERLEALRPNNVESLLVVAQAALDAQEFAKARSKAEAAARIE 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  FLLLA IE+A + +  ++ +W   AL A  DP W++ DG++S  WLP+SP++  +
Sbjct: 360 PREAAFLLLADIEEAETGDQGRVRHWLAQALKAPRDPAWVA-DGFVSDKWLPVSPVTGRI 418

Query: 416 CYFEWKIPTKSPEYISSENINFSLEMAYPA----------------------DDLQSMLN 453
             FEWK P    E    +    +                             +   ++  
Sbjct: 419 DAFEWKAPFGQIEGPLEDGSAPAAIETALKTLPPLRDVRPESPVNDHRIIELERAATIAE 478

Query: 454 NGKKNHLPSIKKVSSFEDSTIHPLDPHIRQ-----PDDPGIKE 491
             +    P+  K      S   P     +      PDDPG+++
Sbjct: 479 AVRPAPAPAKPKSVESTASDKAPAPNEAKPFFGGLPDDPGVRD 521


>gi|221640998|ref|YP_002527260.1| HemY domain-containing protein [Rhodobacter sphaeroides KD131]
 gi|221161779|gb|ACM02759.1| HemY domain protein precursor [Rhodobacter sphaeroides KD131]
          Length = 478

 Score =  460 bits (1183), Expect = e-127,   Method: Composition-based stats.
 Identities = 97/467 (20%), Positives = 189/467 (40%), Gaps = 15/467 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWILL- 58
           M++++ +  ++  +      +      + +  G+      P   +++ L   L  W+ L 
Sbjct: 1   MIKILIFVALVVALTFGASQLMESGGALRLAVGDLELNLGPLQAVIAALLLILAVWLFLK 60

Query: 59  -----FAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
                FAV RF       +     +    KG +AL  G+M++AA     A  M      +
Sbjct: 61  IVGFLFAVLRFLNGDETAVSRYFDRSREQKGLRALSEGMMALAAGEPRTA--MSRAAKAR 118

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  +  LL  Q A        A E  +++L+   TR   V  L  +    GD  +A
Sbjct: 119 KYLGQNAMTTLLNAQAAQQAGDSRRAQESYKLLLEDERTRFVGVRGLLKQKLDEGDTETA 178

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
              A KA +I+P      + +++      +WS A + L+ K K+       + R  A+L 
Sbjct: 179 LALAQKAFEINPKHSETQDILLKLQADLHDWSGARSTLSAKMKSGALPKAVYKRRDAVLA 238

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           +  + +  D+   I +   AI + K   + I A+  AA+S ++Q  K+ A  +L+K W+ 
Sbjct: 239 LQTAKDVFDENASIEAREAAILANKQSPDLIPAAAMAARSYLAQGNKKYATRVLKKAWEA 298

Query: 290 NPHPEIANIYTHLLSENT-VGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A  +  +  + T   +LKR   L  I+ +  E+ +++++++L       A    
Sbjct: 299 EPHPDLAAAFAEIEPDETPAERLKRFRTLTAIHPDHDETRMLIAELSLAAEDFPGARRAL 358

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLP 407
              +   P +    ++A +E+    +   +  W   AL A   P W  D+   + + W P
Sbjct: 359 GDIVARHPTQRALTIMAAVERGEGGDEAVVRGWLARALTAPRGPQWCCDNCQTVHATWAP 418

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNN 454
           +           W+ PT+     ++      L +  PA      ++ 
Sbjct: 419 ICDNCGGFDTLSWREPTQKSTPSATGTELLPLIVGAPAARPADPMDE 465


>gi|319407818|emb|CBI81471.1| conserved exported hypothetical protein [Bartonella sp. 1-1C]
          Length = 514

 Score =  459 bits (1182), Expect = e-127,   Method: Composition-based stats.
 Identities = 129/480 (26%), Positives = 212/480 (44%), Gaps = 10/480 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R+  Y FV+ ++   F   ++    + IT+    +  S   I+S L   L   + L+ 
Sbjct: 1   MIRIFIYIFVVCVIGAIFSWGANNNSFLVITFLQMRFTVSLLTIISGLVILLMVLVFLWK 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
             R   S P  L+     R  + G KAL  GL++  A +   A+KM     +      E 
Sbjct: 61  FFRIIFSIPRTLYRFFSGRYQECGRKALTQGLLAAFAGDYAAAQKMERRALKYLIKDYEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LL  QI   ++    A    E M +   T+   +Y L+ E+      + A+ YA +A
Sbjct: 121 LIKLLRAQILSLQKNSMKAIALYEEMQKDEPTKLAGLYGLFREAMNTKAYDVAKHYAEEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNR---NRAILLIARSLENA 237
           L +SP   W  + V+ +     +W++A+    + ++           R           A
Sbjct: 181 LALSPALLWAQQFVLDRLSAEGQWNKALDVFYRAQRALPRSEHCNSERNYTHALLLSGLA 240

Query: 238 D---KGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPE 294
               +  +  +    +++ KL  + +  ++     L    + RKA+ ++ K W+ NPHP+
Sbjct: 241 LHLTETKLAEARKAILKAHKLMPDFVPITVIMIDILYQLKEVRKADKMIIKAWQENPHPD 300

Query: 295 IANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKI 354
           +  +Y     E+ VG+LKRA  L   NK+  ES  IV+K AL+ G ++ A   A  A+  
Sbjct: 301 LGALYLR-REESAVGRLKRAKALASYNKDIFESAFIVAKAALDAGELELAREYAQKALTY 359

Query: 355 APRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKT 414
            PR+ ++LLLA IE+A  +       W   AL A PDP W   DG   S WL +SPIS  
Sbjct: 360 HPRESVYLLLADIEEAQGNGQGN-RQWLSLALRAEPDPAWAC-DGSFFSSWLIVSPISGR 417

Query: 415 LCYFEWKIPTK-SPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDST 473
           L   EWK+P + SP  +  +N+    E      D + ++ N       SI      +  T
Sbjct: 418 LGRCEWKVPPRCSPITLEVDNVMLKRECKKGVVDEKEVIKNKSFEEKSSIGPDFLLKSRT 477


>gi|77462046|ref|YP_351550.1| hypothetical protein RSP_1508 [Rhodobacter sphaeroides 2.4.1]
 gi|77386464|gb|ABA77649.1| Uncharacterized HemY-like membrane protein [Rhodobacter sphaeroides
           2.4.1]
          Length = 482

 Score =  458 bits (1179), Expect = e-127,   Method: Composition-based stats.
 Identities = 96/467 (20%), Positives = 190/467 (40%), Gaps = 15/467 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWILL- 58
           +++++ +  ++  +      +      + +  G+      P   +++ L   L  W+ L 
Sbjct: 5   LIKILIFVALVVALTFGASQLMESGGALRLAVGDLELNLGPLQAVIAALLLILAVWLFLK 64

Query: 59  -----FAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
                FAV RF       +     +    KG +AL  G+M++AA     A  M      +
Sbjct: 65  IVGFLFAVLRFLNGDETAVSRYFDRSREQKGLRALSEGMMALAAGEPRTA--MSRAAKAR 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  +  LL  Q A        A E  +++L+   TR   V  L  +    GD ++A
Sbjct: 123 KYLGQNAMTTLLNAQAAQQAGDSRRAQESYKLLLEDERTRFVGVRGLLKQKLDEGDTDTA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
              A KA +I+P      + +++      +WS A + L+ K K+       + R  A+L 
Sbjct: 183 LALAQKAFEINPKHSETQDILLKLQADLHDWSGARSTLSAKMKSGALPKAVYKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           +  + +  D+   I +   AI + K   + I A+  AA+S ++Q  K+ A  +L+K W+ 
Sbjct: 243 LQTAKDVFDENASIEAREAAILANKQSPDLIPAAAMAARSYLAQGNKKYATRVLKKAWEA 302

Query: 290 NPHPEIANIYTHLLSENT-VGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A  +  +  + T   +LKR   L  I+ +  E+ +++++++L       A    
Sbjct: 303 EPHPDLAAAFAEIEPDETPAERLKRFRTLTAIHPDHDETRMLIAELSLAAEDFPGARRAL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLP 407
              +   P +    ++A +E+    +   +  W   AL A   P W  D+   + + W P
Sbjct: 363 GDIVARHPTQRALTIMAAVERGEGGDEAVVRGWLARALTAPRGPQWCCDNCQTVHATWAP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNN 454
           +           W+ PT+     ++      L +  PA      ++ 
Sbjct: 423 ICDNCGGFDTLSWREPTQKSTPSATGTELLPLIVGAPAARPADPMDE 469


>gi|126460935|ref|YP_001042049.1| HemY domain-containing protein [Rhodobacter sphaeroides ATCC 17029]
 gi|126102599|gb|ABN75277.1| HemY domain protein [Rhodobacter sphaeroides ATCC 17029]
          Length = 482

 Score =  458 bits (1179), Expect = e-126,   Method: Composition-based stats.
 Identities = 96/467 (20%), Positives = 189/467 (40%), Gaps = 15/467 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWILL- 58
           +++++ +  ++  +      +      + +  G+      P   +++ L   L  W+ L 
Sbjct: 5   LIKILIFVALVVALTFGASQLMESGGALRLAVGDLELNLGPLQAVIAALLLILAVWLFLK 64

Query: 59  -----FAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
                FAV RF       +     +    KG +AL  G+M++AA     A  M      +
Sbjct: 65  IVGFLFAVLRFLNGDETAVSRYFDRSREQKGLRALSEGMMALAAGEPRTA--MSRAAKAR 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  +  LL  Q A        A E  +++L+   TR   V  L  +    GD  +A
Sbjct: 123 KYLGQNAMTTLLNAQAAQQAGDSRRAQESYKLLLEDERTRFVGVRGLLKQKLDEGDTETA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
              A KA +I+P      + +++      +WS A + L+ K K+       + R  A+L 
Sbjct: 183 LALAQKAFEINPKHSETQDILLKLQADLHDWSGARSTLSAKMKSGALPKAVYKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           +  + +  D+   I +   AI + K   + I A+  AA+S ++Q  K+ A  +L+K W+ 
Sbjct: 243 LQTAKDVFDENASIEAREAAILANKQSPDLIPAAAMAARSYLAQGNKKYATRVLKKAWEA 302

Query: 290 NPHPEIANIYTHLLSENT-VGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A  +  +  + T   +LKR   L  I+ +  E+ +++++++L       A    
Sbjct: 303 EPHPDLAAAFAEIEPDETPAERLKRFRTLTAIHPDHDETRMLIAELSLAAEDFPGARRAL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLP 407
              +   P +    ++A +E+    +   +  W   AL A   P W  D+   + + W P
Sbjct: 363 GDIVARHPTQRALTIMAAVERGEGGDEAVVRGWLARALTAPRGPQWCCDNCQTVHATWAP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNN 454
           +           W+ PT+     ++      L +  PA      ++ 
Sbjct: 423 ICDNCGGFDTLSWREPTQKSTPSATGTELLPLIVGAPAARPADPMDE 469


>gi|85705790|ref|ZP_01036887.1| HemY domain protein [Roseovarius sp. 217]
 gi|85669780|gb|EAQ24644.1| HemY domain protein [Roseovarius sp. 217]
          Length = 490

 Score =  458 bits (1178), Expect = e-126,   Method: Composition-based stats.
 Identities = 96/482 (19%), Positives = 180/482 (37%), Gaps = 15/482 (3%)

Query: 2   LRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILL--- 58
           +++  +  +++ V      +      V I         +P   +  L   +FA  LL   
Sbjct: 6   IKIAVFIALVAGVTLGASFLLELDGGVRIVMAGVEINLTPIKAVIALGVLVFAIWLLMKL 65

Query: 59  ----FAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQH 114
                A  +F       L     +   DKGY+AL  G++++A+    +A  M      + 
Sbjct: 66  TGLLVASLKFINGDETALSRYFDRSRQDKGYRALSEGMLALASGEGEVA--MAQAAKAEK 123

Query: 115 TFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQ 174
                 L  L+  Q A      + A E  + +L    TR   V  +  +    GD  +A 
Sbjct: 124 YLRKPALTNLITAQAAEMAGNRSKAEEVYKRLLTNEKTRFVGVRGILRQKLAEGDTETAL 183

Query: 175 RYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLI 230
           + A  A  + P    V + ++       +W  A   LN K K          R  A+L +
Sbjct: 184 KLAKTAFTLKPRHAEVQDTLLDLQAKTSDWKGARETLNAKLKYGNLPRDVHKRRDAVLAL 243

Query: 231 ARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
           + + +  D+G  I +   AIE+ +L  + I A++ AA+  I Q   R A  ++ K W V+
Sbjct: 244 SEARDVLDEGKTIEAREAAIEANRLSPDLIPAAVLAARGYIDQGNTRNALRVINKAWLVH 303

Query: 291 PHPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAM 349
           PHP +A ++  +  + T   +LKR  +L +++ +  E+ ++ +++ L       A     
Sbjct: 304 PHPNLAAVFAAIEPDETPNQRLKRFAKLLKVHPDHRETRLLAAELNLAAEDFPAARRALG 363

Query: 350 LAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISD-DGYLSSVWLPL 408
              ++ P      ++A IE+        +  W   AL A   P W+ D   ++   W P 
Sbjct: 364 NLAEVEPDARAVTIMAAIERGEGAPDAVVKGWLARALSAPRGPQWVCDKCQHIHVEWSPT 423

Query: 409 SPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSS 468
                +     W+ P  S     +      L +    +  +          + +      
Sbjct: 424 CENCNSFDTLSWRAPPNSTIATPTGLEMLPLIVGALDEPHKEAAKEMDDTVVDAEIVAEE 483

Query: 469 FE 470
            E
Sbjct: 484 DE 485


>gi|126738548|ref|ZP_01754253.1| HemY domain protein [Roseobacter sp. SK209-2-6]
 gi|126720347|gb|EBA17053.1| HemY domain protein [Roseobacter sp. SK209-2-6]
          Length = 503

 Score =  457 bits (1176), Expect = e-126,   Method: Composition-based stats.
 Identities = 114/497 (22%), Positives = 205/497 (41%), Gaps = 19/497 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWI--- 56
           +L+++ +F +I++     I++      V IT     Y  S    +L++    L  W+   
Sbjct: 5   LLKVLVFFAIIAVAAFGVIVLGETAGGVQITVAGTEYTLSALQSVLALGVLVLAVWVFFK 64

Query: 57  ---LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
              LL A  +F       +     K    KGY+AL  GLM++A+    LA  M       
Sbjct: 65  VLALLVATLKFLNGDETAISRYFDKGRERKGYQALSDGLMALASGEGRLA--MAKASRAA 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  L  LL  Q A        A +  + +L    TR   V  +  +    GD ++A
Sbjct: 123 RYLEKPELTDLLTAQAAEMAGDTGKAADAYKRLLSNQNTRFVGVRGIMKQKLSEGDSDTA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
            + A KAL + P    V + ++Q    A++W+ A   L+ K K        + R  A+L 
Sbjct: 183 LQLAEKALALRPKHEEVQDTLLQLQAKAEDWAGARKTLSTKLKTGTLPRDVFKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ S E A     +     AIE+ +L  + + A+  AA++ + Q KKR A  IL+K W  
Sbjct: 243 LSASKEVAADTSSLEQREQAIEANRLSPDLVPAAAMAARAYLEQGKKRAAIKILKKAWSA 302

Query: 290 NPHPEIANIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A+ +  +   E+   ++KR  +L  +N ++ E+ ++++++ +      +A    
Sbjct: 303 QPHPDLAHAFAEVEPNESASERVKRFDQLARLNPQNDETRLVMAELLIVAEDFPEARRVL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLP 407
              ++ AP      L+A IE+        I  W   AL A   P W+ ++  ++ + W P
Sbjct: 363 GDLVERAPDARSLTLMAAIEKGEGAGDAVIQGWLARALSAPRGPQWLCENCNHIHAEWAP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVS 467
           +     +     WK P ++PE  S+   +    +       +          +P  + VS
Sbjct: 423 VCEHCTSFDTLSWKRP-ETPELNSATAAHMLPLITGAGASTEVA---QMVEDVPEAEVVS 478

Query: 468 SFEDSTIHPLDPHIRQP 484
                     D     P
Sbjct: 479 DVSGEAEESADAPEAAP 495


>gi|332559973|ref|ZP_08414295.1| HemY domain-containing protein [Rhodobacter sphaeroides WS8N]
 gi|332277685|gb|EGJ23000.1| HemY domain-containing protein [Rhodobacter sphaeroides WS8N]
          Length = 482

 Score =  457 bits (1175), Expect = e-126,   Method: Composition-based stats.
 Identities = 96/467 (20%), Positives = 189/467 (40%), Gaps = 15/467 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWILL- 58
           +++++ +  ++  +      +      + +  G+      P   +++ L   L  W+ L 
Sbjct: 5   LIKILIFVALVVALTFGASELMESGGALRLAVGDLELNLGPLQAVIAALLLILAVWLFLK 64

Query: 59  -----FAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
                FAV RF       +     +    KG +AL  G+M++AA     A  M      +
Sbjct: 65  IVGFLFAVLRFLNGDETAVSRYFDRSREQKGLRALSEGMMALAAGEPRTA--MSRAAKAR 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  +  LL  Q A        A E  +++L+   TR   V  L  +    GD  +A
Sbjct: 123 KYLGQNAMTTLLNAQAAQQAGDSRRAQESYKLLLEDERTRFVGVRGLLKQKLDEGDTETA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
              A KA +I+P      + +++      +WS A + L+ K K+       + R  A+L 
Sbjct: 183 LALAQKAFEINPKHSETQDILLKLQADLHDWSGARSTLSAKMKSGALPKAVYKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           +  + +  D+   I +   AI + K   + I A+  AA+S ++Q  K+ A  +L+K W+ 
Sbjct: 243 LQTAKDVFDENASIEAREAAILANKQSPDLIPAAAMAARSYLAQGNKKYATRVLKKAWEA 302

Query: 290 NPHPEIANIYTHLLSENT-VGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A  +  +  + T   +LKR   L  I+ +  E+ +++++++L       A    
Sbjct: 303 EPHPDLAAAFAEIEPDETPAERLKRFRTLTAIHPDHDETRMLIAELSLAAEDFPGARRAL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLP 407
              +   P +    ++A +E+    +   +  W   AL A   P W  D+   + + W P
Sbjct: 363 GDIVARHPTQRALTIMAAVERGEGGDEAVVRGWLARALTAPRGPQWCCDNCQTVHATWAP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNN 454
           +           W+ PT+     ++      L +  PA      ++ 
Sbjct: 423 ICDNCGGFDTLSWREPTQKSTPSATGTELLPLIVGAPAARPADPMDE 469


>gi|254476677|ref|ZP_05090063.1| HemY domain protein [Ruegeria sp. R11]
 gi|214030920|gb|EEB71755.1| HemY domain protein [Ruegeria sp. R11]
          Length = 496

 Score =  455 bits (1172), Expect = e-126,   Method: Composition-based stats.
 Identities = 107/489 (21%), Positives = 204/489 (41%), Gaps = 21/489 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWI--- 56
           +L+++ +  +++++     +++     V IT     Y  S    ++++       W+   
Sbjct: 5   LLKILVFVAIVAVLAFGASLLTETAGGVQITVAGTEYTLSALQSVIALAVLVFAVWLGFK 64

Query: 57  ---LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
              LL A  RF       L     K    KGY+AL  G+M++A+    LA  M      +
Sbjct: 65  VLSLLIATLRFLNGDETALSRYWDKGRERKGYQALSDGMMALASGEGRLA--MAKAARAE 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
              +N  L  LL  Q A        A E  + ++   +TR   V  +  +    GD  +A
Sbjct: 123 KYLNNPELTDLLTAQAAEMAGDTKKAAEAYKRLVSNQSTRFVGVRGIMKQKLSEGDTETA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNRNRAILL 229
           ++ A KAL + P    V + ++     A++W+ A   L  K K        + R  A+L 
Sbjct: 183 RQLAEKALALRPKHEEVQDTLLTLQARAQDWAGARKTLTTKLKTGTLPRDVYKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ S    + G  +     AIE+ +L  + + A+  AA++ +S+ KKR A  +L+K W+ 
Sbjct: 243 LSASKAIVEDGATVEQQEQAIEANRLSPDLVPAAAMAARTYLSRGKKRNAIRVLKKAWEA 302

Query: 290 NPHPEIANIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A  +  +   E+   ++KR ++L  +  +  E+ +I++++ +      +A    
Sbjct: 303 QPHPDLAQAFAEVEPGESAQERVKRFVQLSRLAPQHDETRLIMAELNIVAEDFPEARRAL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISD-DGYLSSVWLP 407
              ++ AP      L+A IE+        I  W   AL A   P W+ D   ++ + W P
Sbjct: 363 GDLVERAPDARALTLMAAIEKGEGAPDAVIQGWLTRALSAPRGPQWVCDKCNHIHADWAP 422

Query: 408 LSPISKTLCYFEWKIP----TKSPEYISSENINFSLEMAYPAD--DLQSMLNNGKKNHLP 461
           +     +     W  P       P+ +         + A+ AD  D++ + ++       
Sbjct: 423 VCENCASFDTLSWTRPEAPHVMGPQVLPLLTGKPQADEAHGADIADVELLEDDQTDAEDD 482

Query: 462 SIKKVSSFE 470
           S       E
Sbjct: 483 SATVSEDAE 491


>gi|150398166|ref|YP_001328633.1| HemY domain-containing protein [Sinorhizobium medicae WSM419]
 gi|150029681|gb|ABR61798.1| HemY domain protein [Sinorhizobium medicae WSM419]
          Length = 551

 Score =  455 bits (1171), Expect = e-126,   Method: Composition-based stats.
 Identities = 169/539 (31%), Positives = 272/539 (50%), Gaps = 50/539 (9%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++ +  ++  +   F  ++  P ++S+ W  +L   S     S+L     A ++   
Sbjct: 1   MIRILFFVLLVLCLALGFAWLADRPGELSLIWQGQLIEMSLLRAASLLISVFAAVLIAVW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R   S P  +      R  D+GY+AL TGL++  A +  LARKM +      +   E 
Sbjct: 61  LLRTIWSSPHTVTRYFRARKRDRGYQALSTGLIAAGAGDANLARKMTARTRSLISSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L++LLE Q +L E +Y+ A +K E+M   P TRE  +  LY E+ R+G   +A+ YA +A
Sbjct: 121 LIHLLEAQTSLIEGKYDDARKKFELMADDPETRELGLRGLYLEAKRLGANEAARHYAERA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLIARSLEN 236
            + +P  PW T A +     A++W  AI  L+Q +       KE +R +A+LL AR++E 
Sbjct: 181 AEKAPHLPWATLATLDHRSQARQWDEAIRLLDQSRAANVLERKEADRKKAVLLTARAMEQ 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            +  D  ++  DA  +LKL D+ + A++ AAK+L  ++  RK   ILEK+WK++PHPEIA
Sbjct: 241 LE-ADPKSARDDARAALKLDDSLVPAALVAAKALFREDNLRKGASILEKMWKLDPHPEIA 299

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
            +Y      ++ + +LKRA RLE +   +  SL  V++ ALE   +  A  KA  A +I 
Sbjct: 300 RLYVRARGGDSALDRLKRAKRLETLRGNNAVSLATVAEAALEARELALARTKAEAAARID 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+ IFLLLA IE+A++ +  +I YW   AL +  DP W + DG  S  WLP+SP++  L
Sbjct: 360 PRESIFLLLADIEEADTGDEGRIRYWMSQALRSPRDPAWTA-DGVTSPSWLPVSPVTGRL 418

Query: 416 CYFEWKIPTKS-------------------------PEYISSENINFSLEMAYPADDLQS 450
             FEWK P                            P   +      +++ A PA+ +++
Sbjct: 419 DAFEWKAPPARLPAATEEGYLNPDAAIRSLPPVATVPRPATEPETESAVDAAPPAERVEA 478

Query: 451 ------------------MLNNGKKNHLPSIKKVSSFEDSTIHPLDPHIRQPDDPGIKE 491
                               +  +K  +P++   +  +DS   P     R PDDPG++E
Sbjct: 479 EPEKAITVPDPNETVAPPAGDPNRKEPVPAVASPAKGKDSEEAPDPFFGRPPDDPGVRE 537


>gi|126724569|ref|ZP_01740412.1| HemY domain protein [Rhodobacterales bacterium HTCC2150]
 gi|126705733|gb|EBA04823.1| HemY domain protein [Rhodobacterales bacterium HTCC2150]
          Length = 488

 Score =  453 bits (1165), Expect = e-125,   Method: Composition-based stats.
 Identities = 91/473 (19%), Positives = 177/473 (37%), Gaps = 15/473 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLF------- 53
           +++++ +   I  +      ++     + I +GN  Y   P   +  L   +        
Sbjct: 5   LIKILFFVVAIIALAFGVNYLTSMSGGIQIAFGNTEYTLGPLQSIVALILLVLTLYLILK 64

Query: 54  AWILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
               + A  RF       +          KGY+AL  GLM++A+    +A  +      +
Sbjct: 65  LIGFVLAFVRFLNGDETAISRYFSANRERKGYQALSDGLMALASGEGRVA--LSQAERAR 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
              +   L  L+  Q A  E     A +    +L+   TR   V  +  +    GD  +A
Sbjct: 123 RLLNKPELTNLISAQAAEMEGDTKKAKDIYVELLKDERTRFVGVRGIMKQKLAEGDTETA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
           ++ A KA D+ P      + ++Q     ++W+ A   LN K  N         R  A+L 
Sbjct: 183 KKLAEKAFDLKPKHNETGDVLLQLQAENEDWAGARKTLNTKVSNGVLPRDVHKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ + +       + +   AIE+ +L  + I A++ AAK+ + Q K R A  +L   WK 
Sbjct: 243 LSEARDIFANAGAVEAQVAAIEANRLSPDLIPAAVMAAKAYMEQEKPRYATRVLIAAWKS 302

Query: 290 NPHPEIANIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A  +  ++  E T  ++KR   L + + +  E+ ++++++ +       A    
Sbjct: 303 QPHPDLAAGFADIVPTETTKARIKRFAGLIKSDPDHAEARLLMAELHIADEDFAGARKAL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISD-DGYLSSVWLP 407
                         ++A IE+    +   +  W   AL A   P W  D   ++ S W  
Sbjct: 363 GGLNDDYLTSRSLTIMAAIERGEGSDDAIVRGWLTKALGASRGPQWTCDKCNHVHSNWTA 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHL 460
           +           WK P +    +        L +           +  +   +
Sbjct: 423 ICDRCSGFDTLAWKTPAEGELSMHGSTQMLPLIVGQAKSTEPLEDSAKEDATI 475


>gi|49476261|ref|YP_034302.1| hypothetical protein BH16090 [Bartonella henselae str. Houston-1]
 gi|49239069|emb|CAF28372.1| hypothetical protein BH16090 [Bartonella henselae str. Houston-1]
          Length = 517

 Score =  450 bits (1159), Expect = e-124,   Method: Composition-based stats.
 Identities = 139/509 (27%), Positives = 241/509 (47%), Gaps = 22/509 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++ Y FV+ L   +F  V++Y + + IT+ +  +  S    LS+L  FL    LL+ 
Sbjct: 1   MIRILIYTFVVCLFGLAFEWVANYNDVLVITFSHFRFSVSLLTALSLLILFLGILALLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +     S P +L +  +KR    GY+AL  G +++ A +  +A+KM + V +    + E 
Sbjct: 61  LFSILFSVPHILSNYFYKRRQKHGYEALSQGFLAVFAGDAIVAQKMQTRVEKYLAGNREP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL+ Q    +     A    E M +   T+   +Y L+ E+ +     +AQ+YA +A
Sbjct: 121 LAKLLQAQTLSLQNNSARAIGLYEQMRKEKQTKLAGLYGLFREAMKTNAYEAAQQYAQEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN-------AKEWNRNRAILLIARS 233
             +SP   W  +AV+ +      W +A+    Q +K        A E    +A+LL  ++
Sbjct: 181 QALSPALLWAHQAVLDRLSAEGSWDKALDVFEQAQKALPRSVRLAPERQHLQALLLSGQA 240

Query: 234 LENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHP 293
           L    +   + +    +++ KL  + I  ++ AA  L   N+ RKA+ ++   W+  PHP
Sbjct: 241 LHLL-RTHPVDACKAILKAHKLVPDFIPITVIAADILYKLNETRKADKMIVAAWQKEPHP 299

Query: 294 EIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMK 353
           ++  +Y     E  VG+LK+A  L   NK++ ES  +++K AL+ G    A  +A  A++
Sbjct: 300 DLGALYLE-REEGAVGRLKKAKTLASYNKDTFESTFLIAKAALDAGERVLAREQAQKALQ 358

Query: 354 IAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISK 413
              R+ ++LLLA IE+A  +N   +  W   AL A  DP+W+  DG + S W  +SPIS 
Sbjct: 359 YHKRESVYLLLADIEEAQGNNQAAVRQWLSLALRAERDPVWMC-DGTIFSSWAVISPISG 417

Query: 414 TLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDST 473
            L  FEWK P + P        +  +      +D +  ++         ++K  S +   
Sbjct: 418 RLGCFEWKAPPRMPPLTL--EADTLVLTKKDQEDKEDKVDKNAVVEGEMLEKSPSVKVDL 475

Query: 474 IHPLDPHIR----------QPDDPGIKEQ 492
           +H      +            DDPG+K +
Sbjct: 476 LHHAQIDKQDTEESSQIRLNVDDPGVKIE 504


>gi|89067497|ref|ZP_01155010.1| HemY domain protein [Oceanicola granulosus HTCC2516]
 gi|89047066|gb|EAR53120.1| HemY domain protein [Oceanicola granulosus HTCC2516]
          Length = 495

 Score =  450 bits (1159), Expect = e-124,   Method: Composition-based stats.
 Identities = 99/479 (20%), Positives = 199/479 (41%), Gaps = 15/479 (3%)

Query: 7   YFFVISLVICSFIIVSHYPEDVSITWGNRLYR-TSPFVILSILYFFLFAWI------LLF 59
           +  V+  +    + + +     ++T        T+  + ++ +   L  W+      LL 
Sbjct: 11  FVVVVMAIAYGAVWLMNVEGGATVTMAGYEVTLTTLQLAIAFVVLVLAIWLFFKLLGLLS 70

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
           A+  F       +    +KR   +G++AL  G+M++AA +  LA  +             
Sbjct: 71  ALFHFLNGDETAVSRYFNKRTERRGFEALSEGMMALAAGDGQLA--LVKAEKADRYLDRP 128

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATK 179
            L  LL+ Q A       +A +  +++LQ   TR   V  L  +    G+  +A + A +
Sbjct: 129 ELTNLLKAQAAERAGDRRVAEDTYKLLLQDDRTRFVGVQGLMRQKLEAGETETAMQLAQR 188

Query: 180 ALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLIARSLE 235
           A  +SP    V+  +++     ++W+ A   L  + K          R  A+L ++ + E
Sbjct: 189 AFALSPKNDEVSNTLLRLQAEHEDWAGARQTLGARLKTGAIPRDVHRRRDAVLALSEARE 248

Query: 236 NADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEI 295
              +G   A++ +AIE+ +L  + I A+I AA+  I QN  R A  +L+K W+  PHP++
Sbjct: 249 KLLEGKDAAAHEEAIEANRLSPDLIPAAIMAARGYIDQNNGRSAARVLKKAWEAQPHPDL 308

Query: 296 ANIYTHLLSEN-TVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKI 354
           A  +  +  +     ++KR   L  ++ +  E+ ++++++ +      +A       ++ 
Sbjct: 309 AAAFADIKPDEGPAERIKRFRDLTRVHPDHSETRMLLAELHVAAEDFPEAKRALGDLVET 368

Query: 355 APRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGY-LSSVWLPLSPISK 413
            P   +  L+A IE+    +   +  W   AL A     WI D+ + +++ W P+ P  K
Sbjct: 369 DPTARVLTLMAAIERGAGADDTVVRGWLTKALTAPRGDQWICDNCHNVAAHWAPVCPNCK 428

Query: 414 TLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDS 472
           +     WK P +S   +        L +    D        G      +    +S +  
Sbjct: 429 SFDTLAWKRPPQSEVAMPRGVEMLPLIVGRIEDRSAETAAPGSVPPEEAKVVDASADGD 487


>gi|99082666|ref|YP_614820.1| HemY-like [Ruegeria sp. TM1040]
 gi|99038946|gb|ABF65558.1| HemY-like protein [Ruegeria sp. TM1040]
          Length = 494

 Score =  449 bits (1155), Expect = e-124,   Method: Composition-based stats.
 Identities = 104/491 (21%), Positives = 194/491 (39%), Gaps = 16/491 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSI-------LYFFLF 53
           +L+++ +  +++L+     ++      V IT     Y       +          + F  
Sbjct: 5   LLKILVFVAIVALLAFGAGVLMETAGGVQITVAGTEYTLGALQSVMALLALMLLTWLFFK 64

Query: 54  AWILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
              LL A  RF       L     K    +GY+AL   LM++A      A  +      +
Sbjct: 65  LLSLLLATLRFLNGDETALSRYFDKGRERRGYQALSDSLMALAVGEGRTA--LTKAAKAE 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
               +  L  L+  Q A      + A E  + +L   +TR   V  +  +    GD  +A
Sbjct: 123 RYLQDPALTDLVVAQAAEMAGDTHKAAEAYKRLLSDQSTRFVGVRGIMKQKLSEGDTETA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
           ++ A KAL + P    V + +++    A++W+ A   L  K K      + + R  A+L 
Sbjct: 183 RQLAEKALALRPKHEEVQDTLLKLQAQAEDWAGARQTLATKLKTGTLPREVFKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ S     +         AIE+ +L  + + A+  AA+S I++ K R A  IL+K W+ 
Sbjct: 243 LSSSKALLAEEATPEQQEQAIEANRLSPDLVPAAALAARSYIAKGKPRNAVRILKKAWEA 302

Query: 290 NPHPEIANIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A+ +  +   E    ++KR   L  +  +  E+ ++ +++ +      +A    
Sbjct: 303 QPHPDLAHAFAEIEPNETAEARVKRFEPLLRLKPDHDETRLVRAELLIVAEDFPEARRAL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISD-DGYLSSVWLP 407
              +  AP      L+A IE+        +  W   AL A   P W+ +   ++ + W P
Sbjct: 363 GDLVDRAPDARALTLMAAIEKGEGGPDAMVQGWLTKALTAPRGPQWVCESCNHIHAEWAP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVS 467
                 +     WK P ++PEY S+        +A   DD  +            +++  
Sbjct: 423 TCENCASFDTLTWKRP-ETPEYHSATGAAMLPLLAGRQDDNGTGALTIIDPEPSDVREDG 481

Query: 468 SFEDSTIHPLD 478
                T +P D
Sbjct: 482 DQTQRTDNPDD 492


>gi|116254227|ref|YP_770065.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115258875|emb|CAK09983.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 542

 Score =  448 bits (1154), Expect = e-124,   Method: Composition-based stats.
 Identities = 155/463 (33%), Positives = 239/463 (51%), Gaps = 7/463 (1%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++RL+ +   + L+   F  ++  P D+S+ W  ++Y+T   V  S +   + A ++ + 
Sbjct: 2   LIRLVVFALFVLLLAYGFSWLADRPGDLSLIWEGQIYQTKLIVAASAIIALVAAVMIAWW 61

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
             R   + P  +      R  D+GY+AL TGL++  A N  LARKM +          E 
Sbjct: 62  FVRLVWTSPHSVTRYFRARKRDRGYQALSTGLIAAGAGNALLARKMAARSRGLIRADQEP 121

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q AL E +++ A  K E M   P TRE  +  LY E+ R+G   +A++YA KA
Sbjct: 122 LINLLEAQAALIEGRHDEARAKFEAMANDPETRELGLRGLYLEARRLGANEAARQYAEKA 181

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLEN 236
            D +P  PW  +A ++    A  W  AI  L Q+K        E NR  A+LL AR+ E 
Sbjct: 182 ADNAPYLPWAAQATLEYRSQAGRWDDAIRLLEQQKAARVVEKAEANRLHAVLLTARAGEK 241

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            +  +   +  DA+++LKL  + I A++ AAK+L  +   RKA  ILE+ WK  PHPEI 
Sbjct: 242 LE-SNPTGARDDALQALKLAADFIPAALIAAKALFREGGVRKAASILEQAWKSAPHPEIG 300

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             Y      ++T+ +LKRA RLE     +VESL++V++ AL+     +A AKA  A  + 
Sbjct: 301 QAYVRARSGDSTLDRLKRAERLEGQRPNNVESLLVVAQAALDAQEFAKARAKAEAAAHMQ 360

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  +LLLA IE+A + +  ++ +W   AL A  DP W++ DG++S  WLP+SP++  L
Sbjct: 361 PREAAYLLLADIEEAETGDQGRVRHWLAQALKAPRDPAWVA-DGFVSDKWLPVSPVTGRL 419

Query: 416 CYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKN 458
             FEWK P    E    +    +                 +  
Sbjct: 420 DAFEWKAPFGQIEGALEDGSAPASIETALKTLPPLRDVRPESP 462


>gi|254465019|ref|ZP_05078430.1| HemY domain protein [Rhodobacterales bacterium Y4I]
 gi|206685927|gb|EDZ46409.1| HemY domain protein [Rhodobacterales bacterium Y4I]
          Length = 498

 Score =  448 bits (1154), Expect = e-124,   Method: Composition-based stats.
 Identities = 104/498 (20%), Positives = 205/498 (41%), Gaps = 17/498 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILL-- 58
           +L+++ +  +++L+     ++      V IT     Y  S    +  L   + A  L   
Sbjct: 5   LLKILVFVAIVALLAFGAGLLMETAGGVQITVAGTEYTLSALQSVIALGVLVVAVWLFLK 64

Query: 59  -----FAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
                 A  RF       L     K    KGY+AL  GLM++A+    L   +      +
Sbjct: 65  LLSLLVATLRFLNGDETALSRYWDKGRERKGYRALSEGLMALASGEGRL--ALAKAARAE 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
               N  L  LL  Q A      + A +  + +L    TR   V  +  +    GD ++A
Sbjct: 123 KYLQNPELTDLLVAQAAEMSGDTHKAADAYKRLLSNQQTRFVGVRGIMKQKLSQGDTDTA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
           ++ A KAL + P    V + +++    A++W+ A   L+ K K        + R  A+L 
Sbjct: 183 RQLAEKALALRPKHEEVQDTLLRLQAQAEDWAGARKTLSTKLKTGTLPRDVYKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ S    D+   I     AIE+ +L  + + A+  AA++ +++ KKR A  +L+K W+ 
Sbjct: 243 LSASKGVIDENATIEQREQAIEANRLSPDLVPAAAMAARAYLAKGKKRPAVRLLKKTWQS 302

Query: 290 NPHPEIANIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A+ +  +   E+   ++ R  +L  +N +  E+ ++++++ +      +A    
Sbjct: 303 QPHPDLAHAFAEVEPDESAAERVARFDQLARLNPQDDETRLVMAELNIVAEDFPEARRWL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLP 407
               + AP      L+A IE+    +   +  W   AL +   P W+  +  ++   W P
Sbjct: 363 SDLTERAPDARALTLMAAIERGEGADDKVVQGWLTRALTSPRGPQWVCSNCNHIHVEWEP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVS 467
           +     +     WK P ++PE ++S    + L +     D +              + V 
Sbjct: 423 VCEHCTSFDTLSWKRP-ETPE-VASHAAAYMLPLITGVLDSKQSDTVDDAEEADLAEPVP 480

Query: 468 SFEDSTIHPLDPHIRQPD 485
             +          +++P+
Sbjct: 481 DADGDVEPEQQDAVKEPN 498


>gi|241206707|ref|YP_002977803.1| HemY domain protein [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240860597|gb|ACS58264.1| HemY domain protein [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 544

 Score =  448 bits (1153), Expect = e-124,   Method: Composition-based stats.
 Identities = 156/463 (33%), Positives = 240/463 (51%), Gaps = 7/463 (1%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++RL+ +   + L+   F  ++  P D+S+ W  R+Y+T   V  S +   + A ++ + 
Sbjct: 2   LIRLVVFALFVLLLAYGFSWLADRPGDLSLIWEGRIYQTKLIVAASAIIALVAAVMIAWW 61

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
             R   + P  +      R  D+GY+AL TGL++  A N  LARKM +          E 
Sbjct: 62  FVRLVWTSPHSVTRYFRARKRDRGYQALSTGLIAAGAGNALLARKMAARSRGLIRADQEP 121

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q AL E +++ A  K E M   P TRE  +  LY E+ R+G   +A++YA KA
Sbjct: 122 LINLLEAQAALIEGRHDEARAKFEAMANDPETRELGLRGLYLEARRLGANEAARQYAEKA 181

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLEN 236
            D +P  PW  +A ++    A  W  AI  L Q+K        E NR  A+LL AR+ E 
Sbjct: 182 ADNAPYLPWAAQATLEYRSQAGRWDDAIRLLEQQKAARVVEKAEANRLHAVLLTARAGEK 241

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            +  +   +  DA+++LKL  + I A++ AAK+L  +   RKA  ILE+ WK  PHPEI 
Sbjct: 242 LE-SNPTGARDDALQALKLAADFIPAALIAAKALFREGGVRKAASILEQAWKSAPHPEIG 300

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             Y      ++T+ +LKRA RLE     +VESL++V++ AL+     +A AKA  A ++ 
Sbjct: 301 QAYVRARSGDSTLDRLKRAERLEGQRPNNVESLLVVAQAALDAQEFAKARAKAEAAARMQ 360

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  +LLLA IE+A + +  ++ +W   AL A  DP W++ DG++S  WLP+SP++  L
Sbjct: 361 PREAAYLLLADIEEAETGDQGRVRHWLAQALKAPRDPAWVA-DGFVSDKWLPVSPVTGRL 419

Query: 416 CYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKN 458
             FEWK P    E    +    +                 +  
Sbjct: 420 DAFEWKAPFGQIEGALEDGSAPASIETALKTLPPLRDVRPESP 462


>gi|163738035|ref|ZP_02145451.1| HemY-like protein [Phaeobacter gallaeciensis BS107]
 gi|161388651|gb|EDQ13004.1| HemY-like protein [Phaeobacter gallaeciensis BS107]
          Length = 507

 Score =  445 bits (1146), Expect = e-123,   Method: Composition-based stats.
 Identities = 101/494 (20%), Positives = 201/494 (40%), Gaps = 15/494 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           +L+++ +  +++++     +++     V IT     Y  S    +  L   +F   +LF 
Sbjct: 5   LLKILVFVAIVAVLAFGAALLTETAGGVQITVAGTEYTLSALQSVIALAILVFVVWVLFK 64

Query: 61  VS-------RFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
           +        RF       +     K    KGY+AL  GLM++A+    LA  M      +
Sbjct: 65  LLSLLLATLRFLNGDETAISRYFDKGRERKGYQALSDGLMALASGEGRLA--MAKAARAE 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  L  LL  Q A        A E  + ++   +TR   V  +  +    GD ++A
Sbjct: 123 KYLEKPELTDLLTAQAAELAGDTKKAAEAYKRLVSNQSTRFVGVRGIMKQKLSEGDTDTA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNRNRAILL 229
           ++ A KAL + P    V + ++     A++W+ A   L  K K        + R  A+L 
Sbjct: 183 RQLAEKALSLRPKHEEVQDTLLTLQARAQDWAGARKTLTTKLKTGTLPRDVYKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ S     +G  +     AIE+ +L  + + A+  AA++ ++++KKR A  +L+K W+ 
Sbjct: 243 LSASKAIVKEGATVEQQEQAIEANRLSPDLVPAAAMAARAYLARDKKRYAIRVLKKAWEA 302

Query: 290 NPHPEIANIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A+ +  +   E    ++KR  +L  +  +  E+ ++++++ +      +A    
Sbjct: 303 QPHPDLAHAFAEVEPTETAQERVKRFAQLSRLAPQHDETRLVMAELHIVAEDFPEARRAL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLP 407
              ++  P      L+A IE+    +   I  W   AL+A   P W+  +  ++ + W P
Sbjct: 363 GDLVEREPDARALTLMAAIEKGEGASDAVIQGWLARALNAPRGPQWVCGNCNHIHAEWAP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVS 467
           +     +     W+ P       ++      L    P        ++  +  L   +  S
Sbjct: 423 VCENCASFDTLSWRRPEAPEIVGATGAQVLPLITGTPEGAAGPDASDIPEVELLEEEDTS 482

Query: 468 SFEDSTIHPLDPHI 481
             +     P  P  
Sbjct: 483 VSDVGETLPQGPDT 496


>gi|163757398|ref|ZP_02164487.1| hypothetical protein HPDFL43_18347 [Hoeflea phototrophica DFL-43]
 gi|162284900|gb|EDQ35182.1| hypothetical protein HPDFL43_18347 [Hoeflea phototrophica DFL-43]
          Length = 631

 Score =  445 bits (1145), Expect = e-123,   Method: Composition-based stats.
 Identities = 142/494 (28%), Positives = 243/494 (49%), Gaps = 9/494 (1%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RL+ +  ++ ++   F  ++  P D+SI W +R    S    ++++   + A ++ + 
Sbjct: 2   MIRLLFFVALVLVLGFGFAWLADRPGDLSIVWQDRRIEMSLMTAVTVMVSLVAAVMITWW 61

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R     P ++         D+GY+AL TGL++  A +   ARKM+       +   E 
Sbjct: 62  LIRTIWLSPRLVSRYFRANKRDRGYQALSTGLLAAGAGDAMTARKMNKRSRGLLSADQEP 121

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L++LL+VQ AL E + + A ++ E + + P TR   +  LY E+ R G   +A  YA KA
Sbjct: 122 LIHLLDVQTALIEGRNDDARKQFEALAEDPETRLLGLRGLYLEAQRQGATEAAHHYAEKA 181

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILLIARSLEN 236
            +++P  PW   A +       +W  A+  L+ +++       E +R +A+LL AR+ + 
Sbjct: 182 AELAPHLPWAGAAALSFRTQEGKWDEALRLLDTQRQAGTLEALEADRKKAVLLTARARDR 241

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D  D + S  DA+ +LK+      A++ A K+L+  +  RKA  ILE  WKVNPHPEIA
Sbjct: 242 LD-ADPLRSRDDALAALKVAPGFAPAAVIATKALLRNDNLRKAARILESAWKVNPHPEIA 300

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y      +    +LKRA RLE++   + ++   V++ ALE    D A  KA  + ++ 
Sbjct: 301 DAYVRARIGDTAADRLKRAERLEKLKPLNAQAYDTVARAALEARRFDLARQKAEASARLL 360

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           P + I+LLLA IE+A + +  ++ +W   A+ A  DP W + DGY+S  W P+SP++  L
Sbjct: 361 PCEGIYLLLADIEEAETGDEGRVRHWLSQAVRAPRDPAWTA-DGYVSETWEPVSPVTGKL 419

Query: 416 CYFEWKIPTKSPEYISSENINF--SLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDST 473
             FEWK+P +       +      S + A  +      +        P +          
Sbjct: 420 DAFEWKVPVEQLSGPRYDADMPEKSFDRAMASLPPVREVAEPAAPSGPVVNPEPEALVEV 479

Query: 474 IHPLDPHIRQPDDP 487
                  +  P+ P
Sbjct: 480 AAAEAVTVVAPEAP 493


>gi|163742569|ref|ZP_02149955.1| HemY domain protein [Phaeobacter gallaeciensis 2.10]
 gi|161384154|gb|EDQ08537.1| HemY domain protein [Phaeobacter gallaeciensis 2.10]
          Length = 507

 Score =  444 bits (1143), Expect = e-122,   Method: Composition-based stats.
 Identities = 100/489 (20%), Positives = 200/489 (40%), Gaps = 15/489 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           +L+++ +  +++++     +++     V IT     Y  S    +  L   +F   +LF 
Sbjct: 5   LLKILVFVAIVAVLAFGAALLTETAGGVQITVAGTEYTLSALQSVIALAILVFVVWVLFK 64

Query: 61  VS-------RFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
           +        RF       +     K    KGY+AL  GLM++A+    LA  M      +
Sbjct: 65  LLSLLLATLRFLNGDETAISRYFDKGRERKGYQALSDGLMALASGEGRLA--MAKAARAE 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  L  LL  Q A        A E  + ++   +TR   V  +  +    GD ++A
Sbjct: 123 KYLEKPELTDLLTAQAAELAGDTKKAAEAYKRLVSNQSTRFVGVRGIMKQKLSEGDTDTA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNRNRAILL 229
           ++ A KAL + P    V + ++     A++W+ A   L  K K        + R  A+L 
Sbjct: 183 RQLAEKALSLRPKHEEVQDTLLTLQARAQDWAGARKTLTTKLKTGTLPRDVYKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ S     +G  +     AIE+ +L  + + A+  AA++ ++++KKR A  +L+K W+ 
Sbjct: 243 LSASKAIVKEGATVEQQEQAIEANRLSPDLVPAAAMAARAYLARDKKRYAIRVLKKAWEA 302

Query: 290 NPHPEIANIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A+ +  +   E    ++KR  +L  +  +  E+ ++++++ +      +A    
Sbjct: 303 QPHPDLAHAFAEVEPTETAQERVKRFAQLSRLAPQHDETRLVMAELHIVAEDFPEARRAL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLP 407
              ++  P      L+A IE+    +   I  W   AL+A   P W+  +  ++ + W P
Sbjct: 363 GDLVEREPDARALTLMAAIEKGEGASDAVIQGWLARALNAPRGPQWVCGNCNHIHAEWAP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVS 467
           +     +     W+ P       ++      L    P        ++  +  L   +  S
Sbjct: 423 VCENCASFDTLSWRRPEAPEIVGATGAQVLPLITGTPEGAAGRDASDIPEVELLEGEDTS 482

Query: 468 SFEDSTIHP 476
             +     P
Sbjct: 483 VSDVGETLP 491


>gi|222150058|ref|YP_002551015.1| hypothetical protein Avi_4148 [Agrobacterium vitis S4]
 gi|221737040|gb|ACM38003.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 526

 Score =  443 bits (1141), Expect = e-122,   Method: Composition-based stats.
 Identities = 155/516 (30%), Positives = 259/516 (50%), Gaps = 29/516 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R+I Y  ++  +   F  ++  P ++ I W  +L   S     +++   +   ++ + 
Sbjct: 1   MIRIIVYILIVLALGFGFSWLADRPGELQIVWQGQLIEMSLTAAATMIVAIVAVVMIGWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R   + P  +      R  D+GY+A+ TGL++  A N  LAR+M +          E 
Sbjct: 61  LVRTLWTSPHSMRRYFRARKRDRGYQAISTGLIAAGAGNAALARRMSARARGLVRADQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ +LE Q AL E +++ A    E M+  P TRE  +  LY E+ R+G   +A++YA KA
Sbjct: 121 LIMVLEAQAALIEGKHDDARRIYEQMVADPETRELGLRGLYVEATRLGAHEAARQYAEKA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLIARSLEN 236
            + +P  PW  +A ++       W+ AI  L+Q++        E +R +A+LL A++++ 
Sbjct: 181 AEDAPYLPWAAKAALEYRCQTSAWNEAIHLLDQQRVAGVLARAEADRLKAVLLTAKAMDQ 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D GD  A+  +A+ +LKL  + + AS+ AA++L+ ++  RKA  +LE  WK+ PHP+IA
Sbjct: 241 LD-GDPAAARDNAMNALKLAKDLVPASVTAARALLREDNLRKAGSVLETAWKLAPHPDIA 299

Query: 297 NIYTHLLSEN-TVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           ++Y      +  V +LKRA RLE++   +V SL++V+++ALE     +A AKA  A ++ 
Sbjct: 300 SLYVRARGGDGAVDRLKRAERLEQVKPNNVYSLLVVAEMALEARDFTKARAKAEAAARMQ 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
             + +FLLLA IE A + +  +I YW   AL A  DP W++ DG +S  WLP SP+S  L
Sbjct: 360 ASERVFLLLADIEDAETGDQARIRYWMAQALKAPRDPSWVA-DGQVSEKWLPYSPVSGRL 418

Query: 416 CYFEWKIP--------------------TKSPEYISSENINFSLEMAYPADDLQSMLNNG 455
             FEWKIP                     + P     E    S+         +      
Sbjct: 419 DAFEWKIPYAQLSGPVEDGTVISGAAALAELPPLGQGEKPASSIPARKIDTLPEQPEALA 478

Query: 456 KKNHLPSIKKVSSFEDSTIHPLDPHIRQPDDPGIKE 491
             +  P+     + +     P       PDDPG+++
Sbjct: 479 PSSSQPTASPKPTPKSHEPEPF--FGGAPDDPGVRD 512


>gi|254473094|ref|ZP_05086492.1| hypothetical protein PJE062_2166 [Pseudovibrio sp. JE062]
 gi|211957815|gb|EEA93017.1| hypothetical protein PJE062_2166 [Pseudovibrio sp. JE062]
          Length = 613

 Score =  443 bits (1140), Expect = e-122,   Method: Composition-based stats.
 Identities = 117/493 (23%), Positives = 224/493 (45%), Gaps = 13/493 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++ +F  + L+      ++  P  V++ W   + + S    +      + A I+++ 
Sbjct: 1   MVRVLIFFAFVFLLALGGAWMADRPGVVTLEWQGYVVQASLLTTVVAFGASIVASIVVWG 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
             R     P ++ H + +R  DKGY AL  GLM++ + +   ARK      +     +E 
Sbjct: 61  FFRLIWKSPTLVSHFMQRRRKDKGYDALSQGLMALGSGDTLHARKFGLKADKLLD-GDEP 119

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
              LL  Q +  +  +  +  + E ML+   +    ++ LY E+ R  +  +A+ +A +A
Sbjct: 120 AARLLLAQASQLDGDHAESRRRFEAMLEDDRSMAVGLHGLYIEAERESEPAAARHFAEEA 179

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQ----KKKNAKEWNRNRAILLIARSLEN 236
            ++ P   W   AV+    ++ +W  AI  L +    +  + K   R +A+LL AR+LE 
Sbjct: 180 FNLVPGLRWAGNAVLGYQAVSGDWEEAIATLERNYAARMLDKKTLRRQKAVLLTARALEL 239

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            ++ +   +   A+E+  L  + + A+I AA+      + RKA  ILE  WK++PHP++A
Sbjct: 240 ENE-NPDRARTLAVEAHGLAPSLVPAAIVAARLRTRAGEIRKASKILEATWKLSPHPDLA 298

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             Y H+   ++V  +L R   L  +   S E  + ++  A+E    D+A  +    ++  
Sbjct: 299 EAYAHVRPGDSVTDRLSRVRTLASMRAYSSEGAIAIAVAAIEAKKFDEAREQLKRVLRSE 358

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           P +  FLL+A +E+    +  +I  W   A+ A  D +WI+ DG +S+ W P+SP +  +
Sbjct: 359 PTQRAFLLMADLEEREHGDQGRIREWLSRAVRAPHDKVWIA-DGVVSANWAPVSPKTGRV 417

Query: 416 CYFEWKIPTKSPEY-----ISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFE 470
             +EW  P  + +      +  + +    E+A P   L   +        P      +  
Sbjct: 418 DAYEWATPENTMDQDQTIEVIDDKLFEPPELAAPVQVLDEPVKADIVVPKPQDVDTPAAP 477

Query: 471 DSTIHPLDPHIRQ 483
                P    + +
Sbjct: 478 KEEPAPAPAPVEK 490


>gi|159045958|ref|YP_001534752.1| hypothetical protein Dshi_3418 [Dinoroseobacter shibae DFL 12]
 gi|157913718|gb|ABV95151.1| hypothetical protein Dshi_3418 [Dinoroseobacter shibae DFL 12]
          Length = 502

 Score =  443 bits (1139), Expect = e-122,   Method: Composition-based stats.
 Identities = 96/483 (19%), Positives = 192/483 (39%), Gaps = 16/483 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAW----- 55
           +L+++ +  +++ +     ++    E V I+  +  +  SP   + +    L A      
Sbjct: 5   LLKILIFVTLVAALTFGATLLMETGEQVRISLASTEFTLSPVAAVVLSLVLLGAAYLLFK 64

Query: 56  --ILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
              LL A  +F       +     +    KG++AL  G+M++A+    +A  M      +
Sbjct: 65  LAGLLLATLKFLNGDETAISRYFMRNRERKGFEALAQGMMALASGEGRVA--MAKAARAE 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  L  LL  Q A        A E  + ML    T+   V  L  +    GD  +A
Sbjct: 123 RYLGRPDLTQLLTAQAAELSGDRAKATETYKKMLTDERTKFVGVRGLLHQKLSEGDTETA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
              A KA  + P    V + +++     + W+ A   L  K K+         R  A+L 
Sbjct: 183 MALAEKAFALKPRNGEVQDTLLRLQAGDENWAGARKTLAAKLKSGDLPRDVHKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
            + + +  + G M  +   A E+ +L    + ++  AA+  I   K+R+A  +L K W++
Sbjct: 243 YSEAADAVEAGKMDKAEAHANEANRLAPGLVPSAALAARMAIRAGKQRQATKLLRKAWEL 302

Query: 290 NPHPEIANIYTHLLSENT-VGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
           NPHPE+A  Y  ++ + T   ++KR   L + N    ES ++++++ +       A    
Sbjct: 303 NPHPELAAAYAEIVPDETAAARIKRFEALVKPNPNHDESRLLMAELFIAAEDFPAARKAM 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLP 407
               +  P      ++A +E+    +   +  W   A+ A   P W  ++   + + W P
Sbjct: 363 GDLYETKPNARSLTIMAAVERGEGSDDAIVRAWLAKAVTASRGPQWTCENCNNIHASWTP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVS 467
           +           W  P +S   +++      L +   A D  +  +  ++  +P +  ++
Sbjct: 423 VCGNCGAFDSLSWVEPPESEIALTNSAEMLPLIVGAIA-DQSAKKDPEEEVIVPDVVDIT 481

Query: 468 SFE 470
             E
Sbjct: 482 PTE 484


>gi|84514840|ref|ZP_01002203.1| HemY domain protein [Loktanella vestfoldensis SKA53]
 gi|84510999|gb|EAQ07453.1| HemY domain protein [Loktanella vestfoldensis SKA53]
          Length = 479

 Score =  443 bits (1139), Expect = e-122,   Method: Composition-based stats.
 Identities = 91/477 (19%), Positives = 178/477 (37%), Gaps = 15/477 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++++  +   ++ +     ++       +I      +      ++  L   +    L   
Sbjct: 5   LIKITAFILTVTALTYGAAMLYDVDGGATIAVMGIEFTLRTLDMVVALVALVVLVWLGLR 64

Query: 61  VS-------RFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
           +         F       +     +    KGY+AL  G+M++A+    LA  M      +
Sbjct: 65  LLALLAASYHFLNGDETAISRYFDRNRERKGYEALAEGMMALASGEGHLA--MTKAARAE 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
              H   L  LL  Q A        A E  + +L    TR   V  +  +    GD + A
Sbjct: 123 KYLHQPQLTNLLTAQAAEMTGDRRKAEETYKKLLADDRTRFVGVRGIMKQKLAEGDTDLA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
            + A KA  + P      + ++Q      +W  A   L  K K+         R  A+L 
Sbjct: 183 LKLAQKAFALKPKHAETQDVLLQLQADKADWKGARQTLGAKLKSGTLPRDVHKRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ + +  D+G+ I +   AI + +L  + I A++ AA+  I+Q   R A  +L K W  
Sbjct: 243 LSEARDILDEGNPIEAREAAIAANRLSPDLIPAAVMAARGYIAQGNARYASRVLVKTWTA 302

Query: 290 NPHPEIANIYTHLLSENTVG-KLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP+IA  +  ++ + T   +LKR   L +   +  E+ ++++++ +       A    
Sbjct: 303 QPHPDIATAFAEIVPDETPQARLKRFATLTKATPDHPEAKMLMAELHVAAEDFPAARRDI 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISD-DGYLSSVWLP 407
              ++  P      L+A +E+    +   +  W   AL A   P WI D   ++   W P
Sbjct: 363 ADLVETDPTARSLALMAAVERGVGADDAVVRGWLTRALTAPRGPQWICDKCQHIHPQWGP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIK 464
           +           WK P      + +      L +       +++ ++ +       K
Sbjct: 423 VCGNCAAFDTLSWKRPPAGEVSMPAGTEMLPLIVGSQPVPDETLPDDAETVAKDDAK 479


>gi|260575763|ref|ZP_05843759.1| HemY domain protein [Rhodobacter sp. SW2]
 gi|259021916|gb|EEW25216.1| HemY domain protein [Rhodobacter sp. SW2]
          Length = 491

 Score =  442 bits (1136), Expect = e-122,   Method: Composition-based stats.
 Identities = 98/458 (21%), Positives = 173/458 (37%), Gaps = 15/458 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLF------- 53
           +L+++ +  VI+ +      ++     + I          P   L      +        
Sbjct: 6   LLKVVLFVAVIAGLTFGAGRLTDTGGGLQIAVYGYEVTLGPLQALVGALLLVVAVWLLLK 65

Query: 54  AWILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
           A  LL AV +F       +     +    KGY+AL  G++++A+    +A  +      Q
Sbjct: 66  AIGLLVAVLKFLNGDETAVSRYFDRNRERKGYQALSEGMIALASGEARVA--LSRAAKAQ 123

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  L  LL  Q A        A E  + +L    TR   V  L  +    GD  +A
Sbjct: 124 KYLGKPELTTLLTAQAAELAGDSARATEAYKALLTDEKTRFVGVRGLMLQKVASGDKATA 183

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
            + A KA  + P      + ++Q      +W  A T L  K +      + + R  A+L 
Sbjct: 184 LKLAEKAFAMKPRHTETQDVLLQLQASQADWKGARTTLGAKLRAGTLPREVFRRRDAVLA 243

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           +  +    D+   I S   AIE+ KL  + I A+  AA+S I++   + A  +L+K W+ 
Sbjct: 244 LQEAKTVFDESASIESREAAIEANKLSPDLIPAAAMAARSYIAKGDAKNATRVLKKAWEA 303

Query: 290 NPHPEIANIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A  +  +   E+   +LKR   L  I+    E+ ++++++ L       A    
Sbjct: 304 RPHPDLAAAFAEIEPTESAQARLKRFKLLTAIHPTHEETRLLLAELNLAAEDFPAARRII 363

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGY-LSSVWLP 407
                  P      ++A IE+    +   +  W   AL A   P W  D    + + W P
Sbjct: 364 GDLATSHPTGRSLAIMAAIERGEGADDAVVRGWLARALTAPRGPQWCCDKCQGIHAQWTP 423

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPA 445
           +           W+ P +     S+      L +  P 
Sbjct: 424 ICDNCGAFDTLSWREPPEGSRPSSTGTELLPLIVGSPK 461


>gi|209551274|ref|YP_002283191.1| HemY domain protein [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209537030|gb|ACI56965.1| HemY domain protein [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 536

 Score =  441 bits (1135), Expect = e-121,   Method: Composition-based stats.
 Identities = 168/523 (32%), Positives = 264/523 (50%), Gaps = 34/523 (6%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++RL+ +   + L+   F  ++  P D+S+ W  ++Y+T   V  S +   + A ++ + 
Sbjct: 2   LIRLVAFALFVLLLAYGFSWLADRPGDLSLIWEGQIYQTKLIVAASAIIALIAAVMIAWW 61

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
             R   + P  +      R  D+GY+AL TGL++  A N  LARKM +          E 
Sbjct: 62  FVRLVWTSPHSVTRYFRARKRDRGYQALSTGLIAAGAGNALLARKMAARSRGLIRADQEP 121

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q AL E +Y+ A  K E M   P TRE  +  LY E+ R+G   +A++YA KA
Sbjct: 122 LISLLEAQAALIEGRYDEARAKFEAMANDPETRELGLRGLYLEARRLGANEAARQYAEKA 181

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLEN 236
            D +P  PW  +A ++    A  W  AI  L Q+K        + NR  A+LL AR+ E 
Sbjct: 182 ADNAPYLPWAAQATLEYRSQAGRWDDAIRLLEQQKAARVVEKADANRLHAVLLTARAGEK 241

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            + G+   +  DA ++LKL  + I A++ AAK+L  +   RKA  ILE+ WK  PHPEI 
Sbjct: 242 LE-GNPAGARDDAQQALKLAADFIPAALVAAKALFREGGVRKAASILEQAWKSAPHPEIG 300

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             Y      ++T+ +LKRA RLE +   +VESL++V++ AL+     +A AKA  A ++ 
Sbjct: 301 QAYVRARSGDSTLDRLKRAERLEGLRPNNVESLLVVAQAALDAQEFAKARAKAEAAARMQ 360

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  FLLLA IE+A + +  ++ +W   AL A  DP W++ DG++S  WLP+SP++  L
Sbjct: 361 PREAAFLLLADIEEAETGDQGRVRHWLAQALKAPRDPAWVA-DGFVSDKWLPVSPVTGRL 419

Query: 416 CYFEWKIPTKSPEYISSENINFSLEMA-------------YPADDLQSMLNNGKKNHLPS 462
             FEWK P    E    +     +E A              P +D + +          +
Sbjct: 420 DAFEWKAPFGQIEGPLEDGSVPPIETALKTLPPLRDVRPESPVNDHRIIELERAATIAEA 479

Query: 463 IKKVSSFEDSTIHPLDPHI--------------RQPDDPGIKE 491
           ++   +   +   P++P                  PDDPG+++
Sbjct: 480 VRPTPAPAPAKSKPVEPVSGKTPAPGEAKPFFGGLPDDPGVRD 522


>gi|190893756|ref|YP_001980298.1| hypothetical protein [Rhizobium etli CIAT 652]
 gi|190699035|gb|ACE93120.1| hypothetical conserved membrane protein [Rhizobium etli CIAT 652]
          Length = 535

 Score =  440 bits (1133), Expect = e-121,   Method: Composition-based stats.
 Identities = 156/463 (33%), Positives = 243/463 (52%), Gaps = 7/463 (1%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RL+ +  ++ L+   F   +  P D+S+ W  ++Y+T   V +S +   + A ++ + 
Sbjct: 1   MIRLVVFALLVLLLAYGFSWFADRPGDLSLIWEGQIYQTKLIVAVSAIIALIAAVMIGWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
             R   + P  +      R  D+GY+AL TGL++  A N  LARKM +          E 
Sbjct: 61  FVRLIWTSPHSVTRYFRARKRDRGYQALSTGLIAAGAGNALLARKMAARSRGLIRADQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q AL E +++ A  K E M   P TRE  +  LY E+ R+G   +A++YA KA
Sbjct: 121 LINLLEAQAALIEGRHDEARAKFEAMANDPETRELGLRGLYLEARRLGANEAARQYAEKA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLEN 236
            D +P  PW  +A ++    A  W  AI  L Q+K        E NR  A+LL AR+ E 
Sbjct: 181 ADNAPYLPWAAQATLEYRSQAGHWDDAIRLLEQQKAARVVEKAEANRLHAVLLTARAAEK 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            + G+   +  DA+++LKL  + + A++ AAK+L  +   RKA  ILE+ WK  PHPE+ 
Sbjct: 241 LE-GNPAGARDDALQALKLAADFVPAALIAAKALFREGGLRKAASILEQAWKSAPHPEVG 299

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             Y      ++T+ +LKRA RLE +   +VESL++V++ AL+     +A AKA  A +I 
Sbjct: 300 QTYVRARSGDSTLDRLKRAERLEALRPNNVESLLVVAQAALDAQEFAKARAKAEAAARIE 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  FLLLA IE+A + +  ++ +W   AL A  DP W++ DG++S  WLP+SP++  +
Sbjct: 360 PREAAFLLLADIEEAETGDQGRVRHWLAQALKAPRDPAWVA-DGFVSDKWLPVSPVTGRI 418

Query: 416 CYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKN 458
             FEWK P    E    +    +                 +  
Sbjct: 419 DAFEWKAPFGQIEGPLEDGSAPAAIETALKTLPPLRDVRPESP 461


>gi|327188880|gb|EGE56072.1| hypothetical conserved membrane protein [Rhizobium etli CNPAF512]
          Length = 580

 Score =  439 bits (1129), Expect = e-121,   Method: Composition-based stats.
 Identities = 166/523 (31%), Positives = 264/523 (50%), Gaps = 34/523 (6%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RL+ +  ++ L+   F   +  P D+S+ W  ++Y+T   V +S +   + A ++++ 
Sbjct: 46  MIRLVVFALLVLLLAYGFSWFADRPGDLSLIWEGQIYQTKLIVAVSAIIALIAAVMIVWW 105

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
             R   + P  +      R  D+GY+AL TGL++  A N  LARKM +          E 
Sbjct: 106 FVRLIWTSPHSVTRYFRARKRDRGYQALSTGLIAAGAGNALLARKMAARSRGLIRADQEP 165

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q AL E +++ A  K E M   P TRE  +  LY E+ R+G   +A++YA KA
Sbjct: 166 LINLLEAQAALIEGRHDEARAKFEAMANDPETRELGLRGLYLEARRLGANEAARQYAEKA 225

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLEN 236
            D +P  PW  +A ++    A  W  AI  L Q+K        E NR  A+LL AR+ E 
Sbjct: 226 ADNAPYLPWAAQATLEYRSQAGHWDDAIRLLEQQKAARVVEKAEANRLHAVLLTARAAEK 285

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            + GD   +  DA+++LKL  + + A++ AAK+L  +   RKA  ILE+ WK  PHPEI 
Sbjct: 286 LE-GDPAGARDDALQALKLAADLVPAALIAAKALFREGGLRKAASILEQAWKSKPHPEIG 344

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             Y      ++T+ +LKRA RLE +   +VESL++V++ AL+     +A AKA  A +I 
Sbjct: 345 QTYVKARSGDSTLDRLKRAERLEALRPNNVESLLVVAQAALDTQEFAKARAKAEAAARIE 404

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  FLLLA IE+A + +  ++ +W   AL A  DP W++ DG++S  WLP+SP++  +
Sbjct: 405 PREAAFLLLADIEEAETGDQGRVRHWLAQALKAPRDPAWVA-DGFVSDKWLPVSPVTGRI 463

Query: 416 CYFEWKIPTKSPEYISSENINFS--------------------------LEMAYPADDLQ 449
             FEWK P    E    +    +                          +E+   A   +
Sbjct: 464 DAFEWKAPFGQIEGPLEDGSAPAAIETALKTLPPLRDVRPESPVNDHRIIELERAATIAE 523

Query: 450 SMLNNGKKNHLPSIKKVSSFEDSTIHPLDPHI-RQPDDPGIKE 491
           ++           ++  +  +    +   P     PDDPG+++
Sbjct: 524 AVRPAPAPAKPKPVEPAAGDKAPVPNEAKPFFGGLPDDPGVRD 566


>gi|299133147|ref|ZP_07026342.1| HemY domain protein [Afipia sp. 1NLS2]
 gi|298593284|gb|EFI53484.1| HemY domain protein [Afipia sp. 1NLS2]
          Length = 545

 Score =  438 bits (1128), Expect = e-121,   Method: Composition-based stats.
 Identities = 126/527 (23%), Positives = 229/527 (43%), Gaps = 43/527 (8%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R+  +  ++++       V+     V ++W      TS  V+  +    + A IL++ 
Sbjct: 1   MVRIFSFLILLTVAALGATWVADQSGGVVLSWNGWRAETSLPVLALLALILVIAAILVWT 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R F   PA L    H++   K   A+  GL+++   +  LA +            ++ 
Sbjct: 61  IVRAFWKTPARLRRYRHEKREAKARHAITQGLIAVGTGDSSLAHRHAGTAK--RLAEHDP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL+ Q A  E     A      M +    R   +  L+ E+ R  DL++A   A +A
Sbjct: 119 LTLLLQAQTAQLEGDRPGAQHAFHAMAERQDMRLLGLRGLFIEAQRNDDLHTAVAMAEEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQK----KKNAKEWNRNRAILLIARSLEN 236
           L I+P +PW + AV+       +W  A+  L+            + R R +LL AR+LE 
Sbjct: 179 LKIAPSSPWASHAVLGFRCAQSDWDGALALLDSNYSASLIENAPYRRQRGVLLTARALE- 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            ++ D   S   A+E++K     + A++ AAK     N+ R+A   +E  W  NPHP++A
Sbjct: 238 LEERDRDLSRKSAMEAIKFAPQLVPAAVLAAKFYSEDNQVRRAMRTIEVAWNANPHPDLA 297

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y H+   ++   +L R   L +   +  ES + +++ A+E     +A       +   
Sbjct: 298 DAYAHVRLGDSARERLARVELLAQKAPDHRESRLAIARAAIEASEFGRAREALAPLLTTM 357

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
             + + LL+A++E+A +H+  +   WT  A+ A PDP W + DGY+S  W P+SP++  L
Sbjct: 358 -TQRVALLMAELERAGNHDEGRAREWTARAVRAAPDPAWTA-DGYVSDRWRPVSPVTGRL 415

Query: 416 CYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSML------------NNGKKNHLPSI 463
             F+W  P  +   ++S++++ + E ++  + L                        P  
Sbjct: 416 DAFQWVTPVAA---LTSDHVDVAAEASHLPEKLPEPASVAIESKVAPAEPEPAVEKAPVE 472

Query: 464 KKVSSFEDSTIHPL------------------DPHIRQPDDPGIKEQ 492
              +  +   + P                    P +R PDDPG+ E 
Sbjct: 473 AAPAPVKTDNVAPPVFRARPAGEARSPAPSAIIPLVRAPDDPGVPED 519


>gi|118592001|ref|ZP_01549395.1| hypothetical protein SIAM614_25032 [Stappia aggregata IAM 12614]
 gi|118435297|gb|EAV41944.1| hypothetical protein SIAM614_25032 [Stappia aggregata IAM 12614]
          Length = 669

 Score =  438 bits (1127), Expect = e-120,   Method: Composition-based stats.
 Identities = 121/506 (23%), Positives = 233/506 (46%), Gaps = 23/506 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITW---------GNRLYRTSPFVILSILYFF 51
           M+R++ +F ++  V   F  ++  P  + I+W         G  ++  SP ++      F
Sbjct: 1   MIRVLFFFALLFAVALGFAWMADLPGTIQISWPVYENGQQVGTDIWEQSPVIVGLAAAVF 60

Query: 52  LFAWILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVS 111
           L  ++++    R  L  P +      +R  DKGY AL  GL+++   N  LAR+    + 
Sbjct: 61  LAVFLVIVWAIRVVLKSPQIASRFFRRRRKDKGYNALSQGLIALGTGNAKLARRY--ALD 118

Query: 112 QQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLN 171
                 +E    LL  Q A    + + A ++ E ML+ PAT+   ++ L+ E+ R  +  
Sbjct: 119 ADKLLDDEPAAKLLLAQTAQLAGKDDEARQRFEAMLEDPATKALGLHGLFIEAERHKEPV 178

Query: 172 SAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQ----KKKNAKEWNRNRAI 227
           +A+ YA +A   SP   W  +AV+    +A  W  A+  L +    K  + K + R RA+
Sbjct: 179 AARHYAEEAAKTSPGLEWAGKAVLGYQAVAHHWDEALKTLERNYAAKMLDKKTYRRQRAV 238

Query: 228 LLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIW 287
           +L A ++   + G+   +Y  A E+  L  + + A++  ++    +   RKA  +LE  W
Sbjct: 239 ILTALAM-KLEDGEPERAYSLAKEAHGLALDLVPAAVLTSRLATRRGDIRKASKVLEATW 297

Query: 288 KVNPHPEIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHA 346
           ++ PHP++A  Y H+   ++ V +LKR   L      + E  + +++ A+E    ++A  
Sbjct: 298 RLFPHPDLAETYAHVRTGDSAVDRLKRVKSLSAQRANTPEGALAIARAAMEAREFEEARQ 357

Query: 347 KAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWL 406
           +    ++  P ++ FLL+A++E+A + +  +   W   A+ A  D +W++ DG +S+ W 
Sbjct: 358 QLKKVLQSEPTRQAFLLMAEVEEAENGDRGRTRDWLARAVSAPLDKVWMA-DGIISAEWQ 416

Query: 407 PLSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKV 466
           P+SP++  L  F+W  P      +S E+     +  + A  L S         +  ++  
Sbjct: 417 PVSPVTGKLDAFQWATPGS----LSDEDGPLLEDSLFDAPALPSATVAEPVRPVSDVEDS 472

Query: 467 SSFEDSTIHPLDPHIRQPDDPGIKEQ 492
           +   +          + P +P     
Sbjct: 473 AVVLEVEPVTKTTDPK-PSEPKSDAD 497


>gi|153008313|ref|YP_001369528.1| HemY domain-containing protein [Ochrobactrum anthropi ATCC 49188]
 gi|151560201|gb|ABS13699.1| HemY domain protein [Ochrobactrum anthropi ATCC 49188]
          Length = 553

 Score =  438 bits (1127), Expect = e-120,   Method: Composition-based stats.
 Identities = 137/504 (27%), Positives = 238/504 (47%), Gaps = 16/504 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ YF V++ +   F  ++  P ++ +T+    Y       ++ +   + A ++L+ 
Sbjct: 1   MLRVLFYFVVVAALGFGFAWLADRPGELDVTFAGNHYNVPLITAVAGIVAIVAAMLILWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L      R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 61  LVKSIIQSPYTLRRHFRARKRDRGYQSLSTGLIAAGAGDAEAARRMTKQAGKLLSSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M+  P TR   +  LY E+ R+G L++A+ YA +A
Sbjct: 121 LIKLLEAQTAMLEGRTEDARKGFEAMVDDPETRLLGLRGLYIEAQRVGALDAARHYAAEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNRNRAILLIARSLEN 236
              +P   W + A++ Q     +W  A+  ++ +K+          + RA LL A+++  
Sbjct: 181 ASQAPQLEWASSAMMGQLCAEGDWDAALKLVDARKQALAHSKDVVKKERAALLTAKAMAV 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
           AD  D   +   A+E+ KL  + + A++ AA++L S    RK   ILE  WK  PHP+IA
Sbjct: 241 ADV-DHAQAKALALEANKLTPDLVPAAVVAARALFSDGDMRKGSKILEAAWKRFPHPDIA 299

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A   ++ +
Sbjct: 300 STYVYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGDYRLARDNAEQVLRAS 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+S  W P+SP++  L
Sbjct: 360 PRESAYLLLADIEEAETGDQGKVREWLARAVKAPRDPAWTA-DGYVSEQWSPVSPVTGRL 418

Query: 416 CYFEWKIPT---------KSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKV 466
             FEWK+P          + PE            +       ++ + +            
Sbjct: 419 NSFEWKVPVVELAPAIEAEKPEIKGPVEAKPGNPLVLAEPKDKAGVVDASAVVERKSPVR 478

Query: 467 SSFEDSTIHPLDPHIRQPDDPGIK 490
              E   I P    ++    P +K
Sbjct: 479 DVEEAEVIVPAAEPVKVSPAPSVK 502


>gi|15966835|ref|NP_387188.1| hypothetical protein SMc03234 [Sinorhizobium meliloti 1021]
 gi|307301663|ref|ZP_07581422.1| HemY domain protein [Sinorhizobium meliloti BL225C]
 gi|307316313|ref|ZP_07595757.1| HemY domain protein [Sinorhizobium meliloti AK83]
 gi|15076107|emb|CAC47661.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306898153|gb|EFN28895.1| HemY domain protein [Sinorhizobium meliloti AK83]
 gi|306903361|gb|EFN33950.1| HemY domain protein [Sinorhizobium meliloti BL225C]
          Length = 545

 Score =  437 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 161/533 (30%), Positives = 262/533 (49%), Gaps = 44/533 (8%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++ +  ++  +   F  ++  P ++S+ W  +L   S     SIL     A +++  
Sbjct: 1   MIRILFFVLLVLCLALGFAWLADRPGELSLIWQGQLIEMSLMRAASILISLFAAVLIVVW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R     P  +      R  D+GY+AL TGL++  A +  LARKM +      +   E 
Sbjct: 61  LLRTIWLSPHTVTRYFRSRKRDRGYQALSTGLIAAGAGDANLARKMAARTRNLISSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L++LLE Q AL E +Y+ A +K E M   P TRE  +  LY E+ R+G   +A++YA +A
Sbjct: 121 LIHLLEAQTALIEGKYDDARKKFEAMADDPETRELGLRGLYLEAKRLGANEAARQYAERA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLEN 236
            + +P  PW T A +     A++W  AI  L+Q +        E +R +A+LL AR++E 
Sbjct: 181 SEKAPHLPWATLATLDHRSQARQWDEAIRLLDQSRAAHVLEKNEADRKKAVLLTARAMER 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D  D  ++  DA  +LKL D  + A++ AAK+L  +   RK   ILE++WK++PHP+IA
Sbjct: 241 LD-ADPKSARDDAQAALKLDDRLVPAALVAAKALFREENLRKGASILERMWKLDPHPDIA 299

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
            +Y      ++ + +LKRA +LE +   +  +L  V++ AL+   +  A  KA  A ++ 
Sbjct: 300 RLYVRARGGDSALDRLKRAKKLESLRSNNAVALATVAEAALDARELALARTKAEAAARLE 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+ IFLLLA IE+A++ +  +I +W   AL +  DP W + DG  S VWLP+SP+S  L
Sbjct: 360 PRESIFLLLADIEEADTGDEGRIRHWMAQALKSPRDPAWTA-DGVTSPVWLPVSPVSGRL 418

Query: 416 CYFEWKIPTKSPEYISSEN-------INFSLEMAYPADDLQSMLNNGKKNHLPSIKK--- 465
             FEWK P       + +        I     +A     ++           P+ ++   
Sbjct: 419 DAFEWKAPPSQIAAATEDGHLNPDQAIRSLPPVATVPRPVEEPAPERTVEAAPTAERDQT 478

Query: 466 ---------------------------VSSFEDSTIHPLDPHIRQPDDPGIKE 491
                                       +  +D+   P     R PDDPG++E
Sbjct: 479 ERERVERERAGPEKAISVPDRKEPAASPAKGKDAEEAPDPFFGRPPDDPGVRE 531


>gi|148251900|ref|YP_001236485.1| HemY domain-containing protein [Bradyrhizobium sp. BTAi1]
 gi|146404073|gb|ABQ32579.1| putative exported protein of unknown function with HemY domain
           (porphyrin biosynthesis) [Bradyrhizobium sp. BTAi1]
          Length = 641

 Score =  437 bits (1123), Expect = e-120,   Method: Composition-based stats.
 Identities = 117/502 (23%), Positives = 216/502 (43%), Gaps = 16/502 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ +  ++ L       V+    DV + WG      +  V +  L   + A +L++ 
Sbjct: 1   MLRIVVFLILVGLAAAGSAWVAEQTGDVVLNWGPWRIAMTLPVFVLALGLTITACVLVWN 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +    L  P  + +    R + +G  A+  GL++I   ++  AR+            ++ 
Sbjct: 61  LISALLRAPGRIRNHHRARRHQRGRHAITHGLLAIGHGDLTAARQHADAAK--RLAGDDP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL  Q A      + A      M +   TR   +  L+ E+ R  D  +A   A +A
Sbjct: 119 LTLLLHAQAAQLGGDRDGAQRAFRAMAERHDTRLLGLRGLFIEAQRADDAYAAVMIADEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLN----QKKKNAKEWNRNRAILLIARSLEN 236
           L ++P+A W + AV+       +W+ A+  L+        +   + R R +LL AR++  
Sbjct: 179 LKLAPNATWASHAVLGFRCAQGDWNGALAILDSNYTAGMIDKPTYRRQRGVLLTARAIA- 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            +  +   +   A+E++KL    I A++ AAK     ++ R+A  I+E  W   PHP++A
Sbjct: 238 LETENRDLARASAMEAVKLAPTLIPAAVLAAKFESEAHQVRRAMKIIEAAWTAGPHPDLA 297

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y H+   ++   +L R   L    ++ +E  + +++ A++     +A A         
Sbjct: 298 DAYAHVRLGDSARQRLTRIENLAARTRDHIEGALAIARAAIDAAEFGRARAAL-APFTDD 356

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           P + + +L+A++E+    +  K   WT  A+ A  DP W + DGY+S  W P+SP++  L
Sbjct: 357 PTQRVAMLMAELERTEHGDAGKSREWTLRAVRARHDPAWTA-DGYVSDHWRPISPVTGRL 415

Query: 416 CYFEWKIPTKSPE------YISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSF 469
             F+W+ P  S          SSE  +  L     A   + +    ++    S   V + 
Sbjct: 416 DAFQWQTPVASLPSERNSVIESSEFADAVLAPPTRATIPEGLAEPPREVARQSQLDVIAP 475

Query: 470 EDSTIHPLDPHIRQPDDPGIKE 491
                 P  P      DP +  
Sbjct: 476 TPQDNVPPRPAETAVSDPAVDT 497


>gi|126732179|ref|ZP_01747980.1| HemY domain protein [Sagittula stellata E-37]
 gi|126707261|gb|EBA06326.1| HemY domain protein [Sagittula stellata E-37]
          Length = 518

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 105/492 (21%), Positives = 192/492 (39%), Gaps = 22/492 (4%)

Query: 12  SLVICSFIIVSHYPED----VSITWGNRLYRTSPFVILSILYFFLFAWI-------LLFA 60
           + +      +            IT     Y  +P +++      L A          L A
Sbjct: 12  AALTLGLGYLIEADGTGLAQARITLNGVEYTLTPVMMVIGALVLLLAVWLLLKLASFLVA 71

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + RF       L    H+    KGY AL  G+M++A+    LA  +      +   H   
Sbjct: 72  LLRFINGDETALSRHFHRNRERKGYAALSDGMMALASGEGRLA--IAKAQKAEKYLHKPE 129

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  L+  Q A        A E  + +L    TR   +  +  +    GD N+A + A +A
Sbjct: 130 LTDLVTAQAAEMMGDRKKAEETYKKLLTRDGTRFVGIRGIMKQKLASGDTNTALQLAERA 189

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLIARSLEN 236
             + P    V + ++Q      +W+ A   L  K K+       + R  A+L ++++ E 
Sbjct: 190 FALKPKHEEVQDTLLQLQAEKADWTGARKTLQAKLKHGTLPRDVYKRRDAVLALSQATEI 249

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            ++ + IA+   AIE+ +   + + A+  AA++ I+Q + R A  +L+K W+ +PHP++A
Sbjct: 250 ENRDESIAAAEKAIEANRNSPDLVPAAAKAARAYIAQKRPRNAIRVLKKAWETHPHPDLA 309

Query: 297 NIYTHLLSENTVG-KLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             Y  +    T   ++KR + L  IN +  E+ ++ +++ L      +A       ++  
Sbjct: 310 AAYAEIEPNETPDERIKRFVPLTRINPDHRETRLLKAELNLAAEHFPEARRSLGDLVEKE 369

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLPLSPISKT 414
           P   +  ++A IE+        +  W   A+ A   P W+ D+   +   W P       
Sbjct: 370 PDARVLAIMAAIEKGEGAPDQVVRGWLAKAVTAPRGPQWVCDNCKTIHGEWRPTCTNCGA 429

Query: 415 LCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDSTI 474
                WK P +S   + ++     L +    D   +          P +  VS  E    
Sbjct: 430 FDTLSWKTPAQSEVVLPAQANMLPLIIGALEDKSPAEDPAVVPEANPGMIDVSPVERE-- 487

Query: 475 HPLDPHIRQPDD 486
            P  P   +P D
Sbjct: 488 -PKAPDATEPAD 498


>gi|254438357|ref|ZP_05051851.1| HemY N-terminal domain protein [Octadecabacter antarcticus 307]
 gi|198253803|gb|EDY78117.1| HemY N-terminal domain protein [Octadecabacter antarcticus 307]
          Length = 475

 Score =  434 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 94/475 (19%), Positives = 175/475 (36%), Gaps = 28/475 (5%)

Query: 13  LVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILL-------FAVSRFF 65
                  ++       +I  G +    S   +   L   +    L+        A  +F 
Sbjct: 2   AATFGATMLLEMEGSATIDIGGQAASFSVIEMAIGLIILVALVWLVSKLVGLAVAAFKFL 61

Query: 66  LSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLL 125
                 +     +    KGY+AL  G++++A+    LA  M      +       L  LL
Sbjct: 62  NGDETAISRYFSRNRERKGYEALSEGMLALASGEGRLA--MAKANRAEKFLERPELTNLL 119

Query: 126 EVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISP 185
             Q A        A      +L    TR   V  +  +  + GD ++A   A KA  I P
Sbjct: 120 TAQAAELAGDRKTAELTYRKLLANDKTRFVGVRGIMKQKLQDGDTDTALLLAQKAFAIKP 179

Query: 186 DAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILLIARSLENADKGD 241
                 + +++      +W  A   L  K K  +       R  A+L ++ +     +G 
Sbjct: 180 KHVETQDTLLRLQAEKSDWKGARETLTAKLKTGQLPRNVHRRRDAVLALSEAKGVFAEGA 239

Query: 242 MIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTH 301
            + +   AIE+ ++  + + A++ AA+S +++N  R A  +++K W + PHP++A  +  
Sbjct: 240 TLEAQEAAIEANRMSPDLVPAAVMAAQSHVNKNADRAATRVIKKAWDIAPHPDLAAAFAA 299

Query: 302 LLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEI 360
           +   E+   +LKR   L + + +  E+ ++++++ L      +A       +   P    
Sbjct: 300 IAPHEDPAVRLKRFGALTKAHPDHPETRMLLAELNLAAEDFPEARRAITELVAQDPTARS 359

Query: 361 FLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLPLSPISKTLCYFE 419
             ++A IE+        +  W   AL A   P WI D+  ++   W+P+           
Sbjct: 360 LTIMAAIERGEGSTDAVVRGWLSKALIATRGPQWICDNCQHIHPAWVPVCVNCSGFDTLA 419

Query: 420 WKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDSTI 474
           W+ P K              E+A PA      L  GK         V   E   +
Sbjct: 420 WREPPKG-------------EVAMPAGVEMLPLIVGKIEPSKDTTDVEILEAEVV 461


>gi|265982894|ref|ZP_06095629.1| HemY domain-containing protein [Brucella sp. 83/13]
 gi|264661486|gb|EEZ31747.1| HemY domain-containing protein [Brucella sp. 83/13]
          Length = 539

 Score =  432 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 131/492 (26%), Positives = 232/492 (47%), Gaps = 15/492 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 3   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 62

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 63  LVKSLVQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 122

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 123 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 182

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++          + RA LL A+++  
Sbjct: 183 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 242

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D      +    +E+ KL  + + A++ AA++L +  + RK   ILE  WK  PHP+IA
Sbjct: 243 LD-THHAHAKAIVLEANKLAPDLVPAAVIAARALFADGEIRKGSKILEAAWKRFPHPDIA 301

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A   ++ A
Sbjct: 302 ATYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQVLRAA 361

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP++  L
Sbjct: 362 PRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSPVTGRL 420

Query: 416 CYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDSTIH 475
             FEWK+P           +  ++E+  P                       S  +    
Sbjct: 421 NSFEWKVPVV--------ELAPAIEVEKPEIKAPLPEIKAAAPISAPESTRESASELVAE 472

Query: 476 PLDPHIRQPDDP 487
           P+   +R+   P
Sbjct: 473 PVPAPVRETAAP 484


>gi|254717951|ref|ZP_05179762.1| hypothetical protein Bru83_00095 [Brucella sp. 83/13]
 gi|306838961|ref|ZP_07471785.1| HemY domain protein [Brucella sp. NF 2653]
 gi|306405964|gb|EFM62219.1| HemY domain protein [Brucella sp. NF 2653]
          Length = 537

 Score =  432 bits (1110), Expect = e-119,   Method: Composition-based stats.
 Identities = 131/492 (26%), Positives = 232/492 (47%), Gaps = 15/492 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 1   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 61  LVKSLVQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 121 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++          + RA LL A+++  
Sbjct: 181 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D      +    +E+ KL  + + A++ AA++L +  + RK   ILE  WK  PHP+IA
Sbjct: 241 LD-THHAHAKAIVLEANKLAPDLVPAAVIAARALFADGEIRKGSKILEAAWKRFPHPDIA 299

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A   ++ A
Sbjct: 300 ATYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQVLRAA 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP++  L
Sbjct: 360 PRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSPVTGRL 418

Query: 416 CYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDSTIH 475
             FEWK+P           +  ++E+  P                       S  +    
Sbjct: 419 NSFEWKVPVV--------ELAPAIEVEKPEIKAPLPEIKAAAPISAPESTRESASELVAE 470

Query: 476 PLDPHIRQPDDP 487
           P+   +R+   P
Sbjct: 471 PVPAPVRETAAP 482


>gi|294679027|ref|YP_003579642.1| HemY domain-containing protein [Rhodobacter capsulatus SB 1003]
 gi|294477847|gb|ADE87235.1| HemY domain protein [Rhodobacter capsulatus SB 1003]
          Length = 480

 Score =  431 bits (1109), Expect = e-118,   Method: Composition-based stats.
 Identities = 91/477 (19%), Positives = 170/477 (35%), Gaps = 15/477 (3%)

Query: 2   LRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLF-------A 54
           +++  +  V+  +      +S   E + I              + ++   +         
Sbjct: 6   IKISLFVAVVVGLAFGAAWLSDLGETIRIIAFGIELNLGALQAVILIGLAILTIWLALKV 65

Query: 55  WILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQH 114
              +FA  RF       +     +    KGY+AL  G++++A+    LA         + 
Sbjct: 66  LGFVFAFIRFVTGDETAISRYFDRNRERKGYEALAEGMLAVASGESKLAA--SKASKAER 123

Query: 115 TFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQ 174
                 L  LL  Q A+       A E    +L    TR   V  L  +    GD ++A 
Sbjct: 124 YLRRPELTNLLTAQAAMMNGDTRKAEEVYRKLLADQRTRFVGVQGLLSQKLAEGDTDTAV 183

Query: 175 RYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLI 230
           + A KA  ++P    V   + +      +W  A   L  K +          R  A+L +
Sbjct: 184 KLAQKAFALNPKNLEVQNTLFKLQTEVGDWKGARDVLLAKMRQGQLPKDVHKRRDAVLAL 243

Query: 231 ARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
             +    D G  I +   AI + K   + I A+  AAK+   +   + A  +L K W+  
Sbjct: 244 QEAKAVLDGGTSIEAQEAAIAAAKASPDLIPAAAMAAKAHYDKGDAKSATRVLLKAWEAQ 303

Query: 291 PHPEIANIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAM 349
           PHP++A ++  ++  E+   +LKR  +L  +  +  E+ ++ +++ +       A     
Sbjct: 304 PHPDLAAVFASMVPGESATERLKRFEKLLSLRPDHEETRLLRAELCIAAEDFPAARRALG 363

Query: 350 LAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISD-DGYLSSVWLPL 408
             ++  P   +  L+A IE+    +   +  W   AL A     W  D    + S W P+
Sbjct: 364 NLVEANPTSRVLTLMAAIERGEGEDDAVVRGWLAKALTAPRGKQWCCDKCQNIQSQWGPV 423

Query: 409 SPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKK 465
                      W+ P  +   + +      L +A            G    L   +K
Sbjct: 424 CDNCGGFDTLSWREPAHNNMPLPNGAEMLPLIVAKGTKADAGATLEGTARALNEREK 480


>gi|310817089|ref|YP_003965053.1| HemY domain protein [Ketogulonicigenium vulgare Y25]
 gi|308755824|gb|ADO43753.1| HemY domain protein [Ketogulonicigenium vulgare Y25]
          Length = 514

 Score =  429 bits (1104), Expect = e-118,   Method: Composition-based stats.
 Identities = 98/505 (19%), Positives = 193/505 (38%), Gaps = 21/505 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWILLF 59
           +L+++ +  +++ V    + ++  P    +T G       P   +++I    L  W +L 
Sbjct: 5   LLKILTFVVIVTGVTAGAVWLAEMPGGAVVTLGGVEVTLRPLESVVAIAIVMLLFWAVLR 64

Query: 60  AVSR------FFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
            +        F       +     +    KG KAL   ++++AA     A        + 
Sbjct: 65  LLGLLLAVLRFINGDDTAVSRYFSRGRERKGMKALSDSVLALAAGEAKEALARAKVADK- 123

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  + ++L    A    + ++A E  + +L    TR  A+  L  +    GD  +A
Sbjct: 124 -YLGAPDVTHVLLAHTAERAGETHLAEETYKELLTSDRTRFVALQGLMKQKLTAGDTVTA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
            + A  A    P+   V + +++    + +W+ A   L +K +        + R  A+L 
Sbjct: 183 LKLAEAAFKARPENVEVQDVLLRLQAESSDWAGARATLGEKARRGALPRDVYRRRDAVLA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           ++ +    D    I +   AIE+ +L  + + A++ AA+S I     R A  +L K W+V
Sbjct: 243 LSEAQAVFDDKVPIDARERAIEANRLSPDLVPAAVMAARSYIKDGNPRYATRVLRKAWEV 302

Query: 290 NPHPEIANIYTHLLSENTVG-KLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A  +  ++ +     +L R   L  +  +  E+ ++ +++ +  G    A    
Sbjct: 303 QPHPDLAEAFAEIMPDERPDQRLARFETLTNLRTDHAENKMLRAELLIANGDFPAARRAL 362

Query: 349 MLAMK-IAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISD-DGYLSSVWL 406
              ++          L+A IE+    +   +  W   AL A   P W+    G + + WL
Sbjct: 363 GELVEGADATSRSLALMAAIERGMGADESVVRGWLTRALTAPRGPQWVCGQCGKVHAQWL 422

Query: 407 PLSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPAD--DLQSMLNNGKKNHLPSI- 463
           P+           W  P  S   +        L +  P    DL   +        P+  
Sbjct: 423 PVCASCHGFDTLAWTTPPASDFAMPGGAAMLPLIVGAPVAPVDLSGDVVEQAVKPAPTPA 482

Query: 464 --KKVSSFEDSTIHPLDPHIRQPDD 486
              KV   E+  I P  P +  P++
Sbjct: 483 PQTKVEDAEEEVILPPPPDVELPEE 507


>gi|254504335|ref|ZP_05116486.1| HemY N-terminal domain protein [Labrenzia alexandrii DFL-11]
 gi|222440406|gb|EEE47085.1| HemY N-terminal domain protein [Labrenzia alexandrii DFL-11]
          Length = 660

 Score =  428 bits (1102), Expect = e-118,   Method: Composition-based stats.
 Identities = 116/484 (23%), Positives = 225/484 (46%), Gaps = 11/484 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++ +F ++ L    F  ++  P  +S++W   ++   P V+  ++   L A++++  
Sbjct: 11  MIRVLIFFAMLFLAALGFAWMADLPGTISVSWNGYVWEQPPVVVALVVGLVLVAFLVVIG 70

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V R  L  P +      +R  DKGY AL  GL+++   N  +AR+    +      + E 
Sbjct: 71  VIRAILKSPQIAGRFFKQRRKDKGYTALSQGLIALGTGNAKMARRY--GLDADKLLNEEP 128

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
              LL  Q A    +   A ++ E ML  P T+   ++ L+ E+ R  +  +A+ YA +A
Sbjct: 129 ATKLLLAQTAQLAGKDGEARQRFEAMLDDPNTKTLGLHGLFVEAERQREPVAARHYAEEA 188

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQ----KKKNAKEWNRNRAILLIARSLEN 236
           +  +P   W  +AV+    +A  W  A+  L +    K  + K + R RA++L A +   
Sbjct: 189 VKAAPGLEWAGKAVLGYQAVAHHWDEALKTLERNYTSKLLDKKAYRRQRAVILTALA-HK 247

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            +  D   ++  A E+  L    + A++  ++    +   RKA  ++E  W+++PHPE+A
Sbjct: 248 LEDNDPDRAFSLAKEAHGLALELVPAAVITSRLATRRGDIRKASKVIEATWRLSPHPELA 307

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             Y+H+   ++ V +LKRA  L      + E  + ++K ALE    ++A  +    ++  
Sbjct: 308 ETYSHVRTGDSAVDRLKRAKSLAAQRANTAEGAIAIAKAALEAREFEEARTQLKKVLQSE 367

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           P +  F+L+A++E+  + +  ++  W   A+ A  D  WI+ DG +SS W  +SP++  L
Sbjct: 368 PTRAAFILMAEVEETETGDKGRVRDWLARAVKASLDKAWIA-DGVVSSEWQAVSPVTGKL 426

Query: 416 CYFEWKIPTKSPE--YISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDST 473
             F+W  P    E   +  E+  F   +   +   +       +  + +  +     D  
Sbjct: 427 DAFQWSSPGSLNEEDGVLLEDSLFEAPVLPASTLAKDPAAEPVEPVVTAASQSKDASDEK 486

Query: 474 IHPL 477
               
Sbjct: 487 PEEA 490


>gi|83950381|ref|ZP_00959114.1| HemY domain protein [Roseovarius nubinhibens ISM]
 gi|83838280|gb|EAP77576.1| HemY domain protein [Roseovarius nubinhibens ISM]
          Length = 525

 Score =  428 bits (1100), Expect = e-117,   Method: Composition-based stats.
 Identities = 104/493 (21%), Positives = 193/493 (39%), Gaps = 15/493 (3%)

Query: 2   LRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVIL-------SILYFFLFA 54
           ++++ +  +I     + + +      V I         +P   +        +L+  L  
Sbjct: 6   IKIVVFLGLILAASFAAMHLLSLEGGVRIVMAGYEVNLTPLNAIITLALLLLMLWLLLKL 65

Query: 55  WILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQH 114
             LL A+ RF       +     +   +KGY+AL  G+M++A+    LA  M      + 
Sbjct: 66  GALLVALLRFINGDETAMSRYFDRNRQEKGYRALTEGMMALASGEGKLA--MSRAARAEK 123

Query: 115 TFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQ 174
             H   L  LL  Q A        A E  + +L+   TR   V  L  +    GD ++A 
Sbjct: 124 YLHKPELTNLLTAQAAELTGDRRTAEEVYKRLLKDDKTRFVGVRGLLKQKIEEGDTDTAL 183

Query: 175 RYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLI 230
           + A  A  + P    V + ++Q      +W  A   LN K K+         R  AIL +
Sbjct: 184 KLAETAFGLKPTHEEVQDTLLQLQAGQADWKGARATLNAKLKHGSLPRDLHRRRDAILAL 243

Query: 231 ARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
           A + + A +   I +   AIE+ +L  + + A++ AA++ I    KR A  ++ K W+  
Sbjct: 244 AEARDIAAENSTIEAKETAIEANRLSPHLVPAAVMAAQAYIEDGSKRYATRVIRKAWESQ 303

Query: 291 PHPEIANIYTHLLSENTVG-KLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAM 349
           PHP++A  Y  +  + T   +LKR  +L +++ +  E+ ++ +++ +       A     
Sbjct: 304 PHPDLAAAYAAIEPDETPDQRLKRFAKLFKLSPDHPEAKLVEAELQIAAEDFPAARRALG 363

Query: 350 LAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLPL 408
              + AP      ++A IE+    N   +  W   A+ A   P WI ++  ++   W P 
Sbjct: 364 TLAETAPDARSLTIMAAIERGAGANDTVVKGWLARAVAAARGPQWICENCQHIHHEWAPT 423

Query: 409 SPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSS 468
                 +   EW+    +   + +      L +    +  QS     +     +    SS
Sbjct: 424 CAHCHAVDTLEWRNAPGAAPAMPTGVAMLPLIVGALEEPAQSPKAEPEAESPETDAATSS 483

Query: 469 FEDSTIHPLDPHI 481
                   +D  I
Sbjct: 484 GTAPEADIVDAEI 496


>gi|307942605|ref|ZP_07657953.1| HemY domain-containing protein [Roseibium sp. TrichSKD4]
 gi|307774244|gb|EFO33457.1| HemY domain-containing protein [Roseibium sp. TrichSKD4]
          Length = 656

 Score =  428 bits (1100), Expect = e-117,   Method: Composition-based stats.
 Identities = 122/489 (24%), Positives = 228/489 (46%), Gaps = 15/489 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++ +F ++  V      ++  P  VSI+W   ++   P V+  +L   L A++ +  
Sbjct: 1   MIRVLVFFALLFAVALGAARMADLPGVVSISWDGYVWEQPPVVVAVVLASLLAAFLFVVW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V R  L+ P +      +R  DKGY++L  GL+++   N  LAR+    +     F +E 
Sbjct: 61  VIRVILNSPKIATRFFRQRRKDKGYQSLSQGLIALGTGNAKLARR--HALDADKFFSDEP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
              LL  Q A    +   A ++ E ML  P TR   ++ L+ E+ + G+  +A+ YA +A
Sbjct: 119 ATKLLLAQTAQLAGKDEEARKRFEDMLADPQTRSLGLHGLFIEAEKQGEPAAARHYAEEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQ----KKKNAKEWNRNRAILLIARSLEN 236
           +   P   W   AV+    +A +W +A+  L +    K  + K + R RA++L A + + 
Sbjct: 179 VKAVPGLEWAGNAVLGYQAVASDWEQALQSLERNYSAKLLDKKSYRRQRAVILTAHARQL 238

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D+ D   ++ +A E+  L  N + A+  AA+    +   RKA  +LE  W++ PHPE+A
Sbjct: 239 EDQ-DPDKAFANAKEAHGLAQNLVPAATIAARLATRRGDIRKASKMLETTWRLAPHPELA 297

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y H+   ++ + +LKR   L      +    + +++ A+E    D+A  +    ++  
Sbjct: 298 DAYAHVRSGDSAIDRLKRVKALAGQRTNTAVGALAIARAAMEAREFDEAREQMKKVLRSE 357

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           P +  F+++A++E+    N  ++  W   A++A  D  WI+ DG + + W  +SP++  L
Sbjct: 358 PTRGAFMMMAEVEELEHGNRGRMREWLAKAVNAPLDKAWIA-DGVVQAEWAAVSPVTGQL 416

Query: 416 CYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDSTIH 475
             FEW  P       + E     +E +                    I  V   E++ + 
Sbjct: 417 DAFEWATP------NNVERETQVIEDSLFEAPQIMAQPAPTAELGDDIVDVDPAENAKVV 470

Query: 476 PLDPHIRQP 484
                 ++P
Sbjct: 471 NPPQEPKEP 479


>gi|227823721|ref|YP_002827694.1| hypthetical protein contains N-terminal HemY domain [Sinorhizobium
           fredii NGR234]
 gi|227342723|gb|ACP26941.1| hypthetical protein contains N-terminal HemY domain [Sinorhizobium
           fredii NGR234]
          Length = 541

 Score =  427 bits (1098), Expect = e-117,   Method: Composition-based stats.
 Identities = 164/529 (31%), Positives = 259/529 (48%), Gaps = 40/529 (7%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++ +  ++  +   F  ++  P ++S+ W  +L   S     +IL     A +++  
Sbjct: 1   MVRILFFILLVLALALGFAWLADRPGELSLIWQGQLIEMSLMRAATILISLFAAILIVAW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R     P  +      R  D+GY+AL TGL++  A +  LARKM        +   E 
Sbjct: 61  LIRTLWLSPHTVTRYFRARKRDRGYQALSTGLIAAGAGDAALARKMAGRTRGLISADQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L++LLE Q AL E +Y+ A +K E+M   P TRE  +  LY E+ R+G   +A++YA +A
Sbjct: 121 LIHLLEAQTALIEGKYDDARKKFELMADDPETRELGLRGLYLEAKRLGANEAARQYAERA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLEN 236
            + +P   W T A + Q   A +W  AI  L+Q +     + KE NR +A+LL AR+   
Sbjct: 181 AEKAPHLSWATLATLDQRSQAGQWDEAIRLLDQSRTANVLDKKEANRKKAVLLTARATGK 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            +  D  A+  DA+ +LKL D  + A++ AAK+L  ++  RK   +LEK+WK +PHPE+A
Sbjct: 241 LE-ADPKAARDDALAALKLDDRLVPAALTAAKALFREDNLRKGASVLEKVWKQDPHPELA 299

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
            +Y      ++ V +LKRA RLE +   +  SL  V++ ALE   +  A +KA  A ++A
Sbjct: 300 RLYVRARGGDSAVDRLKRAKRLETLRGNNAVSLATVAEAALEARELALARSKAEAAARLA 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           P + IFLL+A IE+A++ +  +I +W   AL +  DP W + DG  S  WLP+SP+S  L
Sbjct: 360 PSESIFLLIADIEEADTGDEGRIRHWMAQALRSPRDPAWTA-DGVTSPTWLPVSPVSGRL 418

Query: 416 CYFEWKIPT---------------------------------KSPEYISSENINFSLEMA 442
             FEWK P                                  ++P    +E     LE  
Sbjct: 419 DAFEWKEPPSPLAGTTEEGRVSVDEAIRSLPPVAPEHPVAVREAPATPKAEENGPVLEAE 478

Query: 443 YPADDLQSMLNNGKKNHLPSIKKVSSFEDSTIHPLDPHIRQPDDPGIKE 491
            P     ++    +K       K                R PDDPG+++
Sbjct: 479 RPIPTPTAITVPERKETAAPPSKSEGTAAEDEEAAPFFGRPPDDPGVRD 527


>gi|240137308|ref|YP_002961777.1| hypothetical protein MexAM1_META1p0562 [Methylobacterium extorquens
           AM1]
 gi|240007274|gb|ACS38500.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens AM1]
          Length = 511

 Score =  427 bits (1097), Expect = e-117,   Method: Composition-based stats.
 Identities = 114/492 (23%), Positives = 216/492 (43%), Gaps = 12/492 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R + +  ++++     + ++ +P  V++ W       S  + L+ +        L++A
Sbjct: 1   MWRALVFLALLAVAAYGAVWIADHPGTVTVVWNGYEIGMSLAIALTGVLVAAIVLGLIWA 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V    +  PA +     +R  +KG  +L  G++++ + +   AR+       +    ++ 
Sbjct: 61  VVTGVIGLPASISRSTRERRRNKGLASLSRGMIAVGSGDPLAARR--HAGDAERLLGSQP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL+ Q A      + A +  + M   P TR   +  L+ E+ R  D  +A+ YA++A
Sbjct: 119 LTLLLKAQAAQISGDRDAAEQAFKRMADDPETRVLGLRGLFVEARRREDEGAARAYASEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLEN 236
             ++P   W  EAV++      EWS A   + ++      +     R RA+LL A + + 
Sbjct: 179 ARLAPSVTWANEAVLEAQCADGEWSAATETVERRAALGLMDKHAARRQRAVLLTA-AAQR 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            + G+  ++   A++++KL  + + A++ A + L  +N  RKA  I+E  WK  PHPE+A
Sbjct: 238 HEAGEPDSATEQALKAVKLAPDLVPAAVIAGRLLARRNDLRKAAKIIEAAWKATPHPELA 297

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
            +Y +L   ++   +L RA  L +++    ES +++++ A E     +A           
Sbjct: 298 KVYLNLRTGDSARDRLARAENLAKLSSWEPESRLVIAQAATEAKDFGRAREALAPLTDDR 357

Query: 356 PRKEIFLLLAQIEQANSH-NTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKT 414
           P   +  ++A+IE A     + +   W   A  A  DP W++ DG +S  W P+SP+S  
Sbjct: 358 PTARVCRMMARIEAAEHGAESGRSREWLARAARAPRDPAWVA-DGIISERWAPVSPVSGR 416

Query: 415 LCYFEWKIPTKSPEYISSENINFS--LEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDS 472
           L  F WK P +       ++       E A P     + +        P+       +  
Sbjct: 417 LDAFVWKTPPEILAGPEDDDAPVPASAEPAAPVAIPTTPVPAPVTTDSPAPSTPGFLQTG 476

Query: 473 TIHPLDPHIRQP 484
              P  P    P
Sbjct: 477 AGTPSVPPTPAP 488


>gi|163850175|ref|YP_001638218.1| HemY domain-containing protein [Methylobacterium extorquens PA1]
 gi|163661780|gb|ABY29147.1| HemY domain protein [Methylobacterium extorquens PA1]
          Length = 511

 Score =  425 bits (1092), Expect = e-116,   Method: Composition-based stats.
 Identities = 118/496 (23%), Positives = 218/496 (43%), Gaps = 16/496 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R + +  ++++     + ++ +P  V++ W       S  + L+ +        L++A
Sbjct: 1   MWRALVFLALLAVAAYGAVWIADHPGTVTVVWNGYEIGMSLAIALTGVLVAAIVLGLIWA 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V    +  PA +     +R  +KG  +L  G++++ + +   AR+       +    ++ 
Sbjct: 61  VVTGVIGLPASISRSTRERRRNKGLASLSRGMIAVGSGDPLAARR--HAGDAERLLGSQP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL+ Q A      + A +  + M   P TR   +  L+ E+ R  D  +A+ YA++A
Sbjct: 119 LTLLLKAQAAQISGDRDAAEQAFKRMADDPETRVLGLRGLFVEARRREDEGAARAYASEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLEN 236
             ++P   W  EAV++      EWS A   + ++      +     R RA+LL A + + 
Sbjct: 179 ARLAPSVTWANEAVLEAQCADGEWSAATETVERRAALGLMDKHAARRQRAVLLTA-AAQR 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            + G+   +   A++++KL  + + A++ A + L  +N  RKA  I+E  WK  PHPE+A
Sbjct: 238 HEAGEPDTATEQALKAVKLAPDLVPAAVIAGRLLARRNDLRKAAKIIEAAWKATPHPELA 297

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
            +Y +L   ++   +L RA  L +++    ES +++++ A E     +A           
Sbjct: 298 KVYLNLRTGDSARDRLARAENLAKLSSWEPESRLVIAQAATEAKDFGRAREALAPLTDDR 357

Query: 356 PRKEIFLLLAQIEQANSH-NTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKT 414
           P   +  ++A+IE A     + +   W   A  A  DP W++ DG +S  W P+SP+S  
Sbjct: 358 PTARVCRMMARIEAAEHGAESGRSREWLARAARAPRDPAWVA-DGIISERWAPVSPVSGR 416

Query: 415 LCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDSTI 474
           L  F WK P   PE ++    + S   A         +       +P+     S   ST 
Sbjct: 417 LDAFVWKTP---PEILAGPEDDDSPAPASAEPAAPVAIPTT---PVPAPVTTDSPAPSTP 470

Query: 475 HPLDPHIRQPDDPGIK 490
             L      P  P   
Sbjct: 471 GFLQTGAGTPSVPSTP 486


>gi|218528780|ref|YP_002419596.1| HemY domain protein [Methylobacterium chloromethanicum CM4]
 gi|218521083|gb|ACK81668.1| HemY domain protein [Methylobacterium chloromethanicum CM4]
          Length = 511

 Score =  425 bits (1092), Expect = e-116,   Method: Composition-based stats.
 Identities = 113/492 (22%), Positives = 215/492 (43%), Gaps = 12/492 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R + +  ++++     + ++ +P  V++ W       S  + L+ +        L++A
Sbjct: 1   MWRALVFLALLAVAAYGAVWIADHPGTVTVVWNGYEIGMSLAIALTGVLVAAIVLGLIWA 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V    +  PA +     +R  +KG  +L  G++++ + +   AR+       +    ++ 
Sbjct: 61  VVTGVIGLPASISRSTRERRRNKGLASLSRGMIAVGSGDPLAARR--HAGDAERLLGSQP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL+ Q A      + A +  + M   P TR   +  L+ E+ R  D  +A+ YA++A
Sbjct: 119 LTLLLKAQAAQISGDRDAAEQAFKRMADDPETRVLGLRGLFVEARRREDEGAARAYASEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLEN 236
             ++P   W  EAV++      EWS A   + ++      +     R RA+LL A + + 
Sbjct: 179 ARLAPSVTWANEAVLEAQCADGEWSAATETVERRAALGLMDKHAARRQRAVLLTA-AAQR 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            + G+   +   A++++KL  + + A++ A + L  +N  RKA  I+E  WK  PHPE+A
Sbjct: 238 HEAGEPDTATEQALKAVKLAPDLVPAAVIAGRLLARRNDLRKAAKIIEAAWKATPHPELA 297

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
            +Y +L   ++   +L RA  L +++    ES +++++ A E     +A           
Sbjct: 298 KVYLNLRTGDSARDRLARAENLAKLSSWEPESRLVIAQAATEAKDFGRAREALAPLTDDR 357

Query: 356 PRKEIFLLLAQIEQANSH-NTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKT 414
           P   +  ++A+IE A     + +   W   A  A  DP W++ DG +S  W P+SP+S  
Sbjct: 358 PTARVCRMMARIEAAEHGAESGRSREWLARAARAPRDPAWVA-DGIISERWAPVSPVSGR 416

Query: 415 LCYFEWKIPTKSPEYISSENINFS--LEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDS 472
           L  F WK P +       ++       E + P     + +        P+       +  
Sbjct: 417 LDAFVWKTPPEILAGPEDDDAPVPASAEPSAPVAIPTTPVPARVTTDSPAPSTPGFLQTG 476

Query: 473 TIHPLDPHIRQP 484
              P  P    P
Sbjct: 477 AGTPSVPPTPAP 488


>gi|17986463|ref|NP_539097.1| hypothetical protein BMEI0179 [Brucella melitensis bv. 1 str. 16M]
 gi|265991915|ref|ZP_06104472.1| HemY domain-containing protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993646|ref|ZP_06106203.1| HemY domain-containing protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265999298|ref|ZP_05465724.2| HemY domain-containing protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|17982061|gb|AAL51361.1| hypothetical protein BMEI0179 [Brucella melitensis bv. 1 str. 16M]
 gi|262764627|gb|EEZ10548.1| HemY domain-containing protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002981|gb|EEZ15274.1| HemY domain-containing protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093114|gb|EEZ17249.1| HemY domain-containing protein [Brucella melitensis bv. 2 str.
           63/9]
          Length = 525

 Score =  425 bits (1092), Expect = e-116,   Method: Composition-based stats.
 Identities = 136/512 (26%), Positives = 237/512 (46%), Gaps = 22/512 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 3   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 62

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 63  LVKSLVQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 122

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 123 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 182

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++          + RA LL A+++  
Sbjct: 183 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 242

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D      +   A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  PHP+IA
Sbjct: 243 LD-THHAHAKAIALEANKLAPDLVPAAVVAARALFADGEIRKGSKILEAAWKRFPHPDIA 301

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A   ++ A
Sbjct: 302 STYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQVLRAA 361

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP++  L
Sbjct: 362 PRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSPVTGRL 420

Query: 416 CYFEWKIPT---KSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDS 472
             FEWK+P         +    I   L        + +      +     +      E  
Sbjct: 421 NSFEWKVPVVELAPAIEVEKPEIKAPLPEVKAVAPISAPELEPVRETAAPVGARDVVEAE 480

Query: 473 TIHPLDPHIRQ------------PDDPGIKEQ 492
            I P    +               DDPGI + 
Sbjct: 481 VIVPAAEPVSADEPVKAGPAHIVVDDPGIDDD 512


>gi|225853321|ref|YP_002733554.1| HemY domain-containing protein [Brucella melitensis ATCC 23457]
 gi|256045493|ref|ZP_05448376.1| hypothetical protein Bmelb1R_13396 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256112219|ref|ZP_05453140.1| hypothetical protein Bmelb3E_05957 [Brucella melitensis bv. 3 str.
           Ether]
 gi|260562802|ref|ZP_05833288.1| HemY domain-containing protein [Brucella melitensis bv. 1 str. 16M]
 gi|225641686|gb|ACO01600.1| HemY domain protein [Brucella melitensis ATCC 23457]
 gi|260152818|gb|EEW87910.1| HemY domain-containing protein [Brucella melitensis bv. 1 str. 16M]
 gi|326409884|gb|ADZ66949.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326539598|gb|ADZ87813.1| HemY domain protein [Brucella melitensis M5-90]
          Length = 523

 Score =  424 bits (1090), Expect = e-116,   Method: Composition-based stats.
 Identities = 136/512 (26%), Positives = 237/512 (46%), Gaps = 22/512 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 1   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 61  LVKSLVQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 121 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++          + RA LL A+++  
Sbjct: 181 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D      +   A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  PHP+IA
Sbjct: 241 LD-THHAHAKAIALEANKLAPDLVPAAVVAARALFADGEIRKGSKILEAAWKRFPHPDIA 299

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A   ++ A
Sbjct: 300 STYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQVLRAA 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP++  L
Sbjct: 360 PRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSPVTGRL 418

Query: 416 CYFEWKIPT---KSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDS 472
             FEWK+P         +    I   L        + +      +     +      E  
Sbjct: 419 NSFEWKVPVVELAPAIEVEKPEIKAPLPEVKAVAPISAPELEPVRETAAPVGARDVVEAE 478

Query: 473 TIHPLDPHIRQ------------PDDPGIKEQ 492
            I P    +               DDPGI + 
Sbjct: 479 VIVPAAEPVSADEPVKAGPAHIVVDDPGIDDD 510


>gi|254559413|ref|YP_003066508.1| hypothetical protein METDI0838 [Methylobacterium extorquens DM4]
 gi|254266691|emb|CAX22471.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens DM4]
          Length = 511

 Score =  423 bits (1088), Expect = e-116,   Method: Composition-based stats.
 Identities = 112/492 (22%), Positives = 213/492 (43%), Gaps = 12/492 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R + +  ++++     + ++ +P  V++ W       S  + L+ +        L++A
Sbjct: 1   MWRALVFLALLAVAAYGAVWIADHPGTVTVVWSGYEIGMSLAIALTGVLVAAIVLGLIWA 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V    +  PA +     +R  +KG  +L  G++++ + +   AR+       +    ++ 
Sbjct: 61  VVTGVIGLPASISRSTRERRRNKGLASLSRGMIAVGSGDPLAARR--HAGDAERLLGSQP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL+ Q A      + A +  + M   P TR   +  L+ E+ R  D  +A+ YA++A
Sbjct: 119 LTLLLKAQAAQISGDRDAAEQAFKRMADDPETRVLGLRGLFVEARRREDEGAARAYASEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLEN 236
             ++P   W  EAV++      EWS A   + ++      +     R RA+LL A + + 
Sbjct: 179 ARLAPSVTWANEAVLEAQCADGEWSAATETVERRAALGLMDKHAARRQRAVLLTA-AAQR 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            + G+   +   A++++KL  + + A++ A + L  +N  RKA  I+E  WK  PHPE+A
Sbjct: 238 HEAGEPDTATEQALKAVKLAPDLVPAAVIAGRLLARRNDLRKAAKIIEAAWKATPHPELA 297

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
            +Y +L   ++   +L RA  L +++    ES +++++ A E     +A           
Sbjct: 298 KVYLNLRTGDSARDRLARAENLAKLSSWEPESRLVIAQAATEAKDFGRAREALAPLTDDR 357

Query: 356 PRKEIFLLLAQIEQANSH-NTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKT 414
           P   +  ++A+IE A     + +   W   A  A  DP W++ DG +S  W P+SP+S  
Sbjct: 358 PTARVCRMMARIEAAEHGAESGRSREWLARAARAPRDPAWVA-DGIISERWAPVSPVSGR 416

Query: 415 LCYFEWKIPTKSPEYISSENINFSLEMAYPADD--LQSMLNNGKKNHLPSIKKVSSFEDS 472
           L  F WK P +       ++          A      + +        P+       +  
Sbjct: 417 LDAFVWKTPPEILAGPEDDDAPAPASAEPAAPVAIPTTPVPAPVTTDSPAPSTPGFLQTG 476

Query: 473 TIHPLDPHIRQP 484
              P  P    P
Sbjct: 477 AGTPSVPPTPAP 488


>gi|261755593|ref|ZP_05999302.1| HemY domain-containing protein [Brucella suis bv. 3 str. 686]
 gi|261745346|gb|EEY33272.1| HemY domain-containing protein [Brucella suis bv. 3 str. 686]
          Length = 525

 Score =  419 bits (1078), Expect = e-115,   Method: Composition-based stats.
 Identities = 133/495 (26%), Positives = 234/495 (47%), Gaps = 11/495 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 3   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 62

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 63  LVKSLVQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 122

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 123 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 182

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++          + RA LL A+++  
Sbjct: 183 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 242

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D      +   A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  PHP+IA
Sbjct: 243 LD-THHTHAKAIALEANKLAPDLVPAAVVAARALFADGEIRKGSKILEAAWKRFPHPDIA 301

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A   ++ A
Sbjct: 302 STYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQVLRAA 361

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP++  L
Sbjct: 362 PRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSPVTGRL 420

Query: 416 CYFEWKIPT---KSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDS 472
             FEWK+P         +    I   L        + +      +     +      E  
Sbjct: 421 NSFEWKVPVVELAPAIEVEKPEIKAPLPEVKAVAPISAPELEPVRETAAPVGARDVVEAE 480

Query: 473 TIHPLDPHIRQPDDP 487
            I P    +   D+P
Sbjct: 481 VIVPAAEPVSA-DEP 494


>gi|260567627|ref|ZP_05838097.1| HemY domain-containing protein [Brucella suis bv. 4 str. 40]
 gi|260157145|gb|EEW92225.1| HemY domain-containing protein [Brucella suis bv. 4 str. 40]
          Length = 523

 Score =  419 bits (1077), Expect = e-115,   Method: Composition-based stats.
 Identities = 134/495 (27%), Positives = 235/495 (47%), Gaps = 11/495 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 1   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +Q +   E 
Sbjct: 61  LVKSLVQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKQLSSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 121 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++          + RA LL A+++  
Sbjct: 181 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D      +   A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  PHP+IA
Sbjct: 241 LD-THHTHAKAIALEANKLAPDLVPAAVVAARALFADGEIRKGSKILEAAWKRFPHPDIA 299

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A   ++ A
Sbjct: 300 STYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQVLRAA 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP++  L
Sbjct: 360 PRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSPVTGRL 418

Query: 416 CYFEWKIPT---KSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDS 472
             FEWK+P         +    I   L        + +      +     +      E  
Sbjct: 419 NSFEWKVPVVELAPAIEVEKPEIKAPLPEVKAVAPISAPELEPVRETAAPVGARDVVEAE 478

Query: 473 TIHPLDPHIRQPDDP 487
            I P    +   D+P
Sbjct: 479 VIVPAAEPVSA-DEP 492


>gi|188579976|ref|YP_001923421.1| HemY domain protein [Methylobacterium populi BJ001]
 gi|179343474|gb|ACB78886.1| HemY domain protein [Methylobacterium populi BJ001]
          Length = 511

 Score =  418 bits (1076), Expect = e-115,   Method: Composition-based stats.
 Identities = 109/485 (22%), Positives = 215/485 (44%), Gaps = 21/485 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R + +  ++++     + ++ +P  V++ W      TS  + L+ +        L++A
Sbjct: 1   MWRALVFLALLAVAAYGAVWIADHPGTVTVVWNGYEIGTSLAIALTGVLVAAIILGLIWA 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +    +  PA +     +R  +KG  +L  G++++ + +   AR+       +    ++ 
Sbjct: 61  IVTGVIGLPASISRSTRERRRNKGLASLSRGMIAVGSGDPLAARR--HAGDAERLLGSQP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL+ Q A      + A +  + M   P TR   +  L+ E+ R  D  +A+ YA +A
Sbjct: 119 LTLLLKAQAAQISGDRDAAEQAFKRMADDPETRVLGLRGLFVEARRREDEGAARAYAAEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLEN 236
             ++P   W  EAV++      EWS A   + ++      +     R RA+LL A + + 
Sbjct: 179 ARLAPSVTWANEAVLEAQCADGEWSAATETVERRAALGLMDKHAARRQRAVLLTA-AAQR 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            + G+   +   A++++KL  + + A++ A + L  +N  RKA  I+E  WK  PHPE+ 
Sbjct: 238 HEAGEPETATEQALKAVKLAPDLVPAAVIAGRLLARRNDLRKAAKIIEAAWKATPHPELG 297

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
            +Y +L   ++   +L RA  L +++    ES +++++ A E     +A       +   
Sbjct: 298 KVYLNLRTGDSARDRLARAETLAKLSSWDPESRLVIAQAASESKDFARAREVLAPLVDDR 357

Query: 356 PRKEIFLLLAQIEQANSH-NTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKT 414
           P   +  ++A+IE A    ++ +   W   A  A  DP W++ DG +S  W P+SP++  
Sbjct: 358 PTSRVCRMMARIEAAEHGADSGRSREWLARAARAPRDPAWVA-DGVVSERWAPVSPVTGR 416

Query: 415 LCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDSTI 474
           L  F WK P +       E+ +  +  +                 +P+    +     + 
Sbjct: 417 LDAFVWKTPPEI--LAGPEDDDAPVPASP---------EPTAPAAIPASSGPAPITTDSP 465

Query: 475 HPLDP 479
            P  P
Sbjct: 466 APSTP 470


>gi|23502736|ref|NP_698863.1| hypothetical protein BR1884 [Brucella suis 1330]
 gi|254704899|ref|ZP_05166727.1| hypothetical protein Bsuib36_13470 [Brucella suis bv. 3 str. 686]
 gi|23348752|gb|AAN30778.1| conserved hypothetical protein [Brucella suis 1330]
          Length = 523

 Score =  418 bits (1076), Expect = e-115,   Method: Composition-based stats.
 Identities = 133/495 (26%), Positives = 234/495 (47%), Gaps = 11/495 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 1   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 61  LVKSLVQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 121 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++          + RA LL A+++  
Sbjct: 181 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D      +   A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  PHP+IA
Sbjct: 241 LD-THHTHAKAIALEANKLAPDLVPAAVVAARALFADGEIRKGSKILEAAWKRFPHPDIA 299

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A   ++ A
Sbjct: 300 STYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQVLRAA 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP++  L
Sbjct: 360 PRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSPVTGRL 418

Query: 416 CYFEWKIPT---KSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDS 472
             FEWK+P         +    I   L        + +      +     +      E  
Sbjct: 419 NSFEWKVPVVELAPAIEVEKPEIKAPLPEVKAVAPISAPELEPVRETAAPVGARDVVEAE 478

Query: 473 TIHPLDPHIRQPDDP 487
            I P    +   D+P
Sbjct: 479 VIVPAAEPVSA-DEP 492


>gi|91974947|ref|YP_567606.1| HemY-like [Rhodopseudomonas palustris BisB5]
 gi|91681403|gb|ABE37705.1| HemY-like [Rhodopseudomonas palustris BisB5]
          Length = 588

 Score =  418 bits (1076), Expect = e-115,   Method: Composition-based stats.
 Identities = 121/502 (24%), Positives = 220/502 (43%), Gaps = 21/502 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR+I +  +I+L       V+  P DV ++W +        V +  L   + + +L +A
Sbjct: 1   MLRIILFLVIIALAAAGAAWVAEQPGDVVLSWNDWRAEMRLPVFVLGLGAAIVSIVLAWA 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +       P+ +     +R   +   A+  GL+++   +   AR   S   +     ++ 
Sbjct: 61  IITGLWRAPSRMKRGRFERRSGRARHAITQGLLAVGHGDAAAARNHASAARRHA--PHDP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL+ Q A  E   + A      M     T+   +  LY E+ R  D   A   A +A
Sbjct: 119 LALLLQAQSAQLEGDRDGARRAFLAMAGRDDTKSLGMRGLYIEAQRADDPYGALAIAEEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLIARSLEN 236
           L + P++ W ++AV+       +WS A+  L     +     K + R RA+LL AR+++ 
Sbjct: 179 LRLQPNSTWASQAVLGFRCARADWSGALDILETNLSSGLVDKKVFRRQRAVLLTARAIDL 238

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D  D   +   A+E+ KL    I A++ AAK L   ++ R+A  ++E  W+  PHP++A
Sbjct: 239 ED-SDESLARDSALEANKLAPTLIPAAVLAAKCLAETHQVRRAMKVIEAAWQAQPHPDLA 297

Query: 297 NIYTHLLSENTVG-KLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             Y ++   +    +L R   L   N    ES + +++  ++ G   +A           
Sbjct: 298 AAYANIKPGDPANIRLARVQNLIAKNPADFESALAIARAGIDAGEFSRARRALQ-PFIDN 356

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           P + + +L+A+IE     +T K   WT  A+ A+PD +W + DGY S  W P+SP++  L
Sbjct: 357 PTQRVAMLMAEIEHGERGDTAKARAWTLRAVRALPDAMWTA-DGYTSDHWRPVSPVTGRL 415

Query: 416 CYFEWKIPTKSPEYISS----------ENINFSLEMAYPADDLQSMLNNGKKNHLPSIKK 465
             F+W++P  +     +            I  S   A PA +    +    ++ + +   
Sbjct: 416 DAFQWQVPIAALPARKAVVIEDNPFHDALIASSATEALPAANAHDPVTVTIESVVETTVV 475

Query: 466 VSSFEDSTIHPLDPHIRQPDDP 487
                ++T+  ++P     D P
Sbjct: 476 APKQAEATVVTVEPEAAA-DKP 496


>gi|237816247|ref|ZP_04595240.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|260755565|ref|ZP_05867913.1| HemY domain-containing protein [Brucella abortus bv. 6 str. 870]
 gi|260758788|ref|ZP_05871136.1| HemY domain-containing protein [Brucella abortus bv. 4 str. 292]
 gi|260760512|ref|ZP_05872855.1| HemY domain-containing protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884589|ref|ZP_05896203.1| HemY domain-containing protein [Brucella abortus bv. 9 str. C68]
 gi|261214836|ref|ZP_05929117.1| HemY domain-containing protein [Brucella abortus bv. 3 str. Tulya]
 gi|261323831|ref|ZP_05963028.1| HemY domain-containing protein [Brucella neotomae 5K33]
 gi|261751032|ref|ZP_05994741.1| HemY domain-containing protein [Brucella suis bv. 5 str. 513]
 gi|237788314|gb|EEP62529.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|260669106|gb|EEX56046.1| HemY domain-containing protein [Brucella abortus bv. 4 str. 292]
 gi|260670944|gb|EEX57765.1| HemY domain-containing protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675673|gb|EEX62494.1| HemY domain-containing protein [Brucella abortus bv. 6 str. 870]
 gi|260874117|gb|EEX81186.1| HemY domain-containing protein [Brucella abortus bv. 9 str. C68]
 gi|260916443|gb|EEX83304.1| HemY domain-containing protein [Brucella abortus bv. 3 str. Tulya]
 gi|261299811|gb|EEY03308.1| HemY domain-containing protein [Brucella neotomae 5K33]
 gi|261740785|gb|EEY28711.1| HemY domain-containing protein [Brucella suis bv. 5 str. 513]
          Length = 525

 Score =  418 bits (1075), Expect = e-115,   Method: Composition-based stats.
 Identities = 133/495 (26%), Positives = 234/495 (47%), Gaps = 11/495 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 3   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 62

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 63  LVKSLVQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 122

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 123 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 182

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++          + RA LL A+++  
Sbjct: 183 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 242

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D      +   A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  PHP+IA
Sbjct: 243 LD-THHAHAKAIALEANKLAPDLVPAAVVAARALFADGEIRKGSKILEAAWKRFPHPDIA 301

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A   ++ A
Sbjct: 302 STYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQVLRAA 361

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP++  L
Sbjct: 362 PRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSPVTGRL 420

Query: 416 CYFEWKIPT---KSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDS 472
             FEWK+P         +    I   L        + +      +     +      E  
Sbjct: 421 NSFEWKVPVVELAPAIEVEKPEIKAPLPEVKAVAPISAPELEPVRETAAPVGARDVVEAE 480

Query: 473 TIHPLDPHIRQPDDP 487
            I P    +   D+P
Sbjct: 481 VIVPAAEPVSA-DEP 494


>gi|306842962|ref|ZP_07475596.1| HemY domain protein [Brucella sp. BO2]
 gi|306286890|gb|EFM58415.1| HemY domain protein [Brucella sp. BO2]
          Length = 523

 Score =  418 bits (1075), Expect = e-115,   Method: Composition-based stats.
 Identities = 133/495 (26%), Positives = 232/495 (46%), Gaps = 11/495 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 1   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 61  LVKSLIQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 121 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++          + RA LL A+++  
Sbjct: 181 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D      +   A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  PHP+IA
Sbjct: 241 LD-THHAHARAIALEANKLAPDLVPAAVVAARALFADGEIRKGSKILEAAWKRFPHPDIA 299

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A   ++ A
Sbjct: 300 ATYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQVLRAA 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP++  L
Sbjct: 360 PRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSPVTGRL 418

Query: 416 CYFEWKIPT---KSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDS 472
             FEWK+P         +    I   L        + +            +      E  
Sbjct: 419 NSFEWKVPVVELAPAIEVEKPEIKAPLPEIKAVAPISAPELEPVHETAAPVSARDVVEAE 478

Query: 473 TIHPLDPHIRQPDDP 487
            I P    +   D+P
Sbjct: 479 VIVPAAEPVSA-DEP 492


>gi|225628086|ref|ZP_03786121.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|261217713|ref|ZP_05931994.1| HemY domain-containing protein [Brucella ceti M13/05/1]
 gi|261220938|ref|ZP_05935219.1| HemY domain-containing protein [Brucella ceti B1/94]
 gi|261315072|ref|ZP_05954269.1| HemY domain-containing protein [Brucella pinnipedialis M163/99/10]
 gi|261316370|ref|ZP_05955567.1| HemY domain-containing protein [Brucella pinnipedialis B2/94]
 gi|261321440|ref|ZP_05960637.1| HemY domain-containing protein [Brucella ceti M644/93/1]
 gi|261758825|ref|ZP_06002534.1| HemY domain-containing protein [Brucella sp. F5/99]
 gi|265987442|ref|ZP_06099999.1| HemY domain-containing protein [Brucella pinnipedialis M292/94/1]
 gi|265996898|ref|ZP_06109455.1| HemY domain-containing protein [Brucella ceti M490/95/1]
 gi|225616911|gb|EEH13958.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|260919522|gb|EEX86175.1| HemY domain-containing protein [Brucella ceti B1/94]
 gi|260922802|gb|EEX89370.1| HemY domain-containing protein [Brucella ceti M13/05/1]
 gi|261294130|gb|EEX97626.1| HemY domain-containing protein [Brucella ceti M644/93/1]
 gi|261295593|gb|EEX99089.1| HemY domain-containing protein [Brucella pinnipedialis B2/94]
 gi|261304098|gb|EEY07595.1| HemY domain-containing protein [Brucella pinnipedialis M163/99/10]
 gi|261738809|gb|EEY26805.1| HemY domain-containing protein [Brucella sp. F5/99]
 gi|262551366|gb|EEZ07356.1| HemY domain-containing protein [Brucella ceti M490/95/1]
 gi|264659639|gb|EEZ29900.1| HemY domain-containing protein [Brucella pinnipedialis M292/94/1]
          Length = 525

 Score =  418 bits (1075), Expect = e-114,   Method: Composition-based stats.
 Identities = 133/495 (26%), Positives = 234/495 (47%), Gaps = 11/495 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 3   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 62

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 63  LVKSLVQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 122

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 123 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 182

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++          + RA LL A+++  
Sbjct: 183 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 242

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D      +   A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  PHP+IA
Sbjct: 243 LD-THHAHAKAIALEANKLAPDLVPAAVVAARALFADGEMRKGSKILEAAWKRFPHPDIA 301

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A   ++ A
Sbjct: 302 STYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQVLRAA 361

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP++  L
Sbjct: 362 PRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSPVTGRL 420

Query: 416 CYFEWKIPT---KSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDS 472
             FEWK+P         +    I   L        + +      +     +      E  
Sbjct: 421 NSFEWKVPVVELAPAIEVEKPEIKAPLPEVKAVAPISAPELEPVRETAAPVGARDVVEAE 480

Query: 473 TIHPLDPHIRQPDDP 487
            I P    +   D+P
Sbjct: 481 VIVPAAEPVSA-DEP 494


>gi|306844854|ref|ZP_07477437.1| HemY domain protein [Brucella sp. BO1]
 gi|306274786|gb|EFM56567.1| HemY domain protein [Brucella sp. BO1]
          Length = 523

 Score =  418 bits (1075), Expect = e-114,   Method: Composition-based stats.
 Identities = 132/495 (26%), Positives = 232/495 (46%), Gaps = 11/495 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 1   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 61  LVKSLIQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 121 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++          + RA LL A+++  
Sbjct: 181 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D      +   A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  PHP+IA
Sbjct: 241 LD-THHAHAKAIALEANKLAPDLVPAAVVAARALFADGEIRKGSKILEAAWKRFPHPDIA 299

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y +  S +    +LKRA  L  +   + E  + +++ A E G    A   A   ++ A
Sbjct: 300 STYIYARSGDAAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQVLRAA 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP++  L
Sbjct: 360 PRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSPVTGRL 418

Query: 416 CYFEWKIPT---KSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDS 472
             FEWK+P         +    I   L        + +            +      E  
Sbjct: 419 NSFEWKVPVVELAPAIEVEKPEIKAPLPEIKAVAPISAPEMEPVHETAAPVGAPDVVEAE 478

Query: 473 TIHPLDPHIRQPDDP 487
            I P    +   D+P
Sbjct: 479 VIVPAAEPVSA-DEP 492


>gi|62290741|ref|YP_222534.1| hypothetical protein BruAb1_1861 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700652|ref|YP_415226.1| hypothetical protein BAB1_1884 [Brucella melitensis biovar Abortus
           2308]
 gi|148559352|ref|YP_001259709.1| hypothetical protein BOV_1812 [Brucella ovis ATCC 25840]
 gi|163843908|ref|YP_001628312.1| HemY domain-containing protein [Brucella suis ATCC 23445]
 gi|189024954|ref|YP_001935722.1| hypothetical protein BAbS19_I17660 [Brucella abortus S19]
 gi|254690029|ref|ZP_05153283.1| hypothetical protein Babob68_07641 [Brucella abortus bv. 6 str.
           870]
 gi|254694518|ref|ZP_05156346.1| hypothetical protein Babob3T_07639 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696143|ref|ZP_05157971.1| hypothetical protein Babob28_00127 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254700528|ref|ZP_05162356.1| hypothetical protein Bsuib55_06701 [Brucella suis bv. 5 str. 513]
 gi|254731061|ref|ZP_05189639.1| hypothetical protein Babob42_07671 [Brucella abortus bv. 4 str.
           292]
 gi|256059861|ref|ZP_05450048.1| hypothetical protein Bneo5_05852 [Brucella neotomae 5K33]
 gi|256258283|ref|ZP_05463819.1| hypothetical protein Babob9C_13253 [Brucella abortus bv. 9 str.
           C68]
 gi|260546004|ref|ZP_05821744.1| HemY domain-containing protein [Brucella abortus NCTC 8038]
 gi|297247127|ref|ZP_06930845.1| HemY protein [Brucella abortus bv. 5 str. B3196]
 gi|62196873|gb|AAX75173.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616753|emb|CAJ11840.1| unnamed protein product [Brucella melitensis biovar Abortus 2308]
 gi|148370609|gb|ABQ60588.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
 gi|163674631|gb|ABY38742.1| HemY domain protein [Brucella suis ATCC 23445]
 gi|189020526|gb|ACD73248.1| hypothetical protein BAbS19_I17660 [Brucella abortus S19]
 gi|260096111|gb|EEW79987.1| HemY domain-containing protein [Brucella abortus NCTC 8038]
 gi|297174296|gb|EFH33643.1| HemY protein [Brucella abortus bv. 5 str. B3196]
          Length = 523

 Score =  418 bits (1074), Expect = e-114,   Method: Composition-based stats.
 Identities = 133/495 (26%), Positives = 234/495 (47%), Gaps = 11/495 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 1   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 61  LVKSLVQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 121 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++          + RA LL A+++  
Sbjct: 181 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D      +   A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  PHP+IA
Sbjct: 241 LD-THHAHAKAIALEANKLAPDLVPAAVVAARALFADGEIRKGSKILEAAWKRFPHPDIA 299

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A   ++ A
Sbjct: 300 STYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQVLRAA 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP++  L
Sbjct: 360 PRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSPVTGRL 418

Query: 416 CYFEWKIPT---KSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDS 472
             FEWK+P         +    I   L        + +      +     +      E  
Sbjct: 419 NSFEWKVPVVELAPAIEVEKPEIKAPLPEVKAVAPISAPELEPVRETAAPVGARDVVEAE 478

Query: 473 TIHPLDPHIRQPDDP 487
            I P    +   D+P
Sbjct: 479 VIVPAAEPVSA-DEP 492


>gi|254707585|ref|ZP_05169413.1| hypothetical protein BpinM_11596 [Brucella pinnipedialis
           M163/99/10]
 gi|254708877|ref|ZP_05170688.1| hypothetical protein BpinB_01173 [Brucella pinnipedialis B2/94]
 gi|254713700|ref|ZP_05175511.1| hypothetical protein BcetM6_10155 [Brucella ceti M644/93/1]
 gi|254715950|ref|ZP_05177761.1| hypothetical protein BcetM_05867 [Brucella ceti M13/05/1]
 gi|256030403|ref|ZP_05444017.1| hypothetical protein BpinM2_07105 [Brucella pinnipedialis
           M292/94/1]
 gi|256158386|ref|ZP_05456284.1| hypothetical protein BcetM4_05995 [Brucella ceti M490/95/1]
 gi|256253805|ref|ZP_05459341.1| hypothetical protein BcetB_05837 [Brucella ceti B1/94]
 gi|260169312|ref|ZP_05756123.1| hypothetical protein BruF5_13330 [Brucella sp. F5/99]
          Length = 523

 Score =  417 bits (1073), Expect = e-114,   Method: Composition-based stats.
 Identities = 133/495 (26%), Positives = 234/495 (47%), Gaps = 11/495 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 1   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 61  LVKSLVQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 121 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++          + RA LL A+++  
Sbjct: 181 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D      +   A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  PHP+IA
Sbjct: 241 LD-THHAHAKAIALEANKLAPDLVPAAVVAARALFADGEMRKGSKILEAAWKRFPHPDIA 299

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A   ++ A
Sbjct: 300 STYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQVLRAA 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP++  L
Sbjct: 360 PRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSPVTGRL 418

Query: 416 CYFEWKIPT---KSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDS 472
             FEWK+P         +    I   L        + +      +     +      E  
Sbjct: 419 NSFEWKVPVVELAPAIEVEKPEIKAPLPEVKAVAPISAPELEPVRETAAPVGARDVVEAE 478

Query: 473 TIHPLDPHIRQPDDP 487
            I P    +   D+P
Sbjct: 479 VIVPAAEPVSA-DEP 492


>gi|161619801|ref|YP_001593688.1| HemY domain-containing protein [Brucella canis ATCC 23365]
 gi|161336612|gb|ABX62917.1| HemY domain protein [Brucella canis ATCC 23365]
          Length = 523

 Score =  417 bits (1072), Expect = e-114,   Method: Composition-based stats.
 Identities = 134/495 (27%), Positives = 236/495 (47%), Gaps = 11/495 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 1   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +Q + + E 
Sbjct: 61  LVKSLVQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKQLSSYQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 121 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++          + RA LL A+++  
Sbjct: 181 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D      +   A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  PHP+IA
Sbjct: 241 LD-THHTHAKAIALEANKLAPDLVPAAVVAARALFADGEIRKGSKILEAAWKRFPHPDIA 299

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A   ++ A
Sbjct: 300 STYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQVLRAA 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP++  L
Sbjct: 360 PRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSPVTGRL 418

Query: 416 CYFEWKIPT---KSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDS 472
             FEWK+P         +    I   L        + +      +     +      E  
Sbjct: 419 NSFEWKVPVVELAPAIEVEKPEIKAPLPEVKAVAPISAPELEPVRETAAPVGARDVVEAE 478

Query: 473 TIHPLDPHIRQPDDP 487
            I P    +   D+P
Sbjct: 479 VIVPAAEPVSA-DEP 492


>gi|256370285|ref|YP_003107796.1| hypothetical protein BMI_I1905 [Brucella microti CCM 4915]
 gi|256000448|gb|ACU48847.1| hypothetical protein BMI_I1905 [Brucella microti CCM 4915]
          Length = 523

 Score =  417 bits (1072), Expect = e-114,   Method: Composition-based stats.
 Identities = 134/495 (27%), Positives = 235/495 (47%), Gaps = 11/495 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 1   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P ML   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 61  LVKSLVQSPYMLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 121 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++          + RA LL A+++  
Sbjct: 181 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D      +   A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  PHP+IA
Sbjct: 241 LD-THHAHAKAIALEANKLAPDLVPAAVVAARALFADGEIRKGSKILEAAWKRFPHPDIA 299

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A   ++ A
Sbjct: 300 STYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAYEAGEYSVARDNAEQVLRAA 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP++  L
Sbjct: 360 PRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSPVTGRL 418

Query: 416 CYFEWKIPT---KSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDS 472
             FEWK+P         +    I   L        + +      +     +      E  
Sbjct: 419 NSFEWKVPVVELAPAIEVEKPEIKAPLPEVKAVAPISAPELEPVRETAAPVGARDVVEAE 478

Query: 473 TIHPLDPHIRQPDDP 487
            I P    +   D+P
Sbjct: 479 VIVPAAEPVSA-DEP 492


>gi|146337456|ref|YP_001202504.1| putative signal peptide;putative HemY porphyrin biosynthesis
           protein [Bradyrhizobium sp. ORS278]
 gi|146190262|emb|CAL74256.1| conserved hypothetical protein; putative signal peptide;putative
           HemY porphyrin biosynthesis protein [Bradyrhizobium sp.
           ORS278]
          Length = 644

 Score =  414 bits (1065), Expect = e-113,   Method: Composition-based stats.
 Identities = 111/474 (23%), Positives = 202/474 (42%), Gaps = 10/474 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R++ +  ++ L       V+    DV + WG      +  V +  L   + A +L++ 
Sbjct: 1   MFRIVVFLILVGLAAAGSAWVAEQTGDVVLNWGPWRVAMTLPVFVLALGLTIAACVLVWN 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +    L  P  +     +R + +G  A+  GL++I   +   AR+            ++ 
Sbjct: 61  LLSALLRAPNRIRKAHRERRHRRGRHAITHGLLAIGHGDSTAARQHADMAK--RLAGDDP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL  Q A  E   + A      M +   TR   +  L+ E+ R  D  +A   A +A
Sbjct: 119 LTLLLHAQAAQLEGDRDGARRAFRAMAERQDTRLLGLRGLFIEAQRADDAMAAVVIADEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLN----QKKKNAKEWNRNRAILLIARSLEN 236
           L ++P+A W + AV+       +W+ A++ L+        +   + R R +LL AR++  
Sbjct: 179 LKLAPNASWASHAVLGFRCAQGDWNGALSILDGNYTAGMIDKPTYRRQRGVLLTARAMA- 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            +  +   +   A+E++KL    + A++ AAK     ++ R+A  I+E  W   PHP++A
Sbjct: 238 LETENRDLARASAMEAVKLAPTLVPAAVLAAKFESEAHQVRRAMKIIEAAWTSCPHPDLA 297

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y H+   ++ V +L R   L       VE  + V++ A++     +A A         
Sbjct: 298 DAYAHVRLGDSAVQRLSRITNLAARTPNHVEGALAVARAAIDAAEFGRARAAL-APFTED 356

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           P + + +L+A++E+    +  K   WT  A+ A  DP W + DGY+S  W P+SP++  L
Sbjct: 357 PTQRVAMLMAELERTEHGDAGKAREWTLRAVRARHDPAWTA-DGYVSDRWRPISPVTGRL 415

Query: 416 CYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSF 469
             F+W+ P  S     +  I  S                      P     +  
Sbjct: 416 DAFQWQTPVASLPSERNSVIESSEFAEAILAPPSRPAIPEGLVEPPRTVPAAPV 469


>gi|300024948|ref|YP_003757559.1| HemY domain protein [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526769|gb|ADJ25238.1| HemY domain protein [Hyphomicrobium denitrificans ATCC 51888]
          Length = 577

 Score =  413 bits (1063), Expect = e-113,   Method: Composition-based stats.
 Identities = 121/492 (24%), Positives = 226/492 (45%), Gaps = 13/492 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RL+ Y   I+L+      ++  P  + I W      TS F  + +L   + + + L++
Sbjct: 1   MVRLVVYLVTIALIASGLAWLADRPGTLQIAWQGYDIETSVFRAVVLLAAAVASIVFLWS 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V R   + PA +   L +R   KG  A+ +GL++I A +  LA +    +  + +  +E 
Sbjct: 61  VFRALWNSPAAIGGRLVQRRQRKGLDAVSSGLIAIGAGDSTLASRF--ALQARKSLPHEP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L +LL  Q A        A    E ML  P T    +  L+ E+   G   +A+++A +A
Sbjct: 119 LTHLLRAQSAELSGDRATARRIYEAMLASPETELLGLRGLFLEAQHQGADEAARQFADRA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLIARSLEN 236
           L  +P   W   A+ +Q    K+W+ A+  L   +KN      + +R RA+LL A++ +N
Sbjct: 179 LKANPKLGWSATALFEQQCKQKDWTGALETLQHARKNGHIAKADADRKRAVLLTAKA-QN 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            ++     +   A+E+  L  + + A+  A + L S+    KA  +L+K W  +PHP++A
Sbjct: 238 VEEDSPDRALTLAMEAHALAPDLVPAAAIAGRILASRGNTAKAAKVLQKTWAKSPHPDLA 297

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y +    ++T  +  R  +L  +N  S+ES + V+  A+E    D+A       +   
Sbjct: 298 SAYAYARVGDSTRDRFDRERQLAALNPHSIESPIAVATAAIEARMYDEARRVLEPLLPER 357

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
             + +  L+A+IE  ++ +  ++  W   A++A  DP WI+ DG +S  W P SP+   L
Sbjct: 358 LTQRVATLMARIEAGDNGDKGRVREWLARAMNAARDPAWIA-DGVISDHWEPTSPVDGRL 416

Query: 416 CYFEWKIPTKSPEYISSENINFSLE----MAYPADDLQSMLNNGKKNHLPSIKKVSSFED 471
             F+W++P ++ +   +E +   +E    +  P    ++            +        
Sbjct: 417 DAFQWRVPVETRDATRNEILARRIEELIAIEAPTVAPEAPSREAATEAGADVIDAEPVTV 476

Query: 472 STIHPLDPHIRQ 483
           +      P  R 
Sbjct: 477 TAKPAPLPEERA 488


>gi|13473574|ref|NP_105142.1| hypothetical protein mll4218 [Mesorhizobium loti MAFF303099]
 gi|14024324|dbj|BAB50928.1| mll4218 [Mesorhizobium loti MAFF303099]
          Length = 531

 Score =  413 bits (1061), Expect = e-113,   Method: Composition-based stats.
 Identities = 147/520 (28%), Positives = 247/520 (47%), Gaps = 30/520 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RL+ +  V+  +   F  ++  P D+ +T+    Y+ S  V    +   + A ++L+ 
Sbjct: 1   MIRLLAFLIVVFALGLGFAWLADRPGDMVVTFNGYQYQVSLMVAAVAIVAVVAAVMILWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R   + P  +      R  D+GY+AL TG+++  A +  LARK     ++      E 
Sbjct: 61  LIRSLWNSPYTISRYFRVRRRDRGYQALSTGMIAAGAGDGALARKKTKEAAKLIRSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L++LLE Q +L E  +  A +K E ML  P  R   +  LY E+ R+GD N+A+ YA +A
Sbjct: 121 LIHLLEAQASLLEGDHEGARQKFESMLDDPEMRLLGLRGLYLEAERLGDRNAARHYAGRA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQK----KKNAKEWNRNRAILLIARSLEN 236
             ++P   W  E+ +++     +W  A+  ++ +    +      NR RA+LL A++   
Sbjct: 181 AAVAPQLAWAAESTLEELTARGDWDGALKLVDAQKSTRQIERDAANRRRAVLLTAKAQSL 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
           AD  D  A+   A+E+ KL  +   A++ AA +L  QN  RK   ILE  W+  PHPEIA
Sbjct: 241 AD-SDPNAARTAALEANKLQPDFAPAAVAAAAALFKQNDVRKGSKILETAWRAEPHPEIA 299

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
            +YTH    + V  +L RA +L+E+ K   ES + V++ AL+      A ++A  A+++ 
Sbjct: 300 ELYTHARPGDAVLDRLNRAKKLQEMKKNHAESSMTVARAALDAQDFSTARSEAEAAIRMD 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
            R+  +LLLA IE+A + +  K+      A+ A  DP W++ DG +S  W P+SP++  L
Sbjct: 360 RREGAYLLLADIEEAETGDQGKVRQLLSKAVRAPRDPAWVA-DGVVSERWAPVSPVTGRL 418

Query: 416 CYFEWKIPTKS-----PEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFE 470
             FEW+ P +              +     +A PA +              +  K +   
Sbjct: 419 DAFEWRAPMERLGQLIDSRDEGTTVPVIEALAKPASEKPIDAIEPVAAGSETTGKGTDRS 478

Query: 471 DS------------------TIHPLDPHIRQPDDPGIKEQ 492
           +                    + P +   R PDDPG+   
Sbjct: 479 EDQVTPVTAAAFAAVPADAEAVEPAEELTRLPDDPGVDPD 518


>gi|89056574|ref|YP_512025.1| HemY-like [Jannaschia sp. CCS1]
 gi|88866123|gb|ABD57000.1| HemY-like protein [Jannaschia sp. CCS1]
          Length = 509

 Score =  412 bits (1060), Expect = e-113,   Method: Composition-based stats.
 Identities = 96/498 (19%), Positives = 186/498 (37%), Gaps = 17/498 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHY-PEDVSITWGNRLYRTSPFVILSILYFFLFAWIL-- 57
           +L++I +  ++   +    +++      + I +G     T    ++  +   L  WIL  
Sbjct: 6   LLKIIIFIAIVVGAVFGITLLTEMDNLGILIIFGREFVITPLLAVIGAVILLLAVWILFK 65

Query: 58  ----LFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
               L A  R        L     +R+  KGY AL   +M++AA    LA +       +
Sbjct: 66  VVGLLVAFLRMLNGDETALTRYWSRRSERKGYDALGDAMMALAAGEGRLAIR--KAERAR 123

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
                  L  L+  Q A       +A E  + M+    TR   V  L  +    GD ++A
Sbjct: 124 KALGRPELTNLVVAQGAEMVGDKALATETYKAMVTDDRTRFVGVRGLMQQRLDDGDTDTA 183

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
            + A KAL + P    V   ++      ++W  A   L    K          R  A+L 
Sbjct: 184 LKLAEKALVLRPKNADVQTTLISLQSRQEDWQGARGTLAAALKAGNVPRDLHRRRDAVLA 243

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           +A + +   +G ++ +  D  E+ +L    + A++ + +  +    KR+A   + K W  
Sbjct: 244 LAHARDAMAEGQVVTATRDVAEANRLAPGLVPAAVMSTRLAVEAGNKRQAAKTIRKAWDQ 303

Query: 290 NPHPEIANIYTHLLSENTVG-KLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A  +  +  + T   +L+R   L   +    E  ++ +++ +       A    
Sbjct: 304 APHPDLAAAFALIEPDETPALRLRRFRPLLGKHPTHPEVKMLEAELHIANEDFPAARKAL 363

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLSSVWLP 407
               + AP      ++A +E+        +  W   A+ A     W+ D+ G++   W P
Sbjct: 364 GDLAESAPTARSLTIMAAVERGEGSPDRIVRGWLARAVTAPRGNQWLCDNCGHVHEDWTP 423

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVS 467
           +    ++    +W  P +S   ++       L +    D  QS          P  ++ +
Sbjct: 424 VCVNCESFDTLDWAEPRQSETSLAGPTQMLPLIVGALED--QSDAPEAAPEAGPDAEEEA 481

Query: 468 SFEDSTIHPLDPHIRQPD 485
              D T    +     PD
Sbjct: 482 EILDDTPAEPEAAQVTPD 499


>gi|90421577|ref|YP_529947.1| HemY-like [Rhodopseudomonas palustris BisB18]
 gi|90103591|gb|ABD85628.1| HemY-like [Rhodopseudomonas palustris BisB18]
          Length = 561

 Score =  412 bits (1059), Expect = e-113,   Method: Composition-based stats.
 Identities = 127/536 (23%), Positives = 228/536 (42%), Gaps = 49/536 (9%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR+I +  VI+        ++  P +V ++W       +  V    L   + A  L + 
Sbjct: 1   MLRIILFLVVIAAAAAGAGWLAEQPGNVVLSWRGWQAEMTLAVAALALLSAIVAVALGWT 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +    L  P  L      R   +  +A+  GL+++   +  +AR   +   +      + 
Sbjct: 61  ILAGVLRSPGRLRRSRRARREARARRAITQGLLAVGHGDAAIARAHANAAKRHA--PQDP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL+ Q A  +   + A      M     T+   +  L+ E+ R  D  +A   A +A
Sbjct: 119 LALLLQAQSAQLDGDRDGAKRAFLAMAGRDDTKSLGMRGLFIEAQRAEDPYAALTIAEEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQK----KKNAKEWNRNRAILLIARSLEN 236
           L +SP + W ++AV+       +WS A+  L         + K + R R +LL AR++E 
Sbjct: 179 LRLSPASSWASQAVLGFRCARGDWSGALEILETNLTSGLIDKKTYRRLRGVLLTARAIEC 238

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            ++ D+  S   A+E++KL    + A++ A+K L   ++ R+A   +E  W  +PHP++A
Sbjct: 239 -EETDVSLSRDSALEAVKLAPTLVPAAVLASKYLSEAHQIRRAMKTIETAWLAHPHPDLA 297

Query: 297 NIYTHLLSENTVG-KLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             Y H+   ++   +L+R   L        E  V V++ A++ G  ++A    M     A
Sbjct: 298 EAYAHIKPGDSAQVRLQRVEALAAKASGDTEGAVAVARAAIDAGDFNRARGALM-PFVDA 356

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           P + + +L+A+IE     ++     WT  A+ A+ DP+W + DG +S  W P+SP++  L
Sbjct: 357 PTQRVAMLMAEIEHTERKDSRSARAWTLRAVRALRDPVWTA-DGCVSDRWRPVSPVTGRL 415

Query: 416 CYFEWKIPT--------------------------KSPEYISSENINFSLEMAYP----- 444
             F+W  P                           +  E ++SE     +  A P     
Sbjct: 416 DAFQWTTPLAELPTNKAVVLESDLFDETLIESPTEEVTEGVTSEPATPEVSKAEPSKPET 475

Query: 445 -ADDLQSMLNNGKKNHLPSIKKVSS-------FEDSTIHPLDPHIRQPDDPGIKEQ 492
               ++ ++ +      P +    S        + S   P+ P +R PDDPGI E 
Sbjct: 476 SGTPVEVVMESKPAAEAPVVGPTESSPPLFHRPQRSAAAPVIPIVRAPDDPGIDED 531


>gi|114705598|ref|ZP_01438501.1| hypothetical protein FP2506_14069 [Fulvimarina pelagi HTCC2506]
 gi|114538444|gb|EAU41565.1| hypothetical protein FP2506_14069 [Fulvimarina pelagi HTCC2506]
          Length = 522

 Score =  411 bits (1057), Expect = e-112,   Method: Composition-based stats.
 Identities = 130/488 (26%), Positives = 230/488 (47%), Gaps = 11/488 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M  ++ +F +I  +   F  ++  P  V+  W  +    S  + L+     + A +L+  
Sbjct: 1   MWGILTFFILILALYLGFGWLADNPGSVTFVWQEQTVEFSMILFLAAAAAVIVASVLVVW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +       P ++      R + KG+  L  G+++  A N  LAR+M      +    +  
Sbjct: 61  LVAKLFQAPGLISSWNSSRRHSKGHNYLSRGVLAAGAGNATLARQMIKKSEGRIGKDDRA 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           ++  L+ Q AL E  +  A      M + P T+  A+  LY E+ R+GD ++ + YA +A
Sbjct: 121 ILGFLDAQTALIEGDHQRAVAIFRDMEEDPNTKLLALRGLYLEAKRVGDESAQEYYAERA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNRNRAILLIARSLEN 236
           L I+P+ PW  EAV+++   +++W  A+  L  ++       K+  R RAILL A++ + 
Sbjct: 181 LRIAPNLPWAAEAVLERKSSSRDWDGALRVLEAQRSIDMLGDKDAKRIRAILLTAKAKDQ 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
           AD  D  A+   A  + K+  + + A++ AA +    N  R+A   LE  W   PHPEIA
Sbjct: 241 AD-ADPKAARSSARSAQKIAPDFVPAALVAAAAATRLNDSRRATRYLETTWVNAPHPEIA 299

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y H    ++   +L+RA +L+ + ++  ES + V++ AL+ G  D A + A+ A +  
Sbjct: 300 DAYVHAKAGDSAKDRLRRAQKLKGLYEKHPESDIAVARAALDAGEHDLARSSALDAAQKR 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           P + ++LLLA IE+  S    ++  W   A+ A  DP+W++ DG +   W P+SP+++ L
Sbjct: 360 PTESVYLLLADIEEEQSGEVGRVREWLAKAITAPRDPVWMA-DGVILDEWQPVSPVTRKL 418

Query: 416 CYFEWKIPTKSPEYISSENINFSL----EMAYPADDLQSMLNNGKKNHLPSIKKVSSFED 471
              EWK P +  +   +  I        E A           +    H PS    +    
Sbjct: 419 GVVEWKSPVEHRDSNGNPVIEARARDHGESARIISSSDGSNASAASAHTPSTAMTTVASS 478

Query: 472 STIHPLDP 479
           +      P
Sbjct: 479 TLNGNPRP 486


>gi|294851122|ref|ZP_06791795.1| HemY protein [Brucella sp. NVSL 07-0026]
 gi|294819711|gb|EFG36710.1| HemY protein [Brucella sp. NVSL 07-0026]
          Length = 480

 Score =  410 bits (1054), Expect = e-112,   Method: Composition-based stats.
 Identities = 126/429 (29%), Positives = 220/429 (51%), Gaps = 7/429 (1%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++++ +    Y  S    ++ +   + A +LL+ 
Sbjct: 3   MLRVLFYLILVAALGFGFAWLADRPGELNLIFAGNQYNVSLITAVAGIVAIVAAVLLLWW 62

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L   L  R  D+GY++L TGL++  A +   AR+M     +  +   E 
Sbjct: 63  LVKSLVQSPYTLRRHLRTRKRDRGYQSLSTGLIAAGAGDADAARRMTRQAGKLLSSDQEP 122

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M++ P TR   +  LY E+ R+G   +A+ YA +A
Sbjct: 123 LIRLLEAQTAMLEGRTEDARKGFEAMIEDPETRLLGLRGLYIEAQRVGAREAARHYAAEA 182

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNRNRAILLIARSLEN 236
              +P   W + AV+ Q     +W  A+  ++ +++          + RA LL A+++  
Sbjct: 183 ARQAPQLEWASSAVMGQLCAEGDWDGALKLVDARRQVLAHGKDVVKKERAALLTAKAMAT 242

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D      +   A+E+ KL  + + A++ AA++L +  + RK   ILE  WK  PHP+IA
Sbjct: 243 LD-THHAHAKAIALEANKLAPDLVPAAVVAARALFADGEIRKGSKILEAAWKRFPHPDIA 301

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A   ++ A
Sbjct: 302 STYIYARSGDTAQDRLKRARHLVLLRSNNAEGSLALARAAYEAGEYSVARDNAEQVLRAA 361

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+   W P+SP++  L
Sbjct: 362 PRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA-DGYVCEQWSPVSPVTGRL 420

Query: 416 CYFEWKIPT 424
             FEWK+P 
Sbjct: 421 NSFEWKVPV 429


>gi|27375675|ref|NP_767204.1| hypothetical protein bll0564 [Bradyrhizobium japonicum USDA 110]
 gi|27348813|dbj|BAC45829.1| bll0564 [Bradyrhizobium japonicum USDA 110]
          Length = 580

 Score =  409 bits (1052), Expect = e-112,   Method: Composition-based stats.
 Identities = 121/498 (24%), Positives = 221/498 (44%), Gaps = 19/498 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ +  +I+L       V+  P D+ +T G     T+    + +L  F  A +L+++
Sbjct: 1   MLRIVLFLVLIALAAAGAAWVADQPGDLVLTAGGFRASTTLPRFVFLLGLFAAAVVLVWS 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +       P  L    H++ + +G  A+  GL++I   +  LAR+     + +    N+ 
Sbjct: 61  ILTTIWRTPGRLRRRSHEKRHARGRHAITHGLLAIGHGDTALARR--HAETARRHAPNDP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL  Q A  E   + A      M +   TR   +  L+ E+ R  D   A   A +A
Sbjct: 119 LALLLHAQSAQLEGNRDEAQRAFRAMAEREDTRLLGLRGLFIEAQRADDAVGAVMIAEEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLN----QKKKNAKEWNRNRAILLIARSLEN 236
           + +SP + W + AV+       +WS A+  L+        +   + R R +LL AR+LE 
Sbjct: 179 IKLSPSSTWASHAVLGFRCARGDWSGALAILDSNLSAGLIDKPAYRRQRGVLLTARALE- 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
               D   +    +E++KL    + A++ AAK     ++ R+A  ++E  W  NPHP++A
Sbjct: 238 LQTMDRDVARESVMEAIKLAPTLVPAAVLAAKFESEAHQVRRAMKLVEAAWLANPHPDLA 297

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINK----ESVESLVIVSKIALEMGSIDQAHAKAMLA 351
             Y H+   ++   +L+R   L           +E  + +++ A++     +A A     
Sbjct: 298 EAYAHVKLGDSARQRLQRVETLAAKTPADKAGHIEGQLALARAAIDASEFSRARAVLAPY 357

Query: 352 MKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPI 411
           +   P + + LL+A+IE+    +  +   WT  A+ A  DP W + DGY+S  W P+SP+
Sbjct: 358 VN-DPTQRVALLMAEIERTEHGDGGRARAWTLRAVRARHDPAWTA-DGYVSDRWRPVSPV 415

Query: 412 SKTLCYFEWKIPTKSPE-----YISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKV 466
           +  L  F+W+ P  S        I S     ++  A P   + +  N+      P+    
Sbjct: 416 TGRLDAFQWQTPVASLPSDKGDLIESSAFEEAMLAAPPPKRVTAPANDTLMEPAPAASVP 475

Query: 467 SSFEDSTIHPLDPHIRQP 484
           +  ++S     +    +P
Sbjct: 476 AEQDNSPPAAKEEPKEEP 493


>gi|239833008|ref|ZP_04681337.1| HemY domain-containing protein [Ochrobactrum intermedium LMG 3301]
 gi|239825275|gb|EEQ96843.1| HemY domain-containing protein [Ochrobactrum intermedium LMG 3301]
          Length = 480

 Score =  408 bits (1048), Expect = e-111,   Method: Composition-based stats.
 Identities = 120/412 (29%), Positives = 208/412 (50%), Gaps = 7/412 (1%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ Y  +++ +   F  ++  P ++ +T+    Y       ++ +   + A ++L+ 
Sbjct: 1   MLRVLFYLVIVAALGFGFAWLADRPGELDVTFAGNHYNVPLITAVAGIVAIVAAILILWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +  P  L      R  D+GY++L TGL++  A +   AR+M     Q  +   E 
Sbjct: 61  LVKSIIQSPYTLRRHFRARKRDRGYQSLSTGLIAAGAGDAEAARRMTKQAGQLLSSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q A+ E +   A +  E M+  P TR   +  LY E+ R+G  ++A+ YA +A
Sbjct: 121 LIKLLEAQTAMLEGRTEDARKGFEAMVDDPETRLLGLRGLYIEAQRVGAHDAARHYAAEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNRNRAILLIARSLEN 236
              +P   W + AV+ Q+    +W  A+  ++ +K+          + RA LL A+++  
Sbjct: 181 AAQAPQLEWASSAVMGQFCAEGDWDAALKLVDARKQALSHSKDVVKKERAALLTAKAMAV 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D  D   +   A+E+ KL  + + A++ AA++L S    RK   ILE  WK  PHP+IA
Sbjct: 241 VDV-DHAQARTLALEANKLAPDLVPAAVVAARALFSDGDIRKGSKILEAAWKRFPHPDIA 299

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y +  S +T   +LKRA  L  +   + E  + +++ A E G    A   A   ++ +
Sbjct: 300 STYVYARSGDTAQDRLKRAKHLVSLRSNNAEGSLALARAAYEAGDYRLARDNAEQVLRAS 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLP 407
           PR+  +LLLA IE+A + +  K+  W   A+ A  DP W + DGY+S  W P
Sbjct: 360 PRESAYLLLADIEEAETGDQGKVREWLARAVKAPRDPAWTA-DGYVSEQWSP 410


>gi|119384727|ref|YP_915783.1| HemY domain-containing protein [Paracoccus denitrificans PD1222]
 gi|119374494|gb|ABL70087.1| HemY domain protein [Paracoccus denitrificans PD1222]
          Length = 596

 Score =  407 bits (1045), Expect = e-111,   Method: Composition-based stats.
 Identities = 103/499 (20%), Positives = 194/499 (38%), Gaps = 24/499 (4%)

Query: 2   LRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPF-VILSILYFFLFAWILLFA 60
           L+++ +F ++ ++    + +S     +S+ +G+  Y   P  ++++ L   L  WI +  
Sbjct: 22  LKILIFFAIVLVLTLGAMQLSETGHGLSMVYGSTEYTLGPVQLVIAALVVVLLGWITVRL 81

Query: 61  VSRFFLS------CPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQH 114
           +  F             +     +    KGY AL  G++++A+    LA+   +  ++  
Sbjct: 82  LGLFLAFLRFLLGDETAINRYFARSRERKGYDALSEGMLAVASGEGKLAQDKAAKAAKFL 141

Query: 115 TFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQ 174
              +  +  LL  Q A        A E    +L  P TR   +  L  +    GD  +A 
Sbjct: 142 DKPH--VTDLLAAQAAEVAGDSRKAGEVYRRLLSDPRTRFVGIRGLMRQKLDEGDTVTAL 199

Query: 175 RYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWN----RNRAILLI 230
           + A KA  + P    V + ++Q      +W  A   L  K++  +       R  A+L +
Sbjct: 200 KLAEKAYALKPKHAEVQDTLLQLQTRQGDWKGARAVLKDKRQQGQLPKDVHIRRDAVLAL 259

Query: 231 ARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
             + E    G+ I++   AI + +   + I A++ AA+S I+QN  R A  +L+K W V 
Sbjct: 260 KEASEVLAHGNSISAREAAISANRASPDLIPAAVLAARSYIAQNDPRNAGRVLQKTWSVR 319

Query: 291 PHPEIANIYTHLLSEN-TVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAM 349
           PHP IA  Y  ++ +     +L+R   L   N +  E+ ++ +++ L       A     
Sbjct: 320 PHPSIAATYAEIVPDEKPAARLRRFEDLMRQNPDHEETRLLRAELLLAAEDFPGARRALG 379

Query: 350 LAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGY-LSSVWLPL 408
              +  P      +LA +E+    +   +      AL A   P W+ D  + + + W P 
Sbjct: 380 DLAEKHPTVRSLSILAAVERGEGGDDAVVRGILARALVASRGPQWVCDKCHNVMADWSPT 439

Query: 409 SPISKTLCYFEWKIP--TKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKV 466
                      W  P         S+      L +  P         NG    +P+    
Sbjct: 440 CDSCGGFDTLTWCEPDTPAWGATASNGVEMLPLLVGAPHG-------NGAGADVPAPPVP 492

Query: 467 SSFEDSTIHPLDPHIRQPD 485
           ++   +T     P    P+
Sbjct: 493 AAQARATPPVPQPEAPAPE 511


>gi|39933335|ref|NP_945611.1| HemY-like [Rhodopseudomonas palustris CGA009]
 gi|39652960|emb|CAE25702.1| unknown protein [Rhodopseudomonas palustris CGA009]
          Length = 565

 Score =  407 bits (1045), Expect = e-111,   Method: Composition-based stats.
 Identities = 129/543 (23%), Positives = 243/543 (44%), Gaps = 56/543 (10%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ +  +I+L       V+  P +V ++W +     +  V   ++   + A +L +A
Sbjct: 1   MLRIVLFLVIIALAAAGAAWVADQPGEVVLSWNDWKASMTLPVFALVIGAGVVAVMLAWA 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +    +  P  +      R   +   A+  GL+++   +   AR +H+  +++H  H+  
Sbjct: 61  IILGVVRAPGWMKRGRSSRRSARARNAITQGLLAVGHGDSSTAR-LHANAARRHAPHD-P 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL+ Q A  E     A      M     T+   +  LY E+ R  D  +A   A +A
Sbjct: 119 LALLLQAQSAQLEGDREGARRAFLAMAARKDTKSLGMRGLYIEAQRADDPYAALAIAEEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLIARSLEN 236
           L + P+  W ++AV+       +W+ A+  L +         K + R RA+LL AR+++ 
Sbjct: 179 LRVQPNCAWASQAVLGFRCARSDWTGALEILERNLSAGLIDKKAFRRQRAVLLTARAID- 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            ++ D   +   A+E+ KL    + A++ AAK L   ++ R+A  ++E  W+  PHP++A
Sbjct: 238 LEESDESLARDSALEANKLAPTLVPAAVLAAKYLAEAHQVRRAMKVIEAAWQAQPHPDLA 297

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y +L   +T   +L R   L     + +ES + +++ A++ GS  +A       + + 
Sbjct: 298 STYANLKPGDTATARLGRVENLVGKGPQQLESALAIARAAIDAGSFSRARTVLQPYLDM- 356

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           P + + +L+A+IE  +  +T K   WT  A+ A+ DP+W + DGY+S  W P+SP++  L
Sbjct: 357 PTQRVAMLMAEIEHGDRGDTAKARAWTLRAVRALHDPVWTA-DGYVSDHWRPVSPVTGRL 415

Query: 416 CYFEWKIPTKS--------------------------PEYISSENINFSLEMAYPA---- 445
             F+W++P  +                          P   +SE +  ++E A  A    
Sbjct: 416 DAFQWQVPVSALPSSKAVVVDDKFHDALIASSAGETLPASTTSEAVTVTVEAAPEAPIVA 475

Query: 446 -DDLQSMLNNGKKNHLPSIKKVSSF---------------EDSTIHPLDPHIRQPDDPGI 489
             +  +++    K   P+    +                       P+ P +R PDDPG+
Sbjct: 476 PKEPTAVVEEPAKADKPAKTTEAPAEAVAPPAASSSPLFHRRKEAAPVIPIVRAPDDPGV 535

Query: 490 KEQ 492
            E 
Sbjct: 536 DED 538


>gi|192288690|ref|YP_001989295.1| HemY domain protein [Rhodopseudomonas palustris TIE-1]
 gi|192282439|gb|ACE98819.1| HemY domain protein [Rhodopseudomonas palustris TIE-1]
          Length = 565

 Score =  406 bits (1043), Expect = e-111,   Method: Composition-based stats.
 Identities = 129/543 (23%), Positives = 244/543 (44%), Gaps = 56/543 (10%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ +  +I+L       V+  P +V ++W +     +  V   ++   + A +L +A
Sbjct: 1   MLRIVLFLVIIALAAAGAAWVADQPGEVVLSWNDWKASMTLPVFALVIGAGVVAVMLAWA 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +    +  P+ +      R   +   A+  GL+++   +   AR +H+  +++H  H+  
Sbjct: 61  IILGVVRAPSWMKRGRSSRRSARARNAITQGLLAVGHGDSGTAR-LHANAARRHAPHD-P 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL+ Q A  E     A      M     T+   +  LY E+ R  D  +A   A +A
Sbjct: 119 LALLLQAQSAQLEGDREGARRAFLAMAARKDTKSLGMRGLYIEAQRADDPYAALAIAEEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLIARSLEN 236
           L + P+  W ++AV+       +W+ A+  L +         K + R RA+LL AR+++ 
Sbjct: 179 LRVQPNCAWASQAVLGFRCARSDWTGALEILERNLSAGLIDKKAFRRQRAVLLTARAID- 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            ++ D   +   A+E+ KL    + A++ AAK L   ++ R+A  ++E  W+  PHP++A
Sbjct: 238 LEESDESLARDSALEANKLAPTLVPAAVLAAKYLAEAHQVRRAMKVIEAAWQAQPHPDLA 297

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y +L   +T   +L R   L     + +ES + +++ A++ GS  +A       + + 
Sbjct: 298 STYANLKPGDTATARLGRVENLVGKGPQQLESALAIARAAIDAGSFSRARTVLQPYLDM- 356

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           P + + +L+A+IE  +  +T K   WT  A+ A+ DP+W + DGY+S  W P+SP++  L
Sbjct: 357 PTQRVAMLMAEIEHGDRGDTAKARAWTLRAVRALHDPVWTA-DGYVSDHWRPVSPVTGRL 415

Query: 416 CYFEWKIPTKS--------------------------PEYISSENINFSLEMAYPA---- 445
             F+W++P  +                          P   +SE +  ++E A  A    
Sbjct: 416 DAFQWQVPVSALPSSKAVVVDDKFHDALIASSAGETLPASTTSEAVTVTVEAAPEAPIVA 475

Query: 446 -DDLQSMLNNGKKNHLPSIKKVSSF---------------EDSTIHPLDPHIRQPDDPGI 489
             +  +++    K   P+    +                       P+ P +R PDDPG+
Sbjct: 476 PKEPTAVVEEPAKADKPAKTTEAPAEAVAPPAASSSPLFHRRKEAAPVIPIVRAPDDPGV 535

Query: 490 KEQ 492
            E 
Sbjct: 536 DED 538


>gi|92116186|ref|YP_575915.1| HemY-like [Nitrobacter hamburgensis X14]
 gi|91799080|gb|ABE61455.1| HemY-like protein [Nitrobacter hamburgensis X14]
          Length = 552

 Score =  406 bits (1043), Expect = e-111,   Method: Composition-based stats.
 Identities = 123/528 (23%), Positives = 228/528 (43%), Gaps = 41/528 (7%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R+I +  +I+L       V+     + ++W      T+       L   + A +L+++
Sbjct: 1   MFRIILFLVLIALAALGATWVADQTGTIVMSWDVWRVETTLPAFALGLGLLVVAVLLVWS 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R     P  +     +R   +G  A+  GL++I   +   AR        +    +E 
Sbjct: 61  IVRGLWQAPRRIRRARRERRNRRGRDAITRGLLAIGHGDAAAAR--THARVARRLVSHEP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL  Q A  +   + A      M +   TR   +  L+ E+ R  D  +A   A +A
Sbjct: 119 LTLLLHAQSAQLDGDADRAQRAFRAMAERADTRLLGLRGLFIEAQRADDPQAAVAIAEEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQK----KKNAKEWNRNRAILLIARSLEN 236
           L +SP + W ++A +       +W+ A+  L++       +   + R R +LL AR+LE 
Sbjct: 179 LKVSPSSIWASQAALGFRCARGDWTGALAILDKNVAAGLIDKALYRRQRGVLLTARALE- 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            +K D  AS +  +E++K     I A + A+K L   N+ R+A  I+E  W   PHP++A
Sbjct: 238 LEKSDRDASRNTVMEAVKYAPTLIPAVVLASKYLSEGNQMRRAMRIIETAWLAQPHPDLA 297

Query: 297 NIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y H++  ++   +L R   L E      ES + +++ A++     +A       +  A
Sbjct: 298 DAYAHVMPGDSARERLARVETLAENASGHPESAMAIARAAIDASEFARAREVLEPLI-AA 356

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           P + + +L+A+IE     ++ +   WT  A+ A+ DP+W + DGY+S  W P+SP++  L
Sbjct: 357 PTQRVAMLMAEIEHNEHGDSGRARAWTLRAVRALHDPVWTA-DGYVSDHWRPVSPVTGRL 415

Query: 416 CYFEWKI-----PTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFE 470
             F+W+      P+  P  + +E  +     A   + L +   +  ++   +   + S  
Sbjct: 416 DAFQWQAPLAALPSSRPALVEAEFSDQIASDAPRFEALPAASQSAARDGDGATVAIESSS 475

Query: 471 DST--------------------------IHPLDPHIRQPDDPGIKEQ 492
             T                          I  +   +R PDDPG+ + 
Sbjct: 476 PETAAMSAEAATSTTFRTQSDLDKAGASDIPAVIAIVRAPDDPGVDDN 523


>gi|21328634|gb|AAM48640.1| conserved hypothetical protein [uncultured marine proteobacterium]
          Length = 491

 Score =  403 bits (1036), Expect = e-110,   Method: Composition-based stats.
 Identities = 93/488 (19%), Positives = 189/488 (38%), Gaps = 16/488 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           +++++ +  ++ L+      +        I +              ++   L ++ L+  
Sbjct: 5   LVKILSFVAMVMLISFGAGRLMEAQGGFMIQYAGLELSFGALQAALLVLGLLVSFWLVLK 64

Query: 61  VS-------RFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ 113
           +        RF       L     +    +G++AL  GLM++A+ +   A  M       
Sbjct: 65  LLGLVVALLRFINGDETALSRYFDRNRERRGFEALSDGLMALASGDGRDA--MAKARKAD 122

Query: 114 HTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSA 173
              +   L  L+  Q A+A      A    + +L+ P TR    Y L  +  + GD   A
Sbjct: 123 RLLNRPDLTNLIMAQAAVANGDRQTAKATYKKLLKDPKTRFVGTYGLLQQHLQDGDTEVA 182

Query: 174 QRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILL 229
            + A  A  + P      + +++     ++W    T L  K K+         R  A+  
Sbjct: 183 LKLAEHAFGLKPRHGETQDVLLKLQAGREDWRGVRTTLTAKLKHGSLPKDVHKRRDAVFA 242

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           +++S +   +G +  +   A+E+ +L    + A+I +A+    Q   ++A  IL   W++
Sbjct: 243 LSQSRDLRAEGKLDEAQIYAVEANRLAPGLVPAAILSAEGHREQKNVKQASRILRAAWQL 302

Query: 290 NPHPEIANIYTHLLSENT-VGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            PHP++A  +  L  +     +LKR  +  +  +   E+ ++++++ + M   D A    
Sbjct: 303 APHPDLAAGFAALAPDEASAARLKRFGQFTKGTESHPETKMLMAELYVAMADFDAARQAL 362

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD-GYLSSVWLP 407
               K  P      +LA IE+ +  +   +      A+ A  DP WI D+ G++   W P
Sbjct: 363 GDLAKTDPTMRALTILAAIERGDGADDQSVRRLLTQAISAQRDPQWICDNCGHVHHDWEP 422

Query: 408 LSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVS 467
           +    + +    WK P  S E +S + +   +     +D+    L   +         V 
Sbjct: 423 VCLNCEAIDSIAWKRPPMS-EAVSPDMLPLIVGHMARSDEDFPPLLEPEDLSQADASAVK 481

Query: 468 SFEDSTIH 475
              D T  
Sbjct: 482 IAADDTPL 489


>gi|85713683|ref|ZP_01044673.1| HemY protein [Nitrobacter sp. Nb-311A]
 gi|85699587|gb|EAQ37454.1| HemY protein [Nitrobacter sp. Nb-311A]
          Length = 577

 Score =  402 bits (1033), Expect = e-110,   Method: Composition-based stats.
 Identities = 121/526 (23%), Positives = 229/526 (43%), Gaps = 40/526 (7%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR+I +  +I+L       ++     + ++W      T+  V    L   + A +L+++
Sbjct: 27  MLRIILFLVLIALSALGASWIADQTGTIVLSWDVWRIETTLPVFALGLGLLVVASLLVWS 86

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
             R     P  L      R   +G  A+  GL++I   +   AR  +     +     + 
Sbjct: 87  AVRGLWQAPTRLRRARRARRTARGRDAITRGLLAIGHGDATAAR--NHARVARRLVSQDP 144

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL  Q A  +   + A      M +   TR   +  L+ E+ R GD  +A   A +A
Sbjct: 145 LALLLHAQAAQLDGDADRAQRVFRTMAERADTRLLGLRGLFIEAQRAGDPAAAVAIAEEA 204

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQK----KKNAKEWNRNRAILLIARSLEN 236
           L  SP + W ++A +       +W+ A+  L++     + +   + R R +LL AR+LE 
Sbjct: 205 LKTSPSSIWASQAALGFRCARGDWAGALAILDRNAASGRIDKALYRRQRGVLLTARALE- 263

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            +  D   S    +E++K     + A + A+K L   N+ R+A  ++E  W   PHP++A
Sbjct: 264 LETSDRDLSRQTVMEAVKFAPTLVPAVVLASKYLSEANQMRRAMRMIETAWLAQPHPDLA 323

Query: 297 NIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y H++  ++ + +L R  +L E      ES + +++ AL+     +A       +  A
Sbjct: 324 DAYAHVMPGDSALQRLARVEKLSEKAPGHPESAMAIARAALDASEFARARDALEPLI-AA 382

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           P + + +L+A+IE +   ++ +   WT  A+ A+ DP+W + DGY+S  W P+SP++  +
Sbjct: 383 PTQRVAMLMAEIEHSEHGDSGRARAWTLRAVRALHDPVWTA-DGYVSDHWRPVSPVTGRV 441

Query: 416 CYFEWKI-----PTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFE 470
             F+W+      P+  P  + ++  +   E     + L +    G+          +  E
Sbjct: 442 DAFQWQTPLAALPSSRPPLVEADVSDQIAEETPRVEALPAASPGGESKAQDDAMSPADVE 501

Query: 471 DST-------------------------IHPLDPHIRQPDDPGIKE 491
            ++                         I  + P +R PDDPG+ +
Sbjct: 502 AASFGTIPMPDETAASPISHTEEDKPGAIPDVIPIVRAPDDPGVDD 547


>gi|304392696|ref|ZP_07374636.1| HemY domain-containing protein [Ahrensia sp. R2A130]
 gi|303295326|gb|EFL89686.1| HemY domain-containing protein [Ahrensia sp. R2A130]
          Length = 674

 Score =  402 bits (1033), Expect = e-110,   Method: Composition-based stats.
 Identities = 127/434 (29%), Positives = 217/434 (50%), Gaps = 13/434 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITW----GNRLYRTSPFVILSILYFFLFAWI 56
           MLRL  +F ++  +   F   +  P  +++ W    G         V + +L   LFA I
Sbjct: 1   MLRLAVFFLILFAIAAGFAWFADNPGTITLQWPWLNGGEPLAVDLLVAIVVLAVVLFAAI 60

Query: 57  LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTF 116
           +L+++    L+ P         R  DKGY+AL  GL++  A N PLAR++    S+    
Sbjct: 61  VLWSIIAAILTSPKTFGRWREGRRRDKGYEALSRGLVAANAGNAPLARRLTKECSKH--L 118

Query: 117 HNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRY 176
            +E LV LL+ Q AL E  ++ A      ML+   TR   +  LY E+ + G+  +A  +
Sbjct: 119 DDEPLVALLDAQTALLEDDHDCARRCYTTMLEKDETRLLGLRGLYLEAEKEGEGEAAGHF 178

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLIAR 232
           A +A+  +P  PW T+A+++     K W  A+  L+  +         +N  +A +L A 
Sbjct: 179 AREAVKANPGTPWATQAMLRSQTATKNWEEALKTLDLNRSAGVYDKDAYNGRKAAILTAL 238

Query: 233 SLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPH 292
           +++  D      +   A+ + KL      A++ AA+  +  N  RKA  +LE  WK  PH
Sbjct: 239 AMDEEDAS-PEKARSHALAAHKLAPTLAPAAVVAARMSVRLNDMRKAAKVLETSWKAEPH 297

Query: 293 PEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLA 351
           PEIA+ Y HL + ++V  +LKRA  L+     S++  + ++++A++ G  + A      A
Sbjct: 298 PEIADAYIHLRNGDSVLDRLKRAQTLDGKRSNSIDGQLAIAQVAIDAGEYETARDALEAA 357

Query: 352 MKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPI 411
            +I P +   LL+A +E+A + +  ++  W   A+HA  D  W++ DG  +  W+P SP+
Sbjct: 358 FRITPTERACLLMADLEEAQNEDMGRVREWLSRAVHAPRDKAWVA-DGVAAEEWMPASPV 416

Query: 412 SKTLCYFEWKIPTK 425
           +  +  FEWK P +
Sbjct: 417 TGEINAFEWKQPVE 430


>gi|328542000|ref|YP_004302109.1| HemY N-terminal domain protein [polymorphum gilvum SL003B-26A1]
 gi|326411750|gb|ADZ68813.1| HemY N-terminal domain protein [Polymorphum gilvum SL003B-26A1]
          Length = 597

 Score =  400 bits (1029), Expect = e-109,   Method: Composition-based stats.
 Identities = 130/491 (26%), Positives = 224/491 (45%), Gaps = 9/491 (1%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R + +F V+  V   F  ++  P  VS++W   ++   P V   ++   L   +L F 
Sbjct: 1   MIRALVFFAVLFAVAFGFAWMADLPGVVSVSWQGYVWEQPPVVAAVLIGLALVLVLLAFW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +    L  P +    L +R  DKGY+AL  GL+++   N   AR+      +      E 
Sbjct: 61  LVGAILRSPRIARRFLRRRRRDKGYEALSHGLIALGTGNAKRARRYGQDADK--LLRGES 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
              LL  Q A    Q++ A ++ E ML+ P TR   ++ L+ E+ R  +  +A+ YA +A
Sbjct: 119 AARLLLAQAAQMSGQHDEARQRFEAMLKDPETRALGLHGLFIEAERQNEPIAARHYAEEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQ----KKKNAKEWNRNRAILLIARSLEN 236
               P   W   AV+    +A +W  AI  L +    +  + K + R+RA+LL AR+LE 
Sbjct: 179 ARAVPGLDWAGRAVLGYQAVAGDWEAAIATLERNYAARLVDKKTYRRHRAVLLAARALEL 238

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D GD   +   A E+  L  + + A++ AA+    +   RKA  I+E  W+++PHP++A
Sbjct: 239 ED-GDPETALTLAKEAHGLALDLVPAAVVAARLATRKGDVRKAAKIVEATWRLSPHPDLA 297

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y H    +  + +L R   L      + E  + V++ ALE     +A  +    ++  
Sbjct: 298 DAYAHARIGDAALDRLARVRTLAAQRAHTAEGALAVARAALEAREFGEAREQLKRVLRSE 357

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           P +  F+L+A++E+A   +  ++  W   A+ A  D  W++ DG +   W P+SP++  L
Sbjct: 358 PTRGAFVLMAELEEAEHGDRGRVREWLARAVRAPLDKAWVA-DGVVREAWAPVSPVTGRL 416

Query: 416 CYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDSTIH 475
             FEW  PT  PE    E ++ +L  A       +         +P     +    +   
Sbjct: 417 DAFEWTTPTGLPETPLVEALDDALFEAPALTVRPAAPKFDTPAEVPPAAGAAPEPAADAA 476

Query: 476 PLDPHIRQPDD 486
              P      D
Sbjct: 477 VSVPAAEPEPD 487


>gi|260464236|ref|ZP_05812429.1| HemY domain protein [Mesorhizobium opportunistum WSM2075]
 gi|259030039|gb|EEW31322.1| HemY domain protein [Mesorhizobium opportunistum WSM2075]
          Length = 533

 Score =  400 bits (1029), Expect = e-109,   Method: Composition-based stats.
 Identities = 140/489 (28%), Positives = 241/489 (49%), Gaps = 14/489 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RL+ +  V+  +   F  ++  P D+ IT+    Y+ S  V    +   + A ++ + 
Sbjct: 1   MIRLLAFLVVVFALGLGFAWLADRPGDMVITFNGYQYQVSLMVAAVAVVAVVAAVMIAWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +   + P  +      R  D+GY+AL TG+++  A +  LARK     ++      E 
Sbjct: 61  LVKSLWNSPYTISRYFRVRRRDRGYQALSTGMIAAGAGDGALARKKTKEAAKLIRSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L++LLE Q +L E  +  A +K E ML  P  R   +  LY E+  +GD N+A+ YA +A
Sbjct: 121 LIHLLEAQASLLEGDHEGARQKFESMLDDPEMRLLGLRGLYLEAESLGDRNAARHYAGRA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQK----KKNAKEWNRNRAILLIARSLEN 236
             ++P   W  E+ +++     +W  A+  ++ +    +      NR RA+LL A++   
Sbjct: 181 AVMAPQLAWAAESTLEELTARGDWDGALKLVDAQKSTRQIERDAANRRRAVLLTAKAQSL 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
           AD  D  A+   A+E+ KL  +   A++ AA +L  QN  RK   ILE  WK  PHPE+A
Sbjct: 241 AD-SDPNAARTAALEANKLRPDFAPAAVAAAAALFKQNDVRKGSKILETAWKAEPHPEVA 299

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
            +YTH    + V  +L RA +L+E+ K   ES + V++ AL+      A  +A  A+++ 
Sbjct: 300 ELYTHARPGDAVLDRLNRAKKLQEMKKNHAESSMTVARAALDAMDFSTARREAEAAIRMD 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
            R+  +LLLA IE+A + +  K+      A+ A  DP W++ DG +S  W P+SP++  L
Sbjct: 360 RREGAYLLLADIEEAETGDQGKVRQLLSKAVRAPRDPAWVA-DGVVSERWAPVSPVTGRL 418

Query: 416 CYFEWKIPTK-------SPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSS 468
             FEW+ P +       S +      +     +A PA +  + +         +  K + 
Sbjct: 419 DAFEWRAPMERLGQLIDSRDETPGAAVPVIEALAKPASETPADVIEHAAASSEATGKAAE 478

Query: 469 FEDSTIHPL 477
             +  + P+
Sbjct: 479 SREDHVKPV 487


>gi|75674672|ref|YP_317093.1| HemY protein [Nitrobacter winogradskyi Nb-255]
 gi|74419542|gb|ABA03741.1| HemY protein [Nitrobacter winogradskyi Nb-255]
          Length = 555

 Score =  400 bits (1028), Expect = e-109,   Method: Composition-based stats.
 Identities = 121/530 (22%), Positives = 229/530 (43%), Gaps = 43/530 (8%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR+I +  +I+L       ++     + ++W      T+  V    L   + A +L ++
Sbjct: 1   MLRIILFLVLIALSALGATWIADQTGTIVLSWDVWRIETTIPVFALGLGLLIVASLLAWS 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V       P  +     +R   +G  A+  GL++I   +       +   + +    N+ 
Sbjct: 61  VVHGLWQAPTRMRRARRERRIARGRDAITRGLLAIGYGDAAA--ARNHAKAARRLVSNDP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL  Q A  +   + A      M +   TR   +  L+ E+ R GD  +A   A +A
Sbjct: 119 LALLLHAQAAQLDGDADRAQRAFRTMAERNDTRLLGLRGLFIEAQRAGDPAAAVAIAEEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQK----KKNAKEWNRNRAILLIARSLEN 236
           L  SP + W ++A +       +W+ A+  L++     + +   + R R +LL AR+LE 
Sbjct: 179 LKTSPSSIWASQAALGFRCARGDWTGALAILDKNVASGRIDKALYRRQRGVLLTARALE- 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            +K D   S    +E++K     I A + A+K L   N+ R+A  ++E  W   PHP++A
Sbjct: 238 LEKSDRDLSRQTVMEAVKFAPTLIPAVVLASKYLSEANQMRRAMRLIETAWLAQPHPDLA 297

Query: 297 NIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y H++  ++ + +L R  +L E      ES + +++ A++     +A       +  A
Sbjct: 298 DAYAHVMPGDSALQRLARVEKLSEKAPGHPESAMAIARAAIDASEFARAREVLEPLI-AA 356

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           P + + +L+A+IE     ++ +   WT  A+ A+ DP+W + DGY+S  W P+SP++  +
Sbjct: 357 PTQRVAMLMAEIEHNERGDSGRARAWTLRAVRALHDPVWTA-DGYVSDHWRPVSPLTGRV 415

Query: 416 CYFEWKI-----PTKSPEYISSENINFSLEMAYPADDLQSMLNNG--------------- 455
             F+W+      P+  P  + +E  +   E A   + L +  +                 
Sbjct: 416 DAFQWQTPLSALPSSRPPLVEAEVSDQIAEDAPRVEALPAATSTEDFKAQDGAIPPAGVE 475

Query: 456 ---------KKNHLPSIKKVSSFEDST----IHPLDPHIRQPDDPGIKEQ 492
                          +    +  E+      I  + P +R PDDPG+ + 
Sbjct: 476 ASSSGTISMPDETATASADYTPSEEDNKPGAIPDVIPIVRAPDDPGVDDD 525


>gi|114769711|ref|ZP_01447321.1| Uncharacterized HemY-like membrane protein [alpha proteobacterium
           HTCC2255]
 gi|114549416|gb|EAU52298.1| Uncharacterized HemY-like membrane protein [alpha proteobacterium
           HTCC2255]
          Length = 478

 Score =  400 bits (1028), Expect = e-109,   Method: Composition-based stats.
 Identities = 98/472 (20%), Positives = 188/472 (39%), Gaps = 26/472 (5%)

Query: 12  SLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWI-------LLFAVSRF 64
           +LV     ++      +++ + +     +P   +  +   + + +       +L A+ +F
Sbjct: 16  ALVTLVTGVIIDAGGVITMQFASYEISLTPIQGIIGIILCMSSLLATKWLFGILVAIFKF 75

Query: 65  FLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYL 124
           F      +    +K   ++GYKAL   ++S+AA     A  +++    +       L  L
Sbjct: 76  FNGDETAITRYFNKNKEERGYKALADSMVSMAAGEGKDA--INNANRAERLLQRPQLTNL 133

Query: 125 LEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDIS 184
           +  Q A        A +  + +L+   TR   +  L  +    GD  +A   A KA  I 
Sbjct: 134 VSAQAAEKFGDNKRALKYYKRLLKNDQTRFVGLQGLLKQKLLEGDNETALLLAEKAFSIR 193

Query: 185 PDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWN----RNRAILLIARSLENADKG 240
           P+       +       ++W  A   +    +  K       R  AILL+A +    + G
Sbjct: 194 PNHDQTLNVLFDLQTEKQDWKGAQKTIKANVRAGKLPKDIGLRREAILLLADAKAMLEAG 253

Query: 241 DMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYT 300
           ++      AI + K   + I A+I AA+  +  N KR +  IL+K W +NPHP++A  + 
Sbjct: 254 EIDTGKAAAIAANKSSPDLIPAAILAAEMYMLDNNKRASTKILKKTWGLNPHPDLATAFA 313

Query: 301 HLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKE 359
            +   E +  + KR     ++  E  E+ ++++++A+       A           P   
Sbjct: 314 EINLKETSGERRKRFSSFVKLKSEHYETKLLLAELAIGDEDFPAARRAIKDLTSTNPTVR 373

Query: 360 IFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLPLSPISKTLCYF 418
              L+A IE+    +   +  W   AL A   P WI +    +   W P     +T    
Sbjct: 374 SLALMAAIEKGEGADEKTVRAWLNKALTASRGPQWICEKCSNIHLSWQPRCENCETFDSL 433

Query: 419 EWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFE 470
            WK P +  + I++E ++F+           + +  G +N LPS+  +   E
Sbjct: 434 SWKAPPRDAKKITNEKLDFT-----------AGILTGAENSLPSVSDIDDAE 474


>gi|217977723|ref|YP_002361870.1| HemY domain protein [Methylocella silvestris BL2]
 gi|217503099|gb|ACK50508.1| HemY domain protein [Methylocella silvestris BL2]
          Length = 516

 Score =  395 bits (1014), Expect = e-107,   Method: Composition-based stats.
 Identities = 120/495 (24%), Positives = 211/495 (42%), Gaps = 13/495 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++ +  V+  +  +   +   P ++ + W      TS  + ++ ++      + L+ 
Sbjct: 1   MIRVLLFLAVLIGLAIAEAWLIERPGELVLNWQGYKIETSVLMGIAAVFVAAAILLGLWM 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + RF  + P+++      R  +KGY AL  G++++ A +   AR+  + V  Q    N+ 
Sbjct: 61  LLRFIFNIPSLMALASRGRRREKGYAALSRGMIAVGAGDTQAARR--AAVEAQRMLPNDP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL+ Q A    +   A      M +    R   +  L+ E+ R GD+  AQ YA  A
Sbjct: 119 LALLLKAQSAQLSGESGSAEAAFTEMTRRNDMRVLGLRGLHVEAERQGDVEKAQHYAETA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLN----QKKKNAKEWNRNRAILLIARSLEN 236
            +I+P  PW  +A     V A +W  A+  L      K  +     R+RA+L  A ++E 
Sbjct: 179 REIAP-LPWAAKANFAHKVAAGDWRGALALLESGAGSKHIDKTIRERSRAVLETAIAIEK 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
           AD      +   A  ++K     + A   AA+    Q   RKA  ++E  W    HP+IA
Sbjct: 238 AD-AQPAEALALARAAVKRAPTLVPAVALAARLTSEQGDARKAAKLIEAGWAGTHHPDIA 296

Query: 297 NIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMK-- 353
            IY  L   E++  +LKRA+ L ++     ES ++V++ A+  G    A       ++  
Sbjct: 297 KIYVGLYPGESSADRLKRAISLAQLAPREPESKIMVAEAAIAAGDFKAAREAMQPLIEGP 356

Query: 354 IAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISK 413
             P   +  L+A++E+        I  W   A  A PDP W++ DG  S  W P+SP++ 
Sbjct: 357 ERPTARMCRLMAELEEKQHGAAGYIREWLTRASLAPPDPTWVA-DGVASDQWRPISPVTG 415

Query: 414 TLCYFEWKIPTKS-PEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDS 472
            L  F W+ P +       +E+  F+  +      L             ++      +  
Sbjct: 416 KLDAFVWQKPVERLSSGNEAEDAIFAQILPPEPPLLLEEAQTASGAKTGALDGPPHPDPE 475

Query: 473 TIHPLDPHIRQPDDP 487
              P+ P      +P
Sbjct: 476 IAIPMGPPPPTTAEP 490


>gi|110635528|ref|YP_675736.1| HemY-like [Mesorhizobium sp. BNC1]
 gi|110286512|gb|ABG64571.1| HemY-like protein [Chelativorans sp. BNC1]
          Length = 533

 Score =  394 bits (1012), Expect = e-107,   Method: Composition-based stats.
 Identities = 144/519 (27%), Positives = 264/519 (50%), Gaps = 31/519 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R++ +  ++ L+   F  ++  P ++++T+G   Y+ +  +   +L   + A ++L+ 
Sbjct: 1   MFRILLFLVIVMLLGLGFAWLADRPGELAVTFGGYQYQVTLMMAAVLLVAAIAAVMILWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R   + P  +      R  D+GY+AL TGL++  A +  LAR+M    ++  +   E 
Sbjct: 61  IVRGIWTSPYTVRRYFRARRRDRGYQALSTGLIAAGAGDAGLARRMGQQAAKLISSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L++LL+ Q A+ E  +  A  K + M   P TR   +  LY E+ R G+  +A+ YA +A
Sbjct: 121 LIHLLDAQAAMLEGNHEAARAKFQAMADDPETRLLGLRGLYLEAERHGEREAARHYADEA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWN----RNRAILLIARSLEN 236
             I+P   W  +A ++      +W  A+  L+++K ++KE      R RA+LL A+++  
Sbjct: 181 TKIAPQLGWAADATLEAKADEGDWQGALALLDKQKPSSKEERAALARKRAVLLTAQAMAQ 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            +  +  A+   A+E+ +L  + + A++ AA++L  Q+  R+   +LE +W  +PHPE+A
Sbjct: 241 LNM-NPAAAKTAALEAHRLQPDFVPAAVTAARALFRQDDLRRGAKVLEAVWAKSPHPEVA 299

Query: 297 NIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           +IY H    ++T  +L RA +L  +   + ES++ V++ AL+ G   +A   A  A+++ 
Sbjct: 300 DIYVHARPGDSTHDRLTRAKKLRRLKPNNAESVLAVARAALDAGEYGEAREAAEAAVRLD 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           PR+  FLLLA IE+A   +  ++ YW   A+ A  DP W++ DGY++  W P SP++  L
Sbjct: 360 PREGAFLLLADIEEAERGDQGRVRYWLAKAVRAPRDPAWVA-DGYVAERWAPASPVTGRL 418

Query: 416 CYFEWKIPTKS-PEYISSENINFSLE------MAYPADDLQSMLNNGKKNHLPSIKKVSS 468
             FEW+ P +   + I  E    +L        A   ++   +L   +   +  +   S 
Sbjct: 419 DAFEWRAPMERLGQIIEGEEALRALPPLETGVKASEEEEADDVLLPAEAEPVVEVAAQSE 478

Query: 469 FEDST---------------IHPLDPHIRQ--PDDPGIK 490
            E +                  P +  IR   PDDPG++
Sbjct: 479 SEKAETALPGDNGAKEPAADAEPTEEDIRPPLPDDPGVE 517


>gi|209883479|ref|YP_002287336.1| HemY protein [Oligotropha carboxidovorans OM5]
 gi|209871675|gb|ACI91471.1| HemY protein [Oligotropha carboxidovorans OM5]
          Length = 572

 Score =  393 bits (1009), Expect = e-107,   Method: Composition-based stats.
 Identities = 118/470 (25%), Positives = 214/470 (45%), Gaps = 15/470 (3%)

Query: 20  IVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKR 79
            V+     + ++W      TS  V   +    L   +++++V R F   P  L     ++
Sbjct: 20  WVADQGGGLVLSWSGWRIETSLPVAALLGVILLAVALVVWSVVRTFWKAPEGLRRRRREK 79

Query: 80  NYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIA 139
              K  +A+  GL+++   +   A++     ++     ++ L  +L+ Q A  E     A
Sbjct: 80  RAAKARRAITQGLIAVGTGDSFAAQRHAGMATRLAA--HDPLALMLQAQTAQLEGDRAGA 137

Query: 140 HEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYV 199
                 M +    R   +  L+ E+ R  D  +A   A +AL I+P +PW ++AV+    
Sbjct: 138 QRAFRAMAERKDMRLLGLRGLFIEAQRSDDAYTAVAMAEEALKIAPASPWASQAVLGFRC 197

Query: 200 LAKEWSRAITFLNQKKKNA----KEWNRNRAILLIARSLENADKGDMIASYHDAIESLKL 255
              +W  A+  L+  K         + R R +LL AR+L   ++ D  AS   A+E++KL
Sbjct: 198 AGSDWDGALALLDTNKAAGLVEPAVYRRERGVLLTARALA-LEERDRDASRKSAMEAVKL 256

Query: 256 CDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLL-SENTVGKLKRA 314
               + A++ AAK     N+ R+A  ++E  W  NPHP++A+ Y H+   ++   +L R 
Sbjct: 257 APQLVPAAVLAAKFYSEDNQVRRAMRVVEAAWVANPHPDLADAYAHVRLGDSARERLSRV 316

Query: 315 LRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHN 374
             L +   +  E  + V++ A++ G  ++A       +  AP + + LL+A++E+AN  +
Sbjct: 317 EMLAQKTPDHREGRLAVARAAIDAGEFERAREALAPLID-APTQRVALLMAELERANH-D 374

Query: 375 TDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEWKIPTK--SPEYISS 432
             +   WT  A+ A PDP W + DGY+S  W P+SP++  L  F+W  P    +PE  + 
Sbjct: 375 EGRAREWTARAVRAAPDPAWTA-DGYVSDRWRPVSPVTGRLDAFQWVTPVAALAPERATI 433

Query: 433 ENINFSLEMAYPA--DDLQSMLNNGKKNHLPSIKKVSSFEDSTIHPLDPH 480
           E    +L M   A     +   +   + +L +  KV +  D         
Sbjct: 434 EAETPTLPMPPIAIESKPEEKADANPETNLEADVKVDTAPDEAAASPIAE 483


>gi|319780790|ref|YP_004140266.1| HemY domain protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317166678|gb|ADV10216.1| HemY domain protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 534

 Score =  391 bits (1005), Expect = e-106,   Method: Composition-based stats.
 Identities = 149/523 (28%), Positives = 251/523 (47%), Gaps = 33/523 (6%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RL+ +  V+  +   F  ++  P D+ +T+    Y+ S  V    +   + A ++L+ 
Sbjct: 1   MIRLLAFLIVVFALGLGFAWLADRPGDMVVTFNGYQYQVSLMVAAVAVVAVVAAVMILWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +   + P  +      R  D+GY+AL TG+++  A +  LARK     ++      E 
Sbjct: 61  LLKALWNSPYTISRYFRVRRRDRGYQALSTGMIAAGAGDGALARKKTKEAAKLIRSDQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L++LLE Q +L E  +  A +K E ML  P  R   +  LY E+ R+GD N+A+ YA +A
Sbjct: 121 LIHLLEAQASLLEGDHEGARQKFESMLDDPEMRLLGLRGLYLEAERLGDRNAARHYAGRA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQK----KKNAKEWNRNRAILLIARSLEN 236
             ++P   W  E+ +++     +W  A+  ++ +    +      NR RA+LL A++   
Sbjct: 181 AAVAPQLAWAAESTLEELTARGDWDGALKLVDAQKATRQIERDAANRRRAVLLTAKAQAL 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
           AD  D  A+   AIE+ KL  +   A++ AA +L  QN  RK   ILE  WK  PHPEIA
Sbjct: 241 AD-SDPAAARTAAIEANKLRPDFAPAAVAAAAALFKQNDVRKGSKILEAAWKAEPHPEIA 299

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
            +YTH    + V  +L RA +L+E+ K   ES + V++ AL+      A  +A  A+++ 
Sbjct: 300 ELYTHARPGDAVLDRLNRAKKLQEMKKNHAESSMTVARAALDAQDFATARREAEAAIRMD 359

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
            R+  +LLLA IE+A + +  K+      A+ A  DP W++ DG +S  W P+SPI+  L
Sbjct: 360 RREGAYLLLADIEEAETGDQGKVRQLLSRAVRAPRDPAWVA-DGVVSERWAPVSPITGRL 418

Query: 416 CYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNG-------------------- 455
             FEW+ P +    +   + +     A   + L    +                      
Sbjct: 419 DAFEWRAPMERLGQLIDSHDDAPAGAAPVIEALAKPTSEKRPIEVIDDAGGETSAGKQAE 478

Query: 456 --KKNHLPSIKKVS----SFEDSTIHPLDPHIRQPDDPGIKEQ 492
             +++H+  I   +      +   + P +   R PDDPG+   
Sbjct: 479 SREEDHVRPITAAAFAAVPSDAEGVEPAEELARLPDDPGVDPD 521


>gi|115522092|ref|YP_779003.1| HemY domain-containing protein [Rhodopseudomonas palustris BisA53]
 gi|115516039|gb|ABJ04023.1| HemY domain protein [Rhodopseudomonas palustris BisA53]
          Length = 577

 Score =  389 bits (999), Expect = e-106,   Method: Composition-based stats.
 Identities = 109/428 (25%), Positives = 200/428 (46%), Gaps = 10/428 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR+I +  VI+L       ++  P +V ++W       S  V   ++   L + +L +A
Sbjct: 1   MLRIILFLVVIALAATGAAWLAEQPGNVVLSWNGWQAEASLAVFSMVVGGILVSVLLAWA 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +       P  L     +R   +   A+  GL+++   +  +AR   +   +     N+ 
Sbjct: 61  IITGLWRSPRRLARSRRERKLARARHAVTQGLLAVGHGDAAIARAHANAARRH--SPNDP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL+ Q A  +     A      M     T+   +  L+ E+ R  D  +A   A +A
Sbjct: 119 LALLLQAQAAQLDGDREGAKRAFLAMASRDDTKSLGMRGLFIEAQRAEDPYAALTVAEEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLIARSLEN 236
           L +SP + W   AV+       +WS A+  L     +     K + R R +LL AR++E 
Sbjct: 179 LRLSPGSHWAAHAVLGFRCARSDWSGAMDILENNLASGLIDKKTYRRQRGVLLTARAIEC 238

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D  D+  +   A+E++KL    + A++ AAK +   ++ R+A  I+E  W  +PHP++A
Sbjct: 239 ED-ADVSVARDSALEAIKLVPTLVPAAVLAAKYMSEAHQLRRALKIIEAAWIAHPHPDLA 297

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             Y H+   ++   +L R   L       +E  + +++ A++     +A       ++ A
Sbjct: 298 EAYAHIKQGDSAQARLSRIETLAAKAPGHIEGALAIARAAIDASDFTRARNALAPYVE-A 356

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           P + + +L+A+IE A+ +++     WT  A+ A+ DP+W + DG +S  W P+SP++  L
Sbjct: 357 PTQRVAMLMAEIEHADRNDSRAARAWTLRAVRALRDPVWTA-DGCVSDRWRPVSPVTGRL 415

Query: 416 CYFEWKIP 423
             F+W  P
Sbjct: 416 DAFQWTSP 423


>gi|316931768|ref|YP_004106750.1| HemY domain-containing protein [Rhodopseudomonas palustris DX-1]
 gi|315599482|gb|ADU42017.1| HemY domain protein [Rhodopseudomonas palustris DX-1]
          Length = 565

 Score =  388 bits (998), Expect = e-106,   Method: Composition-based stats.
 Identities = 126/543 (23%), Positives = 234/543 (43%), Gaps = 56/543 (10%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ +  +I+L       V+  P +V ++W +     +  V  + L   + A +L +A
Sbjct: 1   MLRIVLFLVIIALAAAGAAWVAEQPGEVVLSWNDWRASMTLPVFAAALGAGVVAVMLAWA 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +    +  P  +      R  ++   A+  GL+++   +           + +    ++ 
Sbjct: 61  IVLGVVRAPGWMKRGRSSRRSERARNAITQGLLAVGHGDSAA--ARAHANAARRHAPHDP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL+ Q A  E     A      M     T+   +  LY E+ R  D  +A   A +A
Sbjct: 119 LALLLQAQSAQLEGDREGARRAFLAMASRKDTKSLGMRGLYIEAQRADDPYAALAIAEEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLIARSLEN 236
           L + P+  W ++AV+       +W+ A+  L +         K + R RA+LL AR+++ 
Sbjct: 179 LRLQPNCAWASQAVLGFRCARSDWTGALEILERNLSAGLIDKKAFRRQRAVLLTARAID- 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            ++ D   +   A+E+ KL    + A++ AAK L   ++ R+A  ++E  W+  PHPE+A
Sbjct: 238 LEESDESLARDSALEANKLAPTLVPAAVLAAKHLAGAHQVRRAMKVIEAAWQAQPHPELA 297

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           + Y +L   +T   +L R   L     + +ES V +++ A++ GS  +A       +++ 
Sbjct: 298 STYANLKPGDTATARLGRVENLVGKGPQQLESAVAIARAAIDAGSFGRARTALEPYLEM- 356

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           P + + +L+A+IE  +  +T K   WT  A+ A+ DP+W + DGY+S  W P+SP++  L
Sbjct: 357 PTQRVAMLMAEIEHGDRGDTAKARAWTLRAVRALHDPVWTA-DGYVSDHWRPVSPVTGRL 415

Query: 416 CYFEWKIPTKS--------------------------PEYISSENINFSLEMAYPADDLQ 449
             F+W++P  +                          P   +SE +  ++E A  A  + 
Sbjct: 416 DAFQWQVPVSALPSSKAVVIDDKFHDALIASATTEALPASETSEAVTVTVEAAPEAPIVT 475

Query: 450 SMLNNGKKNH-------------------LPSIKKVSSF-EDSTIHPLDPHIRQPDDPGI 489
                                         P+      F       P+ P +R PDDPG+
Sbjct: 476 PKEPTVAAEEPAKADKPAKAAEAPAETMAAPASSPSPLFHRRKEAAPVIPIVRAPDDPGV 535

Query: 490 KEQ 492
            + 
Sbjct: 536 DDD 538


>gi|158421882|ref|YP_001523174.1| putative HemY protein [Azorhizobium caulinodans ORS 571]
 gi|158328771|dbj|BAF86256.1| putative HemY protein [Azorhizobium caulinodans ORS 571]
          Length = 532

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 112/479 (23%), Positives = 212/479 (44%), Gaps = 12/479 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RL+ +  V++ +      ++  P ++ + W      T+  V L+ L  F  A ++++ 
Sbjct: 1   MIRLVLFLIVLAAIAFGASWLADRPGEMLVVWQGWRIETTVPVALAALAAFSVALLIVWH 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +    L  P M+     +R  +KG+ A+  GL++I + +  L     +          E 
Sbjct: 61  LGALLLRSPRMIATFSRRRRREKGWAAVSRGLVAIGSGD--LDAARRARAEALRYLPKEP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL  Q A A    + A      ML  P TR   +  L+ E+ R GD+ +A+  A +A
Sbjct: 119 LTQLLAAQSAQATGHQDDALRTFRTMLDTPDTRLLGLRGLHMEARRSGDIAAARMLAEEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNRNRAILLIARSLEN 236
            + SP   W  +AV++      +++ A   L ++  +      ++ R RA+ L+A     
Sbjct: 179 ANQSPALTWAADAVIEARCGEGDYAGAREVLEKQMAHRGIDKLQYRRRRAV-LLAAEALA 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            ++ D   +   A+E+++L    + A+  A + L +  + RKA  I+E  +   PHPE+A
Sbjct: 238 LEQTDPPVARERAVEAVRLAPTLVPAAAVAGRLLGANGELRKATKIVETAYASTPHPELA 297

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
            +  HL   +    +LKR   L     +  ESL+ ++   ++     +A A     +   
Sbjct: 298 QVAAHLRPGDAALDRLKRIRTLAAKAPDHAESLIALAHATIDANEFAEARALLQR-LSAE 356

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           P + + LL+A++E +   +  K   W   AL A  DP WI+ DG +   W P+SP++  L
Sbjct: 357 PTQRVCLLMAELEASEHEDVGKAREWAARALRAPRDPAWIA-DGRVFDAWAPVSPVTGKL 415

Query: 416 CYFEWKIPT--KSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDS 472
             F W +P    +   +  E     L +A   +  ++     +   L  +    +  ++
Sbjct: 416 DAFVWAVPPGVSATPVLEHEAERVRLAIAAIREKEEARRELARAAELEKLAASEAVAEA 474


>gi|312114938|ref|YP_004012534.1| HemY domain protein [Rhodomicrobium vannielii ATCC 17100]
 gi|311220067|gb|ADP71435.1| HemY domain protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 524

 Score =  382 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 123/496 (24%), Positives = 211/496 (42%), Gaps = 18/496 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M RLI YF +I LV   F  ++  P +V+I W     +TS F+    L        LL  
Sbjct: 1   MTRLIGYFVIIVLVAVGFAWIADRPGNVTIQWLGYDIQTSVFIGSVALLLAFVIVFLLGW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +     + P      + +R    G +A+  G+ +  A +   A K  +    + T  NE 
Sbjct: 61  LGLLTWTGPKKFRGRMQRRRQRVGQEAVRRGIFAAGAGDKSAALK--ADAIARRTVPNEP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL+ Q A        + +  E ML+ P   E  +  LY E+ +     +A+++A +A
Sbjct: 119 LALLLQAQSAQLNEDSIASRQAFERMLEKPEMAELGLRGLYMEAKKANQNEAAKQFAERA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNRNRAILLIARSLEN 236
           L  +P   W + A+ +      +W  A+  L   K++      E +R R++LL   ++E 
Sbjct: 179 LAANPALAWSSSALFEIQSREGDWRAALKTLQIAKEHRHLAKPEADRRRSLLLTQLAIEL 238

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D      +   A E+  L    I A++ A + L +Q +  +A  IL + W+   HPEIA
Sbjct: 239 ED-SQPSKALAYATEAFDLSPTLIPAAVVAGRILTTQGQTSRATKILTQAWRSTQHPEIA 297

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             + H    ++   +L R   L     +++E  V V+  A++      A       +   
Sbjct: 298 LTFAHARRGDSPRDRLARVKSLVAAGSQTLEGAVAVAVSAIDAQEWKTARLALEPYLANN 357

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           P   +  L+A+IE   + ++ +   W   A    PDP+W++ DG +S+ W P+SP +  L
Sbjct: 358 PPARVCRLMARIEAGQNRDSGRAREWLAKAARGAPDPVWVAPDGTVSAEWQPISPTTGAL 417

Query: 416 CYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLP-SIKKVSSFEDSTI 474
             FEWK P   P   S+   +F+ E++         + + +   LP S  K       + 
Sbjct: 418 GSFEWKTP---PANASANPDDFAAEISA------LDVVSLEGESLPDSYAKTKGLSGRSN 468

Query: 475 HPLDPHIRQPDDPGIK 490
            P+D         G  
Sbjct: 469 EPVDVVASPVGKDGSD 484


>gi|86747438|ref|YP_483934.1| HemY-like [Rhodopseudomonas palustris HaA2]
 gi|86570466|gb|ABD05023.1| HemY-like [Rhodopseudomonas palustris HaA2]
          Length = 583

 Score =  380 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 127/487 (26%), Positives = 217/487 (44%), Gaps = 11/487 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR+I +  +I+L       V+  P DV ++W          V +  L   + A  L++A
Sbjct: 1   MLRIILFLVIIALAAAGAAWVAEQPGDVVLSWNAWRAEMRLPVFILGLGGAIVAIGLVWA 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +       P  + H    R   K  +A+  GL+++   +   AR   +   +     ++ 
Sbjct: 61  IIAALWRAPKRMKHGRAARRSGKANRAITQGLLAVGHGDAAAARSHATAARRHA--PHDP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL+ Q A  E   + A      M     T+   +  LY E+ R  D  +A   A +A
Sbjct: 119 LALLLQAQAAQLEGDRDGARRAFLAMAGRDDTKSLGMRGLYIEAQRANDPQAALAIAEEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLIARSLEN 236
           L + P+A W ++AV+       +W+ A+  L     +     K + R RA+LL AR+L+ 
Sbjct: 179 LRLQPNAAWASQAVLGFRCARADWTGALEILETNLSSGLVDKKAFRRQRAVLLTARALDV 238

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            D  D   S   A+E+ KL    + A++ AAK L   ++ R+A  +LE  W+  PHP++A
Sbjct: 239 ED-SDQSLSRDSALEANKLAPTLVPAAVLAAKCLAETHQVRRAMKVLETAWQAEPHPDLA 297

Query: 297 NIYTHLLSENTVG-KLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             Y H+   +    +L R   L        ES + +++ A++ G   +A       +   
Sbjct: 298 EAYAHIKPGDPPATRLARIENLIGKKATDFESALALARAAIDAGEFSKARLALQPYLD-N 356

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           P + + +L+A+IE     +T K   WT  A+ A+PDP+W + DGY+S  W P+SP+S  L
Sbjct: 357 PTQRVAMLMAEIEHGERGDTAKARAWTLRAVRALPDPVWTA-DGYISDHWRPVSPVSGRL 415

Query: 416 CYFEWKIPTKS-PEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDSTI 474
             F+W++P  + P   +    +     A  A      L   K +    +      +D+ +
Sbjct: 416 DAFQWQVPLAALPAKKTVVIEDNPFHDALIASSAPEALPPAKADAAVMVTVEPVADDAIV 475

Query: 475 HPLDPHI 481
            P  P  
Sbjct: 476 TPKQPEA 482


>gi|220924339|ref|YP_002499641.1| HemY domain-containing protein [Methylobacterium nodulans ORS 2060]
 gi|219948946|gb|ACL59338.1| HemY domain protein [Methylobacterium nodulans ORS 2060]
          Length = 507

 Score =  378 bits (971), Expect = e-102,   Method: Composition-based stats.
 Identities = 115/466 (24%), Positives = 211/466 (45%), Gaps = 10/466 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R + +  ++++     + ++ +P  V++TW      TS    L  +  F      ++A
Sbjct: 1   MWRALAFLALLAIAAYGAVWLADHPGVVTVTWSGYEVATSLAAALVGVLIFAVILGFVWA 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
            +R  L  P  L      R   +GY+AL  G++++ + +   AR+     +      +E 
Sbjct: 61  FTRGILRFPHRLRVRNRARRRARGYEALSRGMVAVGSGDPAAARRHAGEAA--RLLGDEP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL+ Q A        A      M + P TR   +  L+ E+ R GD  +A+ YA +A
Sbjct: 119 LALLLKAQAAQISGDRAGAENAFRRMTEEPETRVLGLRGLFVEARRQGDEATARAYAAEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKK----KNAKEWNRNRAILLIARSLEN 236
             ++P   W  EAV++     ++W+ A+  ++++      +     R RA+LL A +LE 
Sbjct: 179 ARLAPGVSWANEAVLEAQCADRDWNNALETVSRRASLGIADKTAARRQRAVLLTASALE- 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            + GD   +   A E++KL  + + A+  A +    +   ++A  ++E  WK +PHP++A
Sbjct: 238 LEAGDPERALAQAREAVKLAPDLVPAAAVAGRLFARRADLKRAARVVEAAWKASPHPDLA 297

Query: 297 NIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
            +Y  L   +++  +L RA  L  ++    ES   +++ ALE     +A       +   
Sbjct: 298 RVYLDLRPGDSSRDRLARAETLARLSSWHPESRFAIARAALEAREFGRARDVLSPLLADN 357

Query: 356 PRKEIFLLLAQIEQANSH-NTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKT 414
           P + ++L++A+IE+A     + +   W   A HA  DP W   DG +S  W P+SP+S  
Sbjct: 358 PTQRVYLMMAEIEEAEHGRGSGRAREWLARAAHAPRDPAW-CADGIVSDRWAPVSPVSGR 416

Query: 415 LCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHL 460
           L  F W+ P +     S E      E++ P           ++   
Sbjct: 417 LDAFVWQTPPELLGRSSREVPPEEKEVSEPGPLPAPGPAVKEEKPA 462


>gi|182678175|ref|YP_001832321.1| HemY domain-containing protein [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182634058|gb|ACB94832.1| HemY domain protein [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 493

 Score =  373 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 121/491 (24%), Positives = 214/491 (43%), Gaps = 23/491 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ +  +I+ +      +   P    +TW      TS  V +++L        L   
Sbjct: 1   MLRVLLFLCLIAALALGAAWIGEQPGHFLMTWQGYQVETSAPVAITLLGVSAAILALALW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +    L+ P         R  +KGY AL  G+++  A +  +A K  + +  Q     + 
Sbjct: 61  LLVTILNLPKTFARWRETRLKNKGYAALSRGIVAAGAGDTHVANK--AALDAQKYLPKDP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           LV +LE Q A      + A +   +M + P  R   +  LY E+ R  D  +A  +A +A
Sbjct: 119 LVLVLEAQAAQLAGDRSRAQDAFRLMGERPEMRLLGLRGLYAEALRNDDSEAAYHFAHEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFL----NQKKKNAKEWNRNRAILLIARSLEN 236
             + P  PW  +AV+ +++ A++W  A   L    N +  +     R  AIL  A + E 
Sbjct: 179 HKVHP-LPWSAKAVLDEHIRAQDWEGAFGILGKQINAQLVDKATGERQCAILETAMAQEK 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            +      +     ++LK   + + A +  A     +N  R+A  ++E+ W    HP+IA
Sbjct: 238 -ELSAPDEALRLGRQALKHAPDLVPAIVLVAHLWGRKNDVRRAAKLIEREWPNIQHPDIA 296

Query: 297 NIYTHLLSENT-VGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHA--KAMLAMK 353
             Y  L   ++ + +L+RA RL  +   S ES + V+  A+       A    + +LA +
Sbjct: 297 LAYLDLRPGDSNMDRLRRAQRLARLAPGSAESRLSVAGAAIAARQFALARETMRELLAKE 356

Query: 354 IAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISK 413
             P   +  L+A++E+  S  +  +  W   A  A  D  W++ DG++S  WLP SP++ 
Sbjct: 357 KTPTVRMCQLMAELEETESGFSGSVREWLAKASRAPRDETWVA-DGFVSPKWLPASPVTG 415

Query: 414 TLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDST 473
            L  F W+ P         E +  +L+ A   ++   +L+  +K+   + KK +  E   
Sbjct: 416 QLDAFRWQRPV--------ERLVVTLDNAEAVEETALLLSEEEKHGADTSKKAAVQE--- 464

Query: 474 IHPLDPHIRQP 484
           I P      QP
Sbjct: 465 ILPPAEASTQP 475


>gi|154245109|ref|YP_001416067.1| HemY domain-containing protein [Xanthobacter autotrophicus Py2]
 gi|154159194|gb|ABS66410.1| HemY domain protein [Xanthobacter autotrophicus Py2]
          Length = 567

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 107/450 (23%), Positives = 210/450 (46%), Gaps = 10/450 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RL+ +  ++  +      ++  P +V++ W    Y T+  V L+++       ++L+ 
Sbjct: 1   MIRLVLFLLLLVAITFGVSWLADRPGEVTVVWEGVAYGTTVPVALAVIAVVAGLILILWR 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +    +  P ++     +R  +KG+ A+  GL+++   +   A    +         +E 
Sbjct: 61  ILSLLVRSPKIIAAFSRRRRREKGWNAVTRGLLAVGIGDN--AAVRQARHDAARLLPHEP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L +LL  Q A  + ++ +A      M+  P TR   +  L+ E+ + GD  +A   A +A
Sbjct: 119 LTHLLTAQAAQLDGKHEVAVAAFRAMVDKPETRLLGLRGLHMEARKAGDKVAAYAIAEEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLEN 236
              +P   W  +AV++    A +++ A   L ++      +  ++ R +A+LL A ++  
Sbjct: 179 ASAAPTLGWAADAVIEARCAAGDYAGARGVLERQMALKGIDKAQYRRRKAVLLAAEAIA- 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            +  D + +   A+E+++L    + A+ CA + L +  + RKA  ++E  +  NPHPE+A
Sbjct: 238 LEHSDPLVAREKAVEAVRLAPTLVPAAACAGRLLGAAGELRKAAKVVETAFATNPHPELA 297

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           ++  +L   +    +LKR   L        ES + +S+ A++     QA       +   
Sbjct: 298 DVEAYLRPGDAAQDRLKRIRTLVNRAPSHRESAIALSRAAIDAHEFRQARLVLEPLL-AE 356

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTL 415
           P + + LL+A++E A   +  K   WT  A+ A  DP WI+ DG +S  W  +SP+S  L
Sbjct: 357 PSQRVCLLMAELEAAEHADIGKAREWTARAVRAHRDPAWIA-DGVVSDAWAAVSPVSGKL 415

Query: 416 CYFEWKIPTKSPEYISSENINFSLEMAYPA 445
             F W++P         E+    ++ A  A
Sbjct: 416 DAFVWEVPPGVSATPILEHEAERVKAAIAA 445


>gi|170748490|ref|YP_001754750.1| HemY domain-containing protein [Methylobacterium radiotolerans JCM
           2831]
 gi|170655012|gb|ACB24067.1| HemY domain protein [Methylobacterium radiotolerans JCM 2831]
          Length = 536

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 110/479 (22%), Positives = 205/479 (42%), Gaps = 14/479 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R + +  +++L     + ++  P  V++ W      TS  V L  +        LL+A
Sbjct: 1   MWRALAFLALLALAAFGAVWIADRPGTVTVVWNGYQIGTSLAVALVGVIAAAIVLGLLWA 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R  +  P  L     +R   KG  AL  G++++ + +   AR+       +     E 
Sbjct: 61  IVRGVIGLPEALVRGSAERRRAKGLSALSRGMVAVGSGDPLAARRYAG--DAERLLGTEP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL+ Q A      + A    + M+  P TR   +  L+ E+ R  D  +A+ YAT+A
Sbjct: 119 LTLLLKAQAAQISGDRDAAESAFQRMVDDPETRVLGLRGLFVEARRREDETAARAYATEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQK----KKNAKEWNRNRAILLIARSLEN 236
             ++P   W  EA+++      +W+ A+  + ++      +     R RA+LL A + E 
Sbjct: 179 ARLAPSVTWANEALLEAQSADGDWAAALETIERRSSLGLIDKAAARRQRAVLLTAIAGER 238

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            + G+   +    ++++KL  + + A+  A + L  +   +KA  I+E  WK NPHP++A
Sbjct: 239 -EAGEPELATERVLQAVKLAPDLVPAACIAGRLLARRGDVKKAARIVEAAWKANPHPDLA 297

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
            +Y  L   ++V  +L RA  L +++    ES + + + AL+     +A       +   
Sbjct: 298 KVYLGLRPGDSVRDRLARAEVLAKLSVWDPESRLALGQAALDARDYKRAREAVKPLLSDR 357

Query: 356 PRKEIFLLLAQIEQANSHN-TDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKT 414
           P     L++A IE+A     + +   W   A  A  D +WI+ DG  +  W P+SP++  
Sbjct: 358 PTARACLMMAAIEEAEHGAASGQAREWLARAARAPRDRVWIA-DGIATDTWAPVSPVTGR 416

Query: 415 LCYFEWKIPT----KSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSF 469
           L  F W+ P      +P      +      +    +    +      +  P+       
Sbjct: 417 LDAFAWREPPNTLGAAPAVEPEADAAGPALVPAAPNAAAPVAKPTPASKSPAATTSPPA 475


>gi|288957242|ref|YP_003447583.1| hypothetical protein AZL_004010 [Azospirillum sp. B510]
 gi|288909550|dbj|BAI71039.1| hypothetical protein AZL_004010 [Azospirillum sp. B510]
          Length = 449

 Score =  366 bits (940), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 110/445 (24%), Positives = 199/445 (44%), Gaps = 8/445 (1%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R + +   +++VI   I ++  P  VS+ W         +V L +L   L    L + 
Sbjct: 1   MIRALWFLLKLAVVIAIAIWLADRPGSVSVHWLGYAVEAPFWVALLVLLAALGLAALGYR 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R  +  P  L      R  ++GY+AL  G+++IAA + P ARKM          +   
Sbjct: 61  LLRGTIRLPQRLRRHSRARRRERGYRALTQGMVAIAAGDAPTARKMARKAD--VLLNEPP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL  Q A  +     A +    ML+ P T    +  L  ++ + GD   A   A KA
Sbjct: 119 LTMLLSAQAAQLQGDERAAKQYFTAMLERPETAFLGMRGLLTQAIKSGDRVEALTLARKA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILLIARSLEN 236
             + P+ PW+   +      A +W+ A   L Q  +       E  R+R +LL+ RS E 
Sbjct: 179 RGLQPNTPWLLGTLYDLEARAGDWAAAEGTLQQAIQAGAMPTEEGRRHRVVLLLERSFEA 238

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
             +G   A+   A  +  L      A++  A+  ++ ++ + A  ++E+ W+  PHPE+A
Sbjct: 239 ERRGRADAALSHAQAAHDLMPGFAPAAVRLARLQVAADRLKPAAKVVERAWRHEPHPELA 298

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
           +IY  ++ S + + +++   +L     +S ES + V++ A++     +A      AM+I 
Sbjct: 299 DIYGTIVASYDALTRVRLFQKLVRQAPDSAESHLAVARAAIDAQLWGEARQHLERAMEIG 358

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISD-DGYLSSVWLPLSPISKT 414
           P +  + L+A +++   H+ +    W   A +A  DP+W     G +S  W  L      
Sbjct: 359 PTRRTYRLMAALDRGERHDEEVAKDWLAKAANAPEDPVWTCGSCGAVSHNWGGLCGHCGA 418

Query: 415 LCYFEWKIPTKSPEYISSENINFSL 439
                WK PT +   + + ++  +L
Sbjct: 419 FDSLSWKAPTVAVPLMEATDLPPAL 443


>gi|170742656|ref|YP_001771311.1| HemY domain-containing protein [Methylobacterium sp. 4-46]
 gi|168196930|gb|ACA18877.1| HemY domain protein [Methylobacterium sp. 4-46]
          Length = 528

 Score =  365 bits (936), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 112/446 (25%), Positives = 210/446 (47%), Gaps = 13/446 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R + +  +++L     + ++ +P  VS++WG     TS    L  +         L++
Sbjct: 1   MWRALAFLALLALAAYGAVWLADHPGVVSVSWGGVDVATSLNAALVGVLVLAVVLGFLWS 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           ++R  L  P  +    H+R   +G++AL  G++++ + +   AR+       +    +E 
Sbjct: 61  LARGVLRLPRRMRASSHERRRTRGFEALSRGMVAVGSGDPAAARRHAGEA--ERLLGSEP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL  Q A        A      M +   TR   +  L+ E+ R GD  +A+ YA +A
Sbjct: 119 LALLLTAQAAQISGDRAGAERAFRRMTEASETRVLGLRGLFVEARRQGDEATARAYAAEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQK----KKNAKEWNRNRAILLIARSLEN 236
             ++P   W  EAV++     ++W+ A+  ++++      +     R RA+LL A + E 
Sbjct: 179 SRLAPGVSWANEAVMEAQCADRDWAGALETVSRRAALGLADKAASRRQRAVLLTASAQE- 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            + GD   +   A E+++L  + + A++ A + L  + + +KA  ++E  WK  PHP++A
Sbjct: 238 LEAGDPERALAQAREAVRLAPDLVPAAVVAGRLLSRRAELKKAARVIEAAWKAGPHPDLA 297

Query: 297 NIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
            +Y  L   +++  +L RA  L  ++    E+   +++ ALE     +A       +  +
Sbjct: 298 RVYLDLRPGDSSRDRLARAETLARLSSWHPEARFAIARAALEAREFGRARDVLQPLLAES 357

Query: 356 PRKEIFLLLAQIEQANSH-NTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKT 414
           P +  +LL+A+IE+      + +   W   A HA  DP W   DG +S  W P+SP+S  
Sbjct: 358 PTQRAYLLMAEIEETEHGRGSGRAREWLSRAAHAPRDPAW-CADGIVSDRWAPISPVSGR 416

Query: 415 LCYFEWKIPTKSPEYISSENINFSLE 440
           L  F W+ P   PE ++  + +  L 
Sbjct: 417 LDAFVWQTP---PELLAGRSQDLPLP 439


>gi|296444989|ref|ZP_06886950.1| HemY domain protein [Methylosinus trichosporium OB3b]
 gi|296257410|gb|EFH04476.1| HemY domain protein [Methylosinus trichosporium OB3b]
          Length = 466

 Score =  364 bits (935), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 107/453 (23%), Positives = 188/453 (41%), Gaps = 13/453 (2%)

Query: 20  IVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKR 79
            +  +P  +++ WG     TS  V ++     +   I+ +A+   F   P  L      R
Sbjct: 20  WMLEHPGSITLDWGGYHIETSLLVAIAATLGLIALVIIAWAILVSFFQAPTRLAQSSRSR 79

Query: 80  NYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIA 139
             +KG++AL  G+++  A ++  A+K       +     E L +LL+ Q+A  E     A
Sbjct: 80  RREKGFQALSRGIIAAGAGHVGAAKKASKEA--EKCLAKEPLTFLLKAQVAQLEGDRVGA 137

Query: 140 HEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYV 199
                 M  +  TR   +  L+ E+ R  D  +A  +A +A  ++P  PW   A+++ + 
Sbjct: 138 ETAFHEMTLLSETRLLGLRGLHIEAKRRNDAEAAHLFADQAHQLAP-VPWAGHALLEHHG 196

Query: 200 LAKEWSRAITFLNQKKKNA----KEWNRNRAILLIARSLENADKGDMIASYHDAIESLKL 255
              +W  A   +    K          R RA++  A ++E         + H A +++K 
Sbjct: 197 SNADWEEARVAIEANLKAKAIDLPTAQRLRAVVETALAMEKQVDS-PSEALHLARQAVKR 255

Query: 256 CDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLS-ENTVGKLKRA 314
               + A     + L       KA  +LEK +  NPHP+I   Y      E+   +L R 
Sbjct: 256 APTLVPAIALIGRLLARHGDSAKALKLLEKAYAENPHPDIVAAYLDASPSESNAERLARV 315

Query: 315 LRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKI--APRKEIFLLLAQIEQANS 372
            +L     ++ ES VIV++ AL       A       +    AP  +I LL+A++E A +
Sbjct: 316 KKLALAAPKAPESGVIVARAALAARDFAMARRALAPLVAEGQAPTAQICLLMAEVEDAEN 375

Query: 373 HNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEWKIPTKSPEYISS 432
             +  +  W      A  DP WI+ DG +S  W P SP++  L  F W  P + P    +
Sbjct: 376 GPSGPVREWLARGSRAPRDPAWIA-DGVISRSWAPASPVTGKLDAFVWTTPPE-PIRGPA 433

Query: 433 ENINFSLEMAYPADDLQSMLNNGKKNHLPSIKK 465
           E+    +  A+     + +L   + +      +
Sbjct: 434 EDARAGIPAAFLTTRQERLLEAAEIDADSGAAE 466


>gi|218672801|ref|ZP_03522470.1| hypothetical protein RetlG_14767 [Rhizobium etli GR56]
          Length = 382

 Score =  363 bits (932), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 131/369 (35%), Positives = 200/369 (54%), Gaps = 6/369 (1%)

Query: 15  ICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFH 74
              F   +  P D+S+ W  ++Y+T   V +S +   + A ++++   R   + P  +  
Sbjct: 15  AYGFSWFADRPGDLSLIWEGQIYQTKLIVAVSAIIALIAAVMIVWWFVRLIWTSPHSVTR 74

Query: 75  MLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAER 134
               R  D+GY+AL TGL++  A N  LARKM +          E L+ LLE Q AL E 
Sbjct: 75  YFRARKRDRGYQALSTGLIAAGAGNALLARKMAARSRGLIRADQEPLINLLEAQAALIEG 134

Query: 135 QYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAV 194
           +++ A  K E M   P TRE  +  LY E+ R+G   +A++YA KA D +P  PW  +A 
Sbjct: 135 RHDEARAKFEAMANDPETRELGLRGLYLEARRLGANEAARQYAEKAADNAPYLPWAAQAT 194

Query: 195 VQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLENADKGDMIASYHDAI 250
           ++    A  W  AI  L Q+K        E NR  A+LL AR+ E  + G+   +  DA+
Sbjct: 195 LEYRSQAGRWDDAIRLLEQQKAARVVEKTEANRLHAVLLTARAGEKLE-GNPAGARDDAL 253

Query: 251 ESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLL-SENTVG 309
           ++LKL  + + A++ AAK+L  +   RKA  ILE+ WK  PHPEI   Y      ++T+ 
Sbjct: 254 QALKLAADFVPAALIAAKALFREGGLRKAASILEQAWKSAPHPEIGQTYVRARSGDSTLD 313

Query: 310 KLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQ 369
           +LKRA RLE +   +VESL++V++ AL+     +A  KA  A +I PR+  FLLLA IE+
Sbjct: 314 RLKRAERLEALRPNNVESLLVVAQAALDAQEFAKARTKAEAAARIEPREAAFLLLADIEE 373

Query: 370 ANSHNTDKI 378
           A + +  ++
Sbjct: 374 AETGDQGRV 382


>gi|298292771|ref|YP_003694710.1| HemY domain protein [Starkeya novella DSM 506]
 gi|296929282|gb|ADH90091.1| HemY domain protein [Starkeya novella DSM 506]
          Length = 526

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 116/498 (23%), Positives = 221/498 (44%), Gaps = 18/498 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RL+ Y  V++L+      ++  P  ++I W      TS  V  S L   L A ILL+ 
Sbjct: 1   MIRLVVYLLVLALIAFGVAWLADRPGSIAIDWQGWQIETSILVAASALLALLAATILLWT 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R     P ++      R  ++G+ A+  GL+++ + +   AR+  +    +    +E 
Sbjct: 61  LLRLIFRSPELIAFSWRSRRRNRGWAAVTRGLVAVGSGDALGARR--AANDAERLLGHEP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL  Q A      + A      M + P+TR   +  L+ E+ R GD  +A   A +A
Sbjct: 119 LTRLLAAQAAQLAGDRDGAEAAFRAMSETPSTRLLGLRGLHVEARRRGDAAAALLSAEEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA---KEWNRNRAILLIARSLENA 237
             + P   W  +AV++   L  +++ A+  L ++  +    +  +R R  +L+A   +  
Sbjct: 179 ARVEPGLAWAADAVIEARCLNGDFAGALATLEREAAHGGLERAAHRRRRAVLLAAQAQAL 238

Query: 238 DKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIAN 297
           +  D   +   A+E+ +L    + A+  A + L +    RKA  I+E  +   PHP++A+
Sbjct: 239 ELSDPSTAREKAVEATRLAPTLVPAAEVAGRLLGASGDTRKAAKIIEAAYAATPHPDLAD 298

Query: 298 IYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAP 356
            + HL   +++  +LKR   L        ES +++++ A++    D A       +   P
Sbjct: 299 AFLHLRPGDSSQERLKRIRTLTARMPSHPESAMVLARAAIDAQEFDVARTALGPLLG-EP 357

Query: 357 RKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLC 416
            +   LL+A++E A   +  K   WT  A+ A  DP W++ DG ++  W P+SP++  L 
Sbjct: 358 TQRACLLMAELEAAEHGDVGKAREWTARAVRAARDPAWVA-DGVVAERWAPVSPVTGKLD 416

Query: 417 YFEWKIPT----------KSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKV 466
            FEWK+P           ++    ++         A  A+    +++   +   PS+   
Sbjct: 417 AFEWKLPPGVATTPMLENEAERVKAAIAAAIEARPAAEAEPEPPVVDLTPEEPAPSLAPE 476

Query: 467 SSFEDSTIHPLDPHIRQP 484
           +  ++           +P
Sbjct: 477 AEVKEPAKPEAIRPAPKP 494


>gi|154251805|ref|YP_001412629.1| HemY domain-containing protein [Parvibaculum lavamentivorans DS-1]
 gi|154155755|gb|ABS62972.1| HemY domain protein [Parvibaculum lavamentivorans DS-1]
          Length = 512

 Score =  357 bits (916), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 112/489 (22%), Positives = 195/489 (39%), Gaps = 24/489 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR +  F +++++    I ++  P D+ + W     RTS  V + ++    F  +L + 
Sbjct: 1   MLRALYIFLIVAVLSGIAIWLADNPGDLIMHWRGYEIRTSFVVGVGVMALAAFLVLLAYR 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +   F+  PA +   L KR   KG+ AL  G++++AA +   A++  +   +        
Sbjct: 61  IIVSFIETPASVSAYLEKRRQQKGFLALSRGMVAVAAGDAADAKRYAAQAHK--LLDAPP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL  Q A  E     A    E ML  P T    +  L+ ++ R GD + A  +A +A
Sbjct: 119 LTLLLAAQAAQLEGNEAAATAYFEQMLAAPETEFLGLRGLFIQARRAGDRDGALAHARRA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQ----KKKNAKEWNRNRAILLI------ 230
            ++ P  PW  +AV +     ++W  A+  L++    K     E  R RA+LL       
Sbjct: 179 FNLRPQTPWAAQAVFEIEAAEEDWDAALETLDRVVSAKLIPRDEARRRRAVLLTARAMTA 238

Query: 231 ----ARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKI 286
                  +       +  +   ++E++ L      A   AA+      + RK   ++E  
Sbjct: 239 AEAAYGQVGEGRTSALEKATKLSLEAVSLEPKFPPAVALAARLCGETGRARKGMKLIEDA 298

Query: 287 WKVNPHPEIANIYTH-LLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAH 345
           W   PHP++A+++   +  E+   +  RA  L   N + +ES ++V++ A+       A 
Sbjct: 299 WSDAPHPDLADVWLDMIEGESGYDRATRARVLASRNVDHIESRILVARGAIGARDWAAAR 358

Query: 346 AKA----MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYL 401
                      K  P + I  L+A+IE+    +      W   ALHA  DP W    GY 
Sbjct: 359 EALVPYTGAEAKEVPTQCICELMAEIEEGEFGDRGASRSWLTRALHAPADPQWT-GTGYR 417

Query: 402 SSVWLPLSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLP 461
           S  W P++P++      EW  P   P                  +               
Sbjct: 418 SPRWSPVNPVTGEFDALEWSAPL--PMLGRETAAVEPAPAKSTPEPAPVQSAERSIAARE 475

Query: 462 SIKKVSSFE 470
             K  ++ E
Sbjct: 476 EHKSTAAGE 484


>gi|209965650|ref|YP_002298565.1| HemY domain protein [Rhodospirillum centenum SW]
 gi|209959116|gb|ACI99752.1| HemY domain protein [Rhodospirillum centenum SW]
          Length = 472

 Score =  350 bits (899), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 98/469 (20%), Positives = 185/469 (39%), Gaps = 14/469 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R + +F  I L+I   I ++  P  VSI + + +     + +L  L   + A ++L+ 
Sbjct: 1   MRRAVFFFIKIGLLIALAIWLARNPGSVSIQFQDWMVDMPFWAMLLALAVIIVASVVLYR 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V  F +  PA           ++GY AL  G++++AA +   A +           +   
Sbjct: 61  VFSFVVGGPAAFARSRQAAKRERGYHALTQGMVAVAAGDREAASRFARKADT--LLNEPP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL  Q A        A +  + MLQ P T    +  L  ++ + GD   A + A +A
Sbjct: 119 LTLLLSAQAAQLAGDDMAARKYFQSMLQRPETEFLGLRGLLTQALKGGDRTEALKLARRA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILLIARSLEN 236
            +I P A W   A+++       W +A   L++             R+R  LL+ R+   
Sbjct: 179 AEIQPKAQWPVLALMELEAKEGHWKQAEEALDRATATKALPQETLRRHRVALLVERARTA 238

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
             +G    +   A  + +   + + A++  A        ++ A   +E+ WK+ PHPE+A
Sbjct: 239 VAEGRSKDALALAQRANEQMPSHVPAAVLVATLRAQAGNRKAATRAIEEAWKIAPHPELA 298

Query: 297 NIYTHLL-----SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLA 351
             +  +        +    +KR   L  ++  +  + V + +  L     DQA      A
Sbjct: 299 EAWGRIEAIFRPGIDPASLVKRYEALVALDPRAAAAYVALGEACLRADLRDQARTHLEKA 358

Query: 352 MKIAPRKEIFLLLAQIEQANSHNTDKILYWTQS--ALHAMPDPLWIS-DDGYLSSVWLPL 408
             +AP + +F LL ++ +    + + +  W +    LH  PDP+W+    G  ++ W  +
Sbjct: 359 WTLAPTQHVFRLLTELARHEDGDGEAMREWLERSAGLHPDPDPVWVCSACGTPAAGWSAV 418

Query: 409 SPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKK 457
            P  +     EW+    +     +         + PA    +       
Sbjct: 419 CPSCRGFDTMEWRAAKPALRLADTAPAAILPAASRPAPATTTPDTPAAG 467


>gi|323135815|ref|ZP_08070898.1| HemY domain protein [Methylocystis sp. ATCC 49242]
 gi|322398906|gb|EFY01425.1| HemY domain protein [Methylocystis sp. ATCC 49242]
          Length = 464

 Score =  348 bits (894), Expect = 8e-94,   Method: Composition-based stats.
 Identities = 100/431 (23%), Positives = 187/431 (43%), Gaps = 12/431 (2%)

Query: 13  LVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAML 72
           +V      +   P  +++ +       S  V ++ L   +   I+++A+    +  P  +
Sbjct: 13  VVALGLEWLIEQPGSLTLEFAGWHMEASIPVAVAGLLLLIATVIVVWAIVVALIRLPRRM 72

Query: 73  FHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALA 132
                +R  ++G   +  GL+++ A ++       +    +     E L  +L  Q A  
Sbjct: 73  AGGSRERRRERGLDVISQGLVAVGAGDLAR--ARKAAALAERLLPGEPLTQMLNAQAAQL 130

Query: 133 ERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
              +  A +    M   P T+   +  L+ E+ R  D  +A  +A  A +I+P  PW   
Sbjct: 131 SGDHQAAAKAFHKMTLKPETKLLGLRGLHIEAKRRQDAEAAHHFAKAAHEIAP-LPWAGS 189

Query: 193 AVVQQYVLAKEWSRAITFLNQKK----KNAKEWNRNRAILLIARSLENADKGDMIASYHD 248
           AV++ +    +W +A   +         +A      RA++  A ++E   +     +   
Sbjct: 190 AVLEHHAAGGDWEKARAAVEANLAAKAIDAATAQNLRAVIETAMAMEKERE-HPHDALRL 248

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLS-ENT 307
           A ++LK       A+  AA+ LI    +++A  ++E +W   PHP++A +Y   L  E+ 
Sbjct: 249 ARQALKRRPGFPPAAATAARVLIHHGDRKQALKLIETVWATKPHPDLAEVYFEALPDESN 308

Query: 308 VGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML--AMKIAPRKEIFLLLA 365
             ++ R  +L  +  ++ ES  I+++ AL      +A        A    P     LL+A
Sbjct: 309 SQRVARIEKLARLAPDAPESRHILAQAALSARDFTKAREALAPLVAAGQHPTAHTCLLMA 368

Query: 366 QIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEWKIPTK 425
           +IE A +  +  +  W      A  DP WI+ DG +S  WLP+SP+S  L  FEWKIP  
Sbjct: 369 EIEDAQNGPSGPVREWLARGSRAPRDPAWIA-DGVVSKHWLPISPVSGKLDAFEWKIPPH 427

Query: 426 SPEYISSENIN 436
           S ++++ E   
Sbjct: 428 SAQHLTEEGQP 438


>gi|163797972|ref|ZP_02191914.1| Uncharacterized enzyme of heme biosynthesis [alpha proteobacterium
           BAL199]
 gi|159176766|gb|EDP61337.1| Uncharacterized enzyme of heme biosynthesis [alpha proteobacterium
           BAL199]
          Length = 456

 Score =  340 bits (873), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 85/455 (18%), Positives = 164/455 (36%), Gaps = 8/455 (1%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R   Y   +++++   I +   P D+ I W          + + I     +   +   
Sbjct: 1   MRRSFLYIIRLAILVALAIWLVRNPGDIRIDWIGWRLEMPFALFMVITVAVTWVAGIGLR 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           ++   L  P  +      +  + G++AL  GL +IAA +   AR+            +  
Sbjct: 61  MAAGALGAPWAVMRRRADQRRESGFRALTLGLAAIAAGDAEEARRQAREAD--RLLRDPS 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL  Q A        A      +     T    +  L  ++   GD   +   A +A
Sbjct: 119 LTRLLSAQAAALNGDTAAAARYFAALRDNEDTAFLGIVGLLRQALARGDEARSLELAEEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLIARSLEN 236
             + PDAP V    +     A+ W  A   L    K      ++  R+R+ LL  R+ E 
Sbjct: 179 YAMRPDAPLVATTRLYGRARARRWFDAQVALYDAVKRRIVPEEDGRRHRSALLTERAREA 238

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
                +  +   A ++ +     + A    A+ L    K ++ + ++E+ W  +PHP + 
Sbjct: 239 LAADKLDEALEFAGKARESVPGFVPAVALEAELLGRTGKAKRGQRLIEEAWPKSPHPALT 298

Query: 297 NIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             Y  L++E  +  + KR   L +   +  ES + +++ AL+     +A  +        
Sbjct: 299 EAYRGLVTETNLIDRFKRLHALADHAVDHPESRMTIAEAALDAELWGEARVQLEALTGSD 358

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISD-DGYLSSVWLPLSPISKT 414
                  L A++E A   +      W + +  A  DP W     G ++  W  +      
Sbjct: 359 LTARACRLRARLEDAEHGDDRAARLWLERSGSAPADPAWTCGSCGAVAPDWSAVCGHCGE 418

Query: 415 LCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQ 449
                W +P +     S +  +  +++      L 
Sbjct: 419 FDTVAWTLPPRVSVLSSDDVADLEVDVVEMPHSLP 453


>gi|218662368|ref|ZP_03518298.1| hypothetical conserved membrane protein [Rhizobium etli IE4771]
          Length = 428

 Score =  325 bits (833), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 121/356 (33%), Positives = 185/356 (51%), Gaps = 7/356 (1%)

Query: 108 SYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRI 167
           +          E L+    +++ L E +++ A  K E M   P TRE  +  LY E+ R+
Sbjct: 1   ARSRGLIRADQEPLINCSRLRVRLMEGRHDEARAKFEAMANDPETRELGLRGLYLEARRL 60

Query: 168 GDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNR 223
           G   +A++YA KA D +P  PW  +A ++    A  W  AI  L Q+K        E NR
Sbjct: 61  GANEAARQYAEKAADNAPYLPWAAQATLEYRSQAGNWDDAIRLLEQQKAARVVEKTEANR 120

Query: 224 NRAILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVIL 283
             A+LL AR+ E  + G+   +  DA+++LKL    + A++ AAK+L  +N  RKA  IL
Sbjct: 121 LHAVLLTARAGERLE-GNPAGARDDALQALKLAAGLVPAALIAAKALFRENGLRKAASIL 179

Query: 284 EKIWKVNPHPEIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSID 342
           E+ WK  PHPEI   Y      ++T+ +LKRA RLE +   +VESL++V++ AL+     
Sbjct: 180 EQAWKSAPHPEIGQTYVRARSGDSTLDRLKRAERLEALRPNNVESLLVVAQAALDAQEFA 239

Query: 343 QAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLS 402
           +A AKA  A +I PR+  FLLLA IE+A + +  ++ +W   AL A  DP W++ DG++S
Sbjct: 240 KARAKAEAAARIEPREAAFLLLADIEEAETGDQGRVRHWLAQALKAPRDPAWVA-DGFVS 298

Query: 403 SVWLPLSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKN 458
             WLP+SP++  +  FEWK P    E    +    +                 +  
Sbjct: 299 DKWLPVSPVTGRIDAFEWKAPFGQIEGRLEDGSAPAAIETALKTLPPLRDVRPESP 354


>gi|83313522|ref|YP_423786.1| hypothetical protein amb4423 [Magnetospirillum magneticum AMB-1]
 gi|82948363|dbj|BAE53227.1| Uncharacterized enzyme of heme biosynthesis [Magnetospirillum
           magneticum AMB-1]
          Length = 426

 Score =  311 bits (798), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 91/428 (21%), Positives = 169/428 (39%), Gaps = 9/428 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R + +  +  L +   + ++  P +V+I W      T+  V+L++L   L    LL  
Sbjct: 1   MRRFLVFVVLTGLAVAGAVWLADRPGEVTIRWQGWRLDTTVPVLLAVLALLLVGLSLLAR 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R     P             KGY AL  GL + A+ +   A K+     +     +  
Sbjct: 61  LVRAVFGAPGRWLQSRRLGRQRKGYMALSDGLAAAASGDAARAAKLSRKADK--LLKDPA 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           +  LL  Q A      +   ++   M     T       L   + + GD   A+  A +A
Sbjct: 119 VTALLTTQAAQLGGDADQLRDRFRAMTGRKETAFLGHKGLAELALKSGDRAIARDEAARA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLIARSLEN 236
            ++ P A  +   ++  +V A  W+ A   L   +++      ++ R  A++L+ R+ E 
Sbjct: 179 FELQPMAADLAVQLLDLHVEAGAWAEAEQVLRLARRHGAVSEADFPRRHALILLGRAEEA 238

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
              GD   +   A ++         A   AA  L  + K RKA  +L+  +K +PHP + 
Sbjct: 239 LRAGDESLALDWAQDARDADPLFTPAITLAADLLRRRGKGRKAASLLKAAFKAHPHPLLI 298

Query: 297 NIYTHL-LSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             +  L   E+ + ++K    L + N  + E  + +++ AL+      A      A +  
Sbjct: 299 TEWRKLGDGESALDRVKSLQELAQANPGAPEGHMALAEAALDAQLWGLARTHLAKAQEQR 358

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALH-AMPDPLWIS-DDGYLSSVWLPLSPISK 413
           P + +F LLA++E+    +      WT  A   ++P+  W     G+ +  +    P   
Sbjct: 359 PTRAVFALLARVERDERKDEAAANAWTLKAATDSVPESSWTCGGCGHQTPDFALSCPACG 418

Query: 414 TLCYFEWK 421
                EW 
Sbjct: 419 AAGRLEWT 426


>gi|46201304|ref|ZP_00208051.1| hypothetical protein Magn03009978 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 426

 Score =  311 bits (797), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 103/428 (24%), Positives = 176/428 (41%), Gaps = 9/428 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R + +  +  L +   + ++  P +V+I W      TS  V+L++L   L A  +L  
Sbjct: 1   MRRFLAFLVLTGLAVAGAVWLADRPGEVTIRWQGWRADTSVPVLLAVLALLLLALSVLIR 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R     P      L      KGY AL  GL + A+     AR            H+  
Sbjct: 61  LIRLVFGAPKRWLAALRLSRQRKGYAALSDGLAAAAS--GDAARAAKLARKADKLLHDPA 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           +  LL  Q A      +   E+   M +   T       L   + + GD  +A+  A KA
Sbjct: 119 ITGLLSSQAARLSGDDHQLAERFRAMTERKETAFLGHQGLAELAVKAGDRTTARAEAAKA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAILLIARSLEN 236
            DISP AP ++  ++  ++ A  W+ A       +++      ++ R RA++L+ R+ ++
Sbjct: 179 FDISPTAPDLSVLLLDLHMEAGAWAEAEQVARLARRHGSLSEADFTRRRALILLGRAEDS 238

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
              GD   +   A +S         A   AA  L  + K RKA  +L+  +K + HP + 
Sbjct: 239 MAAGDEAQALDWAQDSRDADPQFTPAVALAADLLRRRGKGRKAASLLKSAFKTHAHPLLI 298

Query: 297 NIYTHL-LSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             +  L   E+ + ++KR   L + N  S E  V +++ AL       A +    A+   
Sbjct: 299 AKWLTLGEGESALDRVKRLQDLSQANPASPEGHVALAEAALAAQLWGLARSHLEKALTQR 358

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSA-LHAMPDPLWIS-DDGYLSSVWLPLSPISK 413
           P + +F LLAQ+E+    +      W   A   ++P+P W+    G+ S  +    P   
Sbjct: 359 PTRTVFQLLAQVERDERKDETAAHGWLMKAGTDSVPEPAWVCGGCGHHSPDFALCCPACG 418

Query: 414 TLCYFEWK 421
                EW 
Sbjct: 419 AAGRLEWT 426


>gi|304320180|ref|YP_003853823.1| hypothetical protein PB2503_03027 [Parvularcula bermudensis
           HTCC2503]
 gi|303299083|gb|ADM08682.1| hypothetical protein PB2503_03027 [Parvularcula bermudensis
           HTCC2503]
          Length = 512

 Score =  300 bits (768), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 91/486 (18%), Positives = 189/486 (38%), Gaps = 22/486 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++ +  +I+++  +   ++       I +G+        V+           I    
Sbjct: 1   MIRILVFLTIIAVLAAAITGLASVEGFAVIRFGDTNITARSSVLFGAALIGAVLLICATL 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHT--FHN 118
           +    +  P+ +     +R  ++G  AL  GL ++AA +   A+++     +Q     + 
Sbjct: 61  ILSGIVRLPSSIRRQRAERRRERGLIALTRGLEAVAAGDASDAQRLARTAQKQLGQQGNE 120

Query: 119 EYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYAT 178
             L  LL  Q A        A +    MLQ P T    +  LY ++   GD   A++YA 
Sbjct: 121 AGLSRLLTAQAAQLAGDEETAQQSFAAMLQAPETEFLGLRGLYLQAMASGDRKEARQYAE 180

Query: 179 KALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNRNRAILLIARSL 234
           +A  + P A W  ++V    +    W  A   L + +++     +   R  A LL A + 
Sbjct: 181 RAFKLRPGASWAFQSVYALQLERGAWGEARDALLKAQQHGLEKGEPSRRREAALLTAMAY 240

Query: 235 ENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPE 294
                 D   +  +A E+L+       A++ AA+      ++ +A  +L++ W ++PHP 
Sbjct: 241 GAEAAEDTDTAIKEAEEALRKAPGFAPAAVLAAELETKAGRRSRAGKLLDEAWAISPHPA 300

Query: 295 IANIYTHLLS-ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMK 353
           +A     + + E    +  R + L     E+ ES +++++    +G   +A A+    + 
Sbjct: 301 LAKTMDEIYAKEKLERRTDRLIALANKRPEADESQLLIAEQENRLGKFTEAKARLEPLLT 360

Query: 354 IAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISK 413
             PR   F  +A   +     ++    W   A +A  DP+  +D  ++            
Sbjct: 361 RNPRARTFSAMAAAVRGLYG-SEAAQIWLDRAANAPLDPVPGADGSFV------------ 407

Query: 414 TLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDST 473
                 W+                 L++   +  L+ +        L ++++V++ E +T
Sbjct: 408 -FTTDGWQR-LIREFGDHGRLAPPPLDVIRTSLTLEEVKLLSAPASLDTVQEVAADETAT 465

Query: 474 IHPLDP 479
             P  P
Sbjct: 466 SAPSTP 471


>gi|83594895|ref|YP_428647.1| HemY-like [Rhodospirillum rubrum ATCC 11170]
 gi|83577809|gb|ABC24360.1| HemY-like [Rhodospirillum rubrum ATCC 11170]
          Length = 433

 Score =  298 bits (763), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 87/407 (21%), Positives = 175/407 (42%), Gaps = 10/407 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR++ +  +  L++   + ++ +P  V++ W      TS  V+L  L   +   +    
Sbjct: 1   MLRILLFVLLAGLLVIGAVWIAEHPGIVALNWLGWHIETSIMVLLITLVVLIGLLLFFSR 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
                L  P       +++   +G  A+  G+ +    ++ LARK+      +       
Sbjct: 61  FFGGILGIPQWWRRRRNEKKLRRGSLAVGEGIAAARGGDVHLARKLLK--DAERLLPGAA 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
               L    A A  + ++A +   +ML+ P T+      L   +   GDL+ A     +A
Sbjct: 119 GTQQLTADTAAAAGETDVAEKAYGLMLENPRTQASGRRGLLDLALTRGDLDKAYAIVREA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQK----KKNAKEWNRNRAILLIARSLEN 236
           +    DAPW T  + +  +L ++W+ A + L +      K   +    +A LL  ++ + 
Sbjct: 179 VATGVDAPWATATLFRLQLLRRQWADAESTLAKAGNGVLKPGDDAKVVKAALLTVQARDA 238

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
              G    +   + ++++L   S  A++ AA+ L +  ++RKA  +L  +W  +PHP +A
Sbjct: 239 ELPGRGGDALRLSQQAVELDPTSREATLIAARQLAATGRQRKAAQLLIALWAKHPHPSLA 298

Query: 297 NIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             Y  L   E+++  ++ A  L   N E   S  + ++ AL+     +A       ++  
Sbjct: 299 QAYLALWTGEDSLKIVRHAQELTGANPEHPMSRRVFAEAALDAQLWGEARQSLEPLLRDV 358

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLS 402
           P   I  L+A++E+    +      W + AL A P+   + +DG  +
Sbjct: 359 PSATICRLMARLEEGEKGDVTAANQWLRRALEAGPE---VEEDGVTA 402


>gi|254292446|ref|YP_003058469.1| HemY domain protein [Hirschia baltica ATCC 49814]
 gi|254040977|gb|ACT57772.1| HemY domain protein [Hirschia baltica ATCC 49814]
          Length = 495

 Score =  292 bits (747), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 87/418 (20%), Positives = 165/418 (39%), Gaps = 15/418 (3%)

Query: 2   LRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAV 61
           +R++    V+ L I +     + P+DVSI +    Y  S +    ++        + + V
Sbjct: 1   MRIVILLAVVILTIAAVTYAFNAPDDVSIAFNGAEYGMSRYTAGILVIVTGALVAVGWYV 60

Query: 62  SRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFH--NE 119
               L  P  L     +  + K   AL  GL++    +   A K     +        + 
Sbjct: 61  LSTILRIPFALNRSAKRARFGKARNALADGLIAAEGGDSIDALKKARKSTNLAKSDASDR 120

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATK 179
            L YLL  + A A   ++ A      + +        +  L   + + GDL  A+ +  K
Sbjct: 121 KLSYLLAARAAEANGDWSDAEHAYSDLSREKGAELVGLRGLAAAAIQRGDLRGAETHTRK 180

Query: 180 ALDISPDAPWVTEAVVQQYVLAKEWSRAITFLN----QKKKNAKEWNRNRAILLIARSLE 235
           AL +  +A W    + +    A +W  A   L     +K  + +   R RA+L  A++  
Sbjct: 181 ALSLKSNASWPFSTLFELQTKAADWESANETLTIGEKRKSIDLEVARRRRAVLHTAQASR 240

Query: 236 NADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEI 295
              K     +   A ++ ++  +   A+  AA   ++  K  KA+  +E  W++ PHP +
Sbjct: 241 IRQKA-PEKAERLAADAARMAPSFPPAAYIAASLQLAAGKASKAQASIEGAWRIRPHPAL 299

Query: 296 ANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKI 354
           A ++  L  +E T  + KR   L  IN    ES +++ + A+  G  D+A       ++ 
Sbjct: 300 ALLWRDLKTNEPTSARAKRLNALAHINPSHRESRILLVEAAMIQGQWDEAEETLSHVLRE 359

Query: 355 APRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLW--ISDDG----YLSSVWL 406
                +  L+  I      + ++   W++ A  A  +  W  I  DG    +++  W 
Sbjct: 360 GETTRLCTLMEAI-VGGRGDVEQASRWSRLASSAAREADWSDIDPDGRAFNFINEDWA 416


>gi|114568597|ref|YP_755277.1| HemY domain-containing protein [Maricaulis maris MCS10]
 gi|114339059|gb|ABI64339.1| HemY domain protein [Maricaulis maris MCS10]
          Length = 492

 Score =  284 bits (726), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 108/504 (21%), Positives = 189/504 (37%), Gaps = 37/504 (7%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RLI       L       ++  P   S  +          V   ++    F  ++++ 
Sbjct: 1   MIRLILAVAFALLTAVLGAFLALNPGHASFEFLGMQTEMPFVVAAGLVILLAFLMLVVWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
                 + P  +   + +R  ++GY AL   L++ AA +   A +  +            
Sbjct: 61  GIYMLWTSPDKVKGFMGRRRREQGYDALEKALIASAAGDGEAAVRQAARADA--LLDRPA 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL  + A +      A    E +L    TR  A   L   S   GD  +   +A  A
Sbjct: 119 LSRLLAARAAESAGNLEGAQVHYEALLNDQKTRVVARRGLAQLSNERGDFAATIDHAGDA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLN----QKKKNAKEWNRNRAILLIARSLEN 236
              +  A W  +A+    V    W  A+T L     +K+       R R++LL A ++E 
Sbjct: 179 FQQAKGARWAFDALFDAQVAKARWRDALTTLTEGERRKQVAPDTARRRRSVLLTAAAVE- 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
           A+  D   +   A+ + +       A+  AA+ L    + ++A  +LE  W   PHP +A
Sbjct: 238 AEGTDSENARELAVSAHRAAPGFAPAAALAARLLADGRRHKRASEVLESAWAAAPHPALA 297

Query: 297 NIYTHLLSENT-VGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMK-I 354
             +  L   +T   +L+R   L  +N +  ES +++ +IALE G    A A     M   
Sbjct: 298 RAFQDLRKSDTKAKRLERLKTLAALNPDHRESHLVLIQIALEEGDAPAARALLDPMMDGT 357

Query: 355 APRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD------GYLSSVWLPL 408
            P   +  L A++ + +  + +    W   A HA  D  W   D       Y    W   
Sbjct: 358 PPSSRLCALAARLARLDGKD-ELARRWMTRASHAGADADWSDIDPEGRLFAYTPDDWK-- 414

Query: 409 SPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSS 468
               + +  F  +     P Y   E    ++         ++ L +  +    +  + +S
Sbjct: 415 ----RMVYVFGDENRLTHPRYERFERAAGAVP--------ETALLDAPRPVRSASSRTTS 462

Query: 469 FEDSTIHPLDPHIRQPDDPGIKEQ 492
           F ++T        R PDDPG+ E+
Sbjct: 463 FAEATP-------RMPDDPGVPEE 479


>gi|58616804|ref|YP_196003.1| hypothetical protein ERGA_CDS_00770 [Ehrlichia ruminantium str.
           Gardel]
 gi|58416416|emb|CAI27529.1| Hypothetical protein ERGA_CDS_00770 [Ehrlichia ruminantium str.
           Gardel]
          Length = 413

 Score =  279 bits (713), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 91/433 (21%), Positives = 177/433 (40%), Gaps = 34/433 (7%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTS---PFVILSILYFFLFAWI- 56
           M+  +  F VI+L +   +        V I W N     +      I+++++ F+   I 
Sbjct: 1   MITSVLIFLVIALTVG--LWAIDCDGIVRIEWLNYNIEINILFALCIIAVIFLFVILLIR 58

Query: 57  LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTF 116
           L+F V + F  C         KR  DK    L  G M +   NI  A K    +++ H F
Sbjct: 59  LVFYVCQCFYGC--------KKRRQDKRIILLDQGYMHLNCGNIEKADKC---ITKLHDF 107

Query: 117 HNEYLVYLLEVQIALAERQYNIAHEKL-EMMLQIPATREFAVYSLYFESCRIGDLNSAQR 175
            +  L +LL+ +      +Y +A +   +    +P         +     +I D +    
Sbjct: 108 DHPSL-FLLKGRFYFDSNKYTLAEKYFIQFSKVVPIIDATLGIHILNHIKQIEDQSKQLS 166

Query: 176 YATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQ--KKKNAKEWNRNRAILLIARS 233
              K L+I     W     ++   ++++W+ AI  +++  K K    ++    + ++  +
Sbjct: 167 LFRKMLEIFYKQAWSPIFKLEICCISRDWNSAIEEMHKIIKLKINVPYDTQETLCILYYA 226

Query: 234 LENADKGDMIASYHDAI---ESLK-LCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           L  A +      Y D +   +++K    +  + ++  A+  I+ NKKRKA  +LE  +++
Sbjct: 227 L--AKQYYTYQKYDDGLYVFDNMKHYSKHRTVITLLRAQLYINTNKKRKAIQLLESEYRI 284

Query: 290 NPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAM 349
           +PHP+IA++Y  ++  ++        RL  IN +   S+ ++ + AL +G  D A     
Sbjct: 285 SPHPDIAHLYLEIMHHDSQA----IHRLYNINSDYYFSIYLIVQDALNLGEYDLAMKHLN 340

Query: 350 LAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSAL-HAMPDPLWISDDGYLSS-VWLP 407
              K      ++ L+ ++ +    +  ++LYWT  A   A+ D  W           W  
Sbjct: 341 NVFKSRTYLSLYFLMLKL-KVLVQDYTELLYWTDKASKDAITDQHWQCKKCKCIPIHWNY 399

Query: 408 LSPISKTLCYFEW 420
                K      W
Sbjct: 400 ECDNCKGFNTIVW 412


>gi|57238815|ref|YP_179951.1| hypothetical protein Erum0840 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58578744|ref|YP_196956.1| hypothetical protein ERWE_CDS_00800 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57160894|emb|CAH57799.1| putative integral membrane protein [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417370|emb|CAI26574.1| Hypothetical protein ERWE_CDS_00800 [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 413

 Score =  278 bits (711), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 90/433 (20%), Positives = 177/433 (40%), Gaps = 34/433 (7%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTS---PFVILSILYFFLFAWI- 56
           M+  +  F VI+L +   +        V I W N     +      I+++++ F+   I 
Sbjct: 1   MITSVLIFLVIALTVG--LWAIDCDGIVRIEWLNYNIEINILFALCIIAVIFLFVILLIR 58

Query: 57  LLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTF 116
           L+F V + F  C         KR  DK    L  G M +   NI  A K    +++ H F
Sbjct: 59  LVFYVCQCFYGC--------KKRRQDKRIILLDQGYMHLNCGNIEKADKC---ITKLHDF 107

Query: 117 HNEYLVYLLEVQIALAERQYNIAHEKL-EMMLQIPATREFAVYSLYFESCRIGDLNSAQR 175
            +  L +LL+ +      +Y +A +   +    +P         +     +I D +    
Sbjct: 108 DHPSL-FLLKGRFYFDSNKYTLAEKYFIQFSKVVPIIDATLGIHILNHIKQIEDQSKQLS 166

Query: 176 YATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQ--KKKNAKEWNRNRAILLIARS 233
              K L+I     W     ++   ++++W+ AI  +++  K K    ++    + ++  +
Sbjct: 167 LFRKMLEIFYKQAWSPIFKLEICCISRDWNSAIEEMHKIIKLKINVPYDTQETLCILYYA 226

Query: 234 LENADKGDMIASYHDAI---ESLK-LCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
           L  A +      Y D +   +++K    +  + ++  A+  I+ NKKRKA  +LE  +++
Sbjct: 227 L--AKQYYTYQKYDDGLYVFDNMKHYSKHRTVITLLRAQLYINTNKKRKAIQLLESEYRI 284

Query: 290 NPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAM 349
           +PHP+IA++Y  ++  ++        +L  IN +   S+ ++ + AL +G  D A     
Sbjct: 285 SPHPDIAHLYLEIMHHDSQA----IHKLYNINSDYYFSIYLIVQDALNLGEYDVAMKHLN 340

Query: 350 LAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSAL-HAMPDPLWISDDGYLSS-VWLP 407
              K      ++ L+ ++ +    +  ++LYWT  A   A+ D  W           W  
Sbjct: 341 NVFKSRTYLSLYFLMLKL-KVLVQDYTELLYWTDKASKDAITDQHWQCKKCKCIPIHWNY 399

Query: 408 LSPISKTLCYFEW 420
                K      W
Sbjct: 400 ECDNCKGFNTIVW 412


>gi|114329085|ref|YP_746242.1| hypothetical protein GbCGDNIH1_2421 [Granulibacter bethesdensis
           CGDNIH1]
 gi|114317259|gb|ABI63319.1| hypothetical secreted protein [Granulibacter bethesdensis CGDNIH1]
          Length = 434

 Score =  274 bits (702), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 85/428 (19%), Positives = 160/428 (37%), Gaps = 16/428 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRL-YRTSPFVILSILYFFLFAWILLF 59
           M R+I+     ++V+ +   V+  P  V +T G+ L    S    +  +   + A  LL 
Sbjct: 1   MRRIIKIVLPAAVVVAAAWYVAGLPGHVGMTVGDDLTIDMSVPAAIVAVVILVLAVHLLL 60

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
                 L  P  +      R    G  A+   L+S+AA +   A +            + 
Sbjct: 61  RAVGAILGLPRTIRRWRQARTRQAGDYAVSRALVSLAAGDAGGAWREAGKARA--CLGDT 118

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATK 179
               LL  + A    + + A +    + +           L  E+    D  SA   A K
Sbjct: 119 AQTLLLMAEAARLSGRESEATQAFHALTRTEDASFLGYRGLLREAITREDWTSAAELARK 178

Query: 180 ALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADK 239
           A    P A W+    V   +    W  A++                       +     +
Sbjct: 179 AELAHPGAAWLRTERVNLAIRGGRWMDALSLAEN-----------DQQRAAFATAAAQAE 227

Query: 240 GDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIY 299
            D       A ++ +L  +   A+I  A +L +  ++R+++ +L K W  +P P++A + 
Sbjct: 228 LDQAEKLRTARQAFRLDPSLTSAAIAYATTLRAAGRQRRSDAVLVKAWAAHPQPDLAVVA 287

Query: 300 THLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKE 359
              ++ + + +++   RL   N    ES +++++  L  G   +A + A  A ++  +K 
Sbjct: 288 LSGVT-DPLTRVRTVKRLVAGNPGHPESHLLLARENLAAGLTGEARSHAEQASRLIDQKR 346

Query: 360 IFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWIS-DDGYLSSVWLPLSPISKTLCYF 418
           ++LLLA IE+        +    + A  A PDP W     G+ ++ W    P   T    
Sbjct: 347 VWLLLADIEEKEHGPGAAMQAALRRASEASPDPGWRCLHCGHATTHWAAACPACHTPGQI 406

Query: 419 EWKIPTKS 426
            W  P  +
Sbjct: 407 RWTTPGDA 414


>gi|218515793|ref|ZP_03512633.1| hypothetical conserved membrane protein [Rhizobium etli 8C-3]
          Length = 364

 Score =  270 bits (690), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 102/292 (34%), Positives = 157/292 (53%), Gaps = 7/292 (2%)

Query: 172 SAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAI 227
           +A++YA KA D +P  PW  +A ++    A  W  AI  L Q+K        E NR  A+
Sbjct: 1   AARQYAEKAADNAPYLPWAAQATLEYRSQAGHWDDAIRLLEQQKAARVVEKAEANRLHAV 60

Query: 228 LLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIW 287
           LL AR+ E  + G+   +  DA+++LKL  + + A++ AAK+L  +   RKA  ILE+ W
Sbjct: 61  LLTARAAEKLE-GNPAGARDDALQALKLAADFVPAALIAAKALFREGGLRKAASILEQAW 119

Query: 288 KVNPHPEIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHA 346
           K  PHPE+   Y      ++T+ +LKRA RLE +   +VESL++V++ AL+     +A A
Sbjct: 120 KSAPHPEVGQTYVRARSGDSTLDRLKRAERLEALRPNNVESLLVVAQAALDAQEFAKARA 179

Query: 347 KAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWL 406
           KA  A +I PR+  FLLLA IE+A + +  ++ +W   AL A  DP W++ DG++S  WL
Sbjct: 180 KAEAAARIEPREAAFLLLADIEEAETGDQGRVRHWLAQALKAPRDPAWVA-DGFVSDKWL 238

Query: 407 PLSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKN 458
           P+SP++  +  FEWK P    E    +    +                 +  
Sbjct: 239 PVSPVTGRIDAFEWKAPFGQIEGPLEDGSAPAAIETALKTLPPLRDVRPESP 290


>gi|83945092|ref|ZP_00957458.1| hypothetical protein OA2633_10694 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851874|gb|EAP89729.1| hypothetical protein OA2633_10694 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 487

 Score =  262 bits (671), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 102/502 (20%), Positives = 181/502 (36%), Gaps = 29/502 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RL        L     + ++  P  V++ +  +  +    + +  L    F  ++ + 
Sbjct: 1   MIRLTLTVIACVLTAMLAVFLTLNPGLVTVEFLGQTTQAPFALAMGALILAAFVLVVAWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V     S P        +R  D+G+ AL   L++ AA    LA +       +       
Sbjct: 61  VIAKLWSAPEAWKRFSLRRRRDQGFDALERALIASAAGQGDLAVR--QAARAEALLDRPA 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL  + A A      A    E ML    TR  A   L   +    D      +A  A
Sbjct: 119 LSRLLAARAAEAAGDLESAQIHYEAMLADAKTRLVAQRGLVGIAQSRSDSQGLLTHAADA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILLIARSLEN 236
            + +  A W  +A+ +  V    W++A   L + ++          R RA+LL A +   
Sbjct: 179 FEQAGRARWAFDALFEAQVNVALWAKAEATLTEGERRGHVDRLVAARMRAVLLTAEAR-R 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            +  D   +   A  +         A+  A + L  Q + R+A  ILE  WK  PHP +A
Sbjct: 238 LESADPETAARLADRAATSSPGFAPAAELAGRLLAEQRRHRRAVDILEDAWKHAPHPALA 297

Query: 297 NIYTHLLSENT-VGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
             + +L   +T   + +R   L  +N +  ES +++ + AL+ G+ + AH+     ++ +
Sbjct: 298 RAFANLRRSDTKAKRAERLRGLAALNPDHRESRLLLVETALDQGNREAAHSALKPVLETS 357

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD------GYLSSVWLPLS 409
           P       LA        N +    W   A HA  +  W   D       Y  + W  + 
Sbjct: 358 PVSARACALAARLARLEENPEDAQRWMARASHAPAEADWSDIDEGGQAFNYTDADWKRMV 417

Query: 410 PISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSF 469
                            P +   E    +          +++L + +     S K+  + 
Sbjct: 418 ESWGRDGVL------IHPRHERYEVAAAAAP--------ETVLIDARPTAERSAKRSEAG 463

Query: 470 EDSTIHPLDPHIRQPDDPGIKE 491
           +    +   P +  PDDPG  +
Sbjct: 464 DKQGPNFYVP-VPAPDDPGASD 484


>gi|218679767|ref|ZP_03527664.1| putative transmembrane protein [Rhizobium etli CIAT 894]
          Length = 280

 Score =  258 bits (660), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 100/281 (35%), Positives = 146/281 (51%), Gaps = 5/281 (1%)

Query: 32  WGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTG 91
           W  ++Y+T   V  S +   + A +L++   R   + P  +      R  D+GY+AL TG
Sbjct: 1   WEGQIYQTKLIVAASAIIALIAAVMLVWWFIRLVWTSPHSVTRYFRARKRDRGYQALSTG 60

Query: 92  LMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPA 151
           L++  A N  LARKM +          E L+ LLE Q AL E +++ A  K E M   P 
Sbjct: 61  LIAAGAGNALLARKMAARSRGLIRADQEPLINLLEAQAALIEGRHDEARAKFEAMANDPE 120

Query: 152 TREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFL 211
           TRE  +  LY E+ R+G   +A++YA KA D +P  PW  +A ++    A  W  AI  L
Sbjct: 121 TRELGLRGLYLEARRLGANEAARQYAEKAADNAPYLPWAAQATLEYRSQAGRWDDAIRLL 180

Query: 212 NQKKK----NAKEWNRNRAILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAA 267
            Q+K        E NR  A+LL AR+ E  + G+   +  DA+++LKL  + I A++ AA
Sbjct: 181 EQQKAARVVEKAEANRLHAVLLTARAGERLE-GNPAGARDDALQALKLAADFIPAALIAA 239

Query: 268 KSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
           K+L  +   RKA  ILE+ WK  PHPEI   Y    S ++ 
Sbjct: 240 KALFREGGLRKAASILEQAWKSAPHPEIGQAYVRARSGDST 280


>gi|114798425|ref|YP_761904.1| HemY domain-containing protein [Hyphomonas neptunium ATCC 15444]
 gi|114738599|gb|ABI76724.1| HemY domain protein [Hyphomonas neptunium ATCC 15444]
          Length = 478

 Score =  239 bits (610), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 74/389 (19%), Positives = 151/389 (38%), Gaps = 9/389 (2%)

Query: 15  ICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFH 74
                     P +V+   G  +      V   +L  F     L + ++   L  P  +  
Sbjct: 18  AVLAWWAFSLPGEVTFPVGQEIVSVRAGVAAILLLVFGGLIALAWWLATGILVLPGRISK 77

Query: 75  MLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAER 134
                   K   AL  GL++    +   A ++     +     +E L  LLE + A A  
Sbjct: 78  AQRLSRARKANAALAEGLLAAEGGDSKAALRLARKSMRHA--EDERLKLLLEARAAEAND 135

Query: 135 QYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAV 194
            +  A     ++ ++P  +   +      +   GD  +A+  A +AL++  DA W   ++
Sbjct: 136 DWAGAERAWGLLTRLPGGQLAGLRGSATAASERGDPLTAETRAREALELRSDADWPFNSL 195

Query: 195 VQQYVLAKEWSRAITFL----NQKKKNAKEWNRNRAILLIARSLENADKGDMIASYHDAI 250
               V   +W +A+  L     +         R RA+L  AR++         A    A 
Sbjct: 196 FDIQVAKGDWDKALDTLAMGEKRGLVEGINLKRRRAVLFTARAVNLPIAEKPAAQKSLA- 254

Query: 251 ESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGK 310
           ++++   +   A+   A+ L+   K + A+ +LE  WK  PHP +A +   L+ ++T   
Sbjct: 255 DAIRSAPDFPPAAYHGARFLMVDGKAKAAQGVLELGWKARPHPALAQLSRRLVPQDTREN 314

Query: 311 L-KRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQ 369
           +  R   L + +    ES ++ ++++++     +A     L ++  P   + LL+ +  +
Sbjct: 315 IAARLKALVDAHPSHRESRILAAELSMDSADWVEAIKTLALLVEENPTARLCLLMERALK 374

Query: 370 ANSHNTDKILYWTQSALHAMPDPLWISDD 398
               +  +   W + A+ A  +  W   D
Sbjct: 375 G-YGDLGEAQRWGRMAVSASREADWSDID 402


>gi|73666713|ref|YP_302729.1| hypothetical protein Ecaj_0080 [Ehrlichia canis str. Jake]
 gi|72393854|gb|AAZ68131.1| putative Uncharacterized membrane-bound protein [Ehrlichia canis
           str. Jake]
          Length = 413

 Score =  237 bits (605), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 86/429 (20%), Positives = 171/429 (39%), Gaps = 26/429 (6%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+  +  F +++L I   + V      ++I W       +      ++  FL   ILL  
Sbjct: 1   MITSLLIFVIVALTIG--LWVIDCDGIITIDWLGYDIEVNILFTFFVVAVFLLVLILLVR 58

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +    +     L+        +K    L  G M +   ++    ++   +++  +F +  
Sbjct: 59  LVFCLIQS---LYRYRRDS-QNKKMILLEQGYMYLNCGDVE---RVEKIITKLGSFDHPS 111

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQ-IPATREFAVYSLYFESCRIGDLNSAQRYATK 179
             YLL+ ++    R+Y +A +      + +P         L     +  D         K
Sbjct: 112 -FYLLKGRVCFDNRKYGLAEKYFGQFAKIVPMIDASLGVHLLNVISQEEDQIQQLSLLRK 170

Query: 180 ALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQ--KKKNAKEWNRNRAILLIARSLENA 237
            L+I     W     ++ Y L+++WS AI  + +  K K    +N    + +   +L  A
Sbjct: 171 MLEIFYKQSWSAIFKLEIYRLSRDWSNAIEEIKKVIKLKVNLPYNVQDMLNIFYYAL--A 228

Query: 238 DKGDMIASYHDAIESLKLCDN----SIMASICAAKSLISQNKKRKAEVILEKIWKVNPHP 293
            +   +  Y D ++ L    N    S    +  A+  ++ ++KRKA  ILE  ++ NPHP
Sbjct: 229 KQCYDVQRYDDGLKVLDNIKNCQKYSTPIVLLKAQCYLNTDRKRKAVSILEYEYRTNPHP 288

Query: 294 EIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMK 353
           +IAN+Y  ++  N+        +L   N E   S+ ++++ A+ +G  D A        K
Sbjct: 289 DIANLYLDIMQHNSHA----IHKLYSFNTEYYFSIYLIARDAINLGEYDAAMKYLNNEFK 344

Query: 354 IAPRKEIFLLLAQIEQANSHNTDKILYWTQS-ALHAMPDPLWIS-DDGYLSSVWLPLSPI 411
                 ++ L+ ++ +  S + +++LYWT   A  A+ +  W       +S+ W      
Sbjct: 345 TQTYISLYFLMLKL-KVLSQDYNELLYWTDKIAKDAISEQHWSCTKCQCVSTRWHYECDN 403

Query: 412 SKTLCYFEW 420
            K      W
Sbjct: 404 CKGFNTIVW 412


>gi|295687520|ref|YP_003591213.1| HemY domain-containing protein [Caulobacter segnis ATCC 21756]
 gi|295429423|gb|ADG08595.1| HemY domain protein [Caulobacter segnis ATCC 21756]
          Length = 511

 Score =  231 bits (590), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 97/406 (23%), Positives = 164/406 (40%), Gaps = 10/406 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R++   F+++ V  S + ++  P   S+ W       +      +  F    + +L+ 
Sbjct: 1   MTRVVFALFLVAAVAVSVLALTGEPGRASLEWMGWRIEMTAAAAALLTLFSALLFTVLWR 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
              + +  P        +    +  +AL  G +++AA +   AR++    S +       
Sbjct: 61  GVIWIVEAPRRAARARAEAKRKQAIEALTRGFLAVAAGDGSEARRLAQK-SAELAEDAPG 119

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           LV +L  Q A A      A      ML  P  R   +  L   +   GD  +A R+A  A
Sbjct: 120 LVRVLAAQAAEAAGDRGAAASAYNAMLGFPEMRLAGLRGLMQAALADGDKITALRHAETA 179

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITF----LNQKKKNAKEWNRNRAILLIARSLEN 236
             ++  A W   A+++  + A +W+ A+      L +K  +     R+RA LL A +   
Sbjct: 180 YGLARTARWAWRALLEARLEAGDWAAALQLVQGALERKIVSPAVAERSRAALLAASAASL 239

Query: 237 ADKGDMIA---SYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHP 293
            +  D  A   +   A +S+KL  +     I AA+ L  + K  KA  ++E  WK  PHP
Sbjct: 240 EESPDPKARAQALDFANQSVKLKPDFAPGVIMAARLLADEGKTAKAGQLIETAWKAQPHP 299

Query: 294 EIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAM 352
            +   Y  L  +E    + +R   L  +  E  ESL++  + AL  G    A A A L  
Sbjct: 300 ALWLAYRDLKTNETPKARAQRLAALAAMRPEVRESLILRVEAALVGGDPIAARAAARLLD 359

Query: 353 KIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD 398
             AP      L+A++  AN    +    W    + A  +P W   D
Sbjct: 360 DEAPTARFAGLMARVAAANGQADE-ARAWIARGIDAPREPDWSDLD 404


>gi|16124330|ref|NP_418894.1| hypothetical protein CC_0075 [Caulobacter crescentus CB15]
 gi|221233012|ref|YP_002515448.1| HemY domain membrane protein [Caulobacter crescentus NA1000]
 gi|13421172|gb|AAK22062.1| hypothetical protein CC_0075 [Caulobacter crescentus CB15]
 gi|220962184|gb|ACL93540.1| HemY domain membrane protein [Caulobacter crescentus NA1000]
          Length = 511

 Score =  229 bits (584), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 95/406 (23%), Positives = 164/406 (40%), Gaps = 10/406 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R+    F++++V  S + ++  P   S+ W       +      +  F    + LL+ 
Sbjct: 1   MTRVAFALFLVAVVAVSVLALTGEPGRASMEWMGWRVEMTAAAAALLTLFSALMFTLLWR 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
              + +  P        +    +  +AL  G +++AA +   AR++    S +       
Sbjct: 61  GVIWIVEAPRRAARARAEAKRKQAIEALSRGFLAVAAGDGSEARRLAQKSS-ELAEDAPA 119

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           LV +L  Q A A      A      ML  P  R   +  L   +   GD  +A R+A  A
Sbjct: 120 LVRVLAAQAAEAAGDRGAAKSAYNAMLGFPEMRLAGLRCLMLAAQAEGDRQTAIRHAETA 179

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITF----LNQKKKNAKEWNRNRAILLIARSLEN 236
             ++  A W   A+++  + A +W+ A+      L +K  +     R+RA LL A +   
Sbjct: 180 YGLARTARWAWRALLEARLEAGDWAAALQLVQGALERKIVSPVVAERSRAALLAASAASL 239

Query: 237 ADKGDM---IASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHP 293
            +  D      +   A +S+KL  +     + AA+ L    K  KA  ++E  WK  PHP
Sbjct: 240 VNADDPKTRAQALDFATQSVKLKPDFAPGVVMAARLLAEDGKTAKAGGLIETAWKAEPHP 299

Query: 294 EIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAM 352
            +   Y  L  +E    + +R   L  +  E+ ES ++  + AL  G    A A A L  
Sbjct: 300 ALWLAYRDLKTNETPKARAQRLAALAAMKPEARESRLLRVESALIGGDPVAARAAARLLD 359

Query: 353 KIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD 398
             AP      L+A++  A + + D+   W    + A  +P W   D
Sbjct: 360 DEAPTARFAGLMARVAAA-NGDADEARAWIARGVAAPQEPDWSDLD 404


>gi|218507798|ref|ZP_03505676.1| hypothetical conserved membrane protein [Rhizobium etli Brasil 5]
          Length = 240

 Score =  229 bits (584), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 80/240 (33%), Positives = 123/240 (51%), Gaps = 4/240 (1%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RL+ +  ++ L+   F   +  P D+S+ W  ++Y+T   V +S +   + A ++++ 
Sbjct: 1   MIRLVVFALLVLLLAYGFSWFADRPGDLSLIWEGQIYQTKLIVAVSAIIALIAAVMIVWW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
             R   + P  +      R  D+GY+AL TGL++  A N  LARKM +          E 
Sbjct: 61  FVRLIWTSPHSVTRYFRARKRDRGYQALSTGLIAAGAGNALLARKMAARSRGLIRADQEP 120

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ LLE Q AL E +++ A  K E M   P TRE  +  LY E+ R+G   +A++YA KA
Sbjct: 121 LINLLEAQAALIEGRHDEARAKFEAMANDPETRELGLRGLYLEARRLGANEAARQYAEKA 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----NAKEWNRNRAILLIARSLEN 236
            D +P  PW  +A ++    A  W  AI  L Q+K        E NR  A+LL AR+ E 
Sbjct: 181 ADNAPYLPWAAQATLEYRSQAGHWDDAIRLLEQQKAARVVEKAEANRLHAVLLTARAAEK 240


>gi|329848281|ref|ZP_08263309.1| hemY protein [Asticcacaulis biprosthecum C19]
 gi|328843344|gb|EGF92913.1| hemY protein [Asticcacaulis biprosthecum C19]
          Length = 515

 Score =  223 bits (568), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 97/491 (19%), Positives = 165/491 (33%), Gaps = 27/491 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R +     I+ +I   I +   P   S++W N          + I+    F  +  + 
Sbjct: 1   MIRSLLILLAITTLIVLTIGMVGDPGLASLSWMNYRIDIPATAAVIIIGVMAFCAVAFWN 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           ++ +    P         +   +G  AL  G M++A  +   AR+    V       N  
Sbjct: 61  LALWLARSPQRAERARADQRRRQGDDALTRGFMAVAVGDGSEARR--HAVKALDLSDNTV 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           LV +L    A               M+ +P  +   +  L   + R GD   A + A +A
Sbjct: 119 LVRILGAMAAEESGDAVATRTAYSAMVSVPELKLAGLRGLMQLAARQGDKAEAVKLAGEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITF----LNQKKKNAKEWNRNRAILLIARSLEN 236
            +    + W  E +    + A EW+ A+      L +K  +     R +A L+ A +   
Sbjct: 179 YNQPRPSMWAFETLFAARLEAGEWAEALDLIEGALTRKLISPIFSERAKASLMAASAARL 238

Query: 237 ADKGDM---IASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHP 293
               D      +   A  + KL      A+I AA+ L   NK  +AE +LE  W   PHP
Sbjct: 239 ETSDDAQMRDQALDYAQRAAKLQPQFTPAAIIAARLLAKANKPGRAEDVLEAAWASRPHP 298

Query: 294 EIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIAL----EMGSIDQAHAKA 348
            +   Y  L+S+ T   + +R   L + N +  ES ++  + AL    +        A  
Sbjct: 299 AVWLAYRDLVSDETPKERARRLQGLVDRNAKHRESRLLQVERALLTNTKAEIAAALAALE 358

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD------GYLS 402
             + +    K I  ++A+  Q    + D    W   A  A  +  W   D       Y +
Sbjct: 359 EDSAEANLTKRICGVIARGAQG-LGDYDTARVWIAKAASARGEADWSDIDAEGKAFAYSA 417

Query: 403 SVWLPLSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPS 462
           + W  +         F        P Y   +     +    P          G       
Sbjct: 418 ADWSDVILN------FAETAALSHPRYERGDKGLPEIPDMPPRYVPSMPFIKGPARRGSV 471

Query: 463 IKKVSSFEDST 473
               S   D  
Sbjct: 472 RTDPSHMPDDV 482


>gi|167644094|ref|YP_001681757.1| HemY domain-containing protein [Caulobacter sp. K31]
 gi|167346524|gb|ABZ69259.1| HemY domain protein [Caulobacter sp. K31]
          Length = 515

 Score =  219 bits (559), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 86/406 (21%), Positives = 161/406 (39%), Gaps = 10/406 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R    FF+++ +  + + ++  P   S+ W       +      +  F      +L+ 
Sbjct: 1   MIRAAIVFFLVAAIAVAVVALTGEPGVASLDWMGWRVEMTAAAAALLTLFTALLATILWR 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
              + +  P        +    +G +AL  G +++AA +   AR++      +       
Sbjct: 61  ALLWVIEAPQRAARARAEAKRKQGVEALSRGFLAVAAGDGSEARRLAQKA-AELAEDAPA 119

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L+ +L  Q A A   +  A +    ML  P  R   +  L   +   GD   A ++A  A
Sbjct: 120 LIRVLAAQAAEAAGDHTAARQAYNAMLGFPEMRLAGLRGLMQTALAEGDKGLALKHAETA 179

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITF----LNQKKKNAKEWNRNRAILLIARSLEN 236
             ++  A W   A+++  + A +W  A+      L +K        R RA LL A +   
Sbjct: 180 YGLAKTARWAWRALLEARLEAGDWKAALDLVQGALERKIVPPLVAERARAALLAASAASL 239

Query: 237 ADKGDM---IASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHP 293
            +  D      +   A+++ +L  +     + AA+   +  K  KA  ++E  WK++PHP
Sbjct: 240 EESDDPKTLAQALDFAVQAARLKPDFAPGVVMAARLQAADGKAAKAGSLIEAAWKLSPHP 299

Query: 294 EIANIYTHLL-SENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAM 352
            +   Y  L  SE    +  R   L  +  E+ ES ++  + AL  G    A A A L  
Sbjct: 300 ALWLAYRDLKTSETPKLRAARLAALAGLKPEARESRLLKVESALIGGDPVAARAAARLLP 359

Query: 353 KIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD 398
           +      +  L++++  A +   D+   W    + A  +P W   D
Sbjct: 360 EEGLTARVAGLMSRVAYA-NGEADEARAWIARGVAAAQEPDWSDLD 404


>gi|315497774|ref|YP_004086578.1| hemy domain protein [Asticcacaulis excentricus CB 48]
 gi|315415786|gb|ADU12427.1| HemY domain protein [Asticcacaulis excentricus CB 48]
          Length = 515

 Score =  217 bits (552), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 77/395 (19%), Positives = 141/395 (35%), Gaps = 15/395 (3%)

Query: 16  CSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHM 75
                 +  P   ++ W      T     + ++    FA +  + +  +    P      
Sbjct: 16  AVAFAAAGDPGTATLIWLGYRIDTPAAAAVIVIGLLAFAAVCFWNLVLWMSRAPQRAERQ 75

Query: 76  LHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQ 135
                  +G + L  G +++ + +   AR+        H   N  LV +L    A     
Sbjct: 76  RANARRRQGEETLTRGFIAVVSGDGAEARRQAIKAVDLH--DNVALVRILNALAAETAHD 133

Query: 136 YNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVV 195
                     ML +P  +   +  L   +   GD   A R A +  +    A W  + + 
Sbjct: 134 PVATRAAWTAMLSVPELKLAGLRGLMALAISEGDRTEAIRLAAEGYNQPKPAMWAFKTLF 193

Query: 196 QQYVLAKEWSRAITFLNQKKKNA------KEWNRNRAILLIARSLENADKGD-MIASYHD 248
           +    A EW+ A+  +              E  R   +   A  LE A +G     +   
Sbjct: 194 EARSTAGEWAEALDLVEGALNRKLVSPLFAERARAALMAASAARLEGAAEGQIREQALDY 253

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
           A+ + KL       ++ AA+ L + NK  +AE +LE  +   PHP I   Y  L+++ T 
Sbjct: 254 AVRAAKLQPMFAPGAVIAARLLAAHNKLGRAEDVLEAAYAAQPHPAIWLAYRDLVNDETP 313

Query: 309 -GKLKRALRLEEINKESVESLVIVSKIALEMG---SIDQAHAKAMLAMKIAP-RKEIFLL 363
             + +R   L + N +  ES ++  + ++  G    I++A A     +      + +  L
Sbjct: 314 KDRARRLQGLIDRNPQHRESRLLEVERSVLSGVRADIERATAALEDELTEERLTRRLCGL 373

Query: 364 LAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD 398
           +A+   A   + D    W   A  A  +P W   D
Sbjct: 374 MAKAALA-LQDVDGARGWVAKASLAKAEPDWSDLD 407


>gi|68171287|ref|ZP_00544688.1| hypothetical protein EchaDRAFT_0515 [Ehrlichia chaffeensis str.
           Sapulpa]
 gi|88658307|ref|YP_506957.1| HemY domain-containing protein [Ehrlichia chaffeensis str.
           Arkansas]
 gi|67999302|gb|EAM85950.1| hypothetical protein EchaDRAFT_0515 [Ehrlichia chaffeensis str.
           Sapulpa]
 gi|88599764|gb|ABD45233.1| HemY domain protein [Ehrlichia chaffeensis str. Arkansas]
          Length = 416

 Score =  216 bits (551), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 87/432 (20%), Positives = 167/432 (38%), Gaps = 29/432 (6%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+  +  F +++L I   + V      + I W       +    L ++       ILL  
Sbjct: 1   MITSVLIFVIVALTIG--LWVIDCDGIIRIDWLGYDIEVNILFTLFVIAVVFLLLILLVR 58

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
               F  C   ++        +K    L  G M +   ++    ++   + +   F +  
Sbjct: 59  FIFCFSRC---VYRYKRD-LQNKKMVLLEQGYMYLNCGDVE---RVEKIIVKIGNFDHPS 111

Query: 121 LVYLLEVQIALAERQYNIAHEKL-EMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATK 179
           L +LL+ ++     +Y +A +   + +  +P         L     +I D         K
Sbjct: 112 L-FLLKGRVYFDTGKYILAEKYFTQFVKVVPVIDASLGIHLLNVIMQIEDQIQQLSLLRK 170

Query: 180 ALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQ--KKKNAKE--WNRNRAILLIARSLE 235
            L+I     W     +  Y ++++W  AI  + +  K K      +N    + +   +L 
Sbjct: 171 MLEIFFKQSWSAIFKLTIYRISRDWGNAIEEMKKIIKLKINLPLPYNTQEMLNVFYYAL- 229

Query: 236 NADKGDMIASYHDAI---ESLKLCDN--SIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
            A +   I  Y D +   +++K C    S   ++  AK  I  +KKRKA  ILE  +++N
Sbjct: 230 -AKQCYDIQKYDDGLRVLDNIKNCSQQCSTAVTLLKAKFYIDTDKKRKAVNILEHEYRIN 288

Query: 291 PHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           PHP+IAN Y  ++  ++        +L   N     S+ ++++ A+  G  D A      
Sbjct: 289 PHPDIANFYLDIMQHSSHA----IHKLYSFNTGYYFSIYLIAQDAINSGEYDTAMKYLNH 344

Query: 351 AMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQS-ALHAMPDPLWISDDGYLSSV-WLPL 408
           + K      ++ L+ ++ +  S N +++LYWT   A  A+ D  W       +   W   
Sbjct: 345 SFKTKTYISLYFLVLKL-KVLSQNYNELLYWTDKIAKDAIADKYWSCTKCKYTPTCWHYE 403

Query: 409 SPISKTLCYFEW 420
               K+     W
Sbjct: 404 CDGCKSFNTIIW 415


>gi|261884328|ref|ZP_06008367.1| hypothetical protein CfetvA_03481 [Campylobacter fetus subsp.
           venerealis str. Azul-94]
          Length = 266

 Score =  212 bits (539), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 72/227 (31%), Positives = 115/227 (50%), Gaps = 4/227 (1%)

Query: 218 AKEWNRNRAILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKR 277
                + RA LL A+++   D      +   A+E+ KL  + + A++ AA++L +  + R
Sbjct: 9   KDVVKKERAALLTAKAMATLD-THHAHAKAIALEANKLAPDLVPAAVVAARALFADGEIR 67

Query: 278 KAEVILEKIWKVNPHPEIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIAL 336
           K   ILE  WK  PHP+IA+ Y +  S +T   +LKRA  L  +   + E  + +++ A 
Sbjct: 68  KGSKILEAAWKRFPHPDIASTYIYARSGDTAQDRLKRARHLVSLRSNNAEGSLALARAAY 127

Query: 337 EMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWIS 396
           E G    A   A   ++ APR+  +LLLA IE+A + +  K+  W   A+ A  DP W +
Sbjct: 128 EAGEYSVARDNAEQVLRAAPRESAYLLLADIEEAETGDQGKVRQWLAQAVKAPRDPAWTA 187

Query: 397 DDGYLSSVWLPLSPISKTLCYFEWKIP-TKSPEYISSENINFSLEMA 442
            D Y+   W P+SP++  L  FEWK+P  +    I  E       +A
Sbjct: 188 -DCYVCEQWSPVSPVTGRLNSFEWKVPVVELAPAIEVEKPEIKAPLA 233


>gi|197106863|ref|YP_002132240.1| hypothetical protein PHZ_c3402 [Phenylobacterium zucineum HLK1]
 gi|196480283|gb|ACG79811.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 504

 Score =  210 bits (534), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 81/406 (19%), Positives = 141/406 (34%), Gaps = 10/406 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R    FF+++ V  + + ++  P   S+ W       +    + I         + + 
Sbjct: 1   MIRAAIVFFMVAAVAVAVLALTGDPGRASVVWLGWRADMTAAAAILIALLASLLAAVAWR 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
              + L  P        +    +    L  G ++ A  +   AR++              
Sbjct: 61  TVLWILDAPQRAERARAEARRRQASDVLSRGFLAAAGGDGSEARRLARKA-ADLASDAPG 119

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           LV +L  Q A A    + A      ML  P  R      L   +   G   +A R+A +A
Sbjct: 120 LVRVLAAQAAEAAGDLDEARAAYTAMLGFPEMRLAGHKGLMQLAAAQGARETALRHAQEA 179

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA---KEWNRNRAILLIARSLENA 237
              +  A W   A+++  + A +W +A+  +                    L+A S    
Sbjct: 180 YGEARTARWAWRALLEAKLEAGDWPQALDLMKGALDRKIVPPVVAERARAALLAASAAQL 239

Query: 238 DKGDMIASY----HDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHP 293
           +      +       A+E+ KL        + AA+ L    K  +A   +E  W+V PHP
Sbjct: 240 EHAPEPKARALAMDHAVEAAKLAPGFAPGVVMAARLLAQAGKVGRAAATVENAWRVAPHP 299

Query: 294 EIANIYTHLLSENTV-GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAM 352
            +   Y  L ++ T   + +R   L  +N    ESL++  + AL  G    AH  A    
Sbjct: 300 ALWLAYRDLRTDETPRERAQRLSELAAVNPTHRESLILHVERALIAGEPAAAHEAAGALE 359

Query: 353 KIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDD 398
                  I  L+A+   A     +    W    + A  +P W   D
Sbjct: 360 AEPVTARIAGLMARAAFAAGAPDE-ARVWLARGISAPHEPDWSDLD 404


>gi|23004378|ref|ZP_00047740.1| hypothetical protein Magn03000405 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 250

 Score =  209 bits (531), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 53/253 (20%), Positives = 111/253 (43%), Gaps = 7/253 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R + +  ++++     + ++ +P  V++ W       S  + L+ +        +++A
Sbjct: 1   MWRALVFLALLAIAAYGAVWIADHPGSVTVVWNGYEIGMSLAIALTGVLVAAIIIGIIWA 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +    +  PA +     +R  +KG  +L  G++++ + +   AR+       +    ++ 
Sbjct: 61  IMSGVIGLPASISRSTRERRRNKGLASLSRGMIAVGSGDPLAARR--HAGDAERLLGSQP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL+ Q A        A +  + M   P TR   +  L+ E+ R  D  +A+ YAT+A
Sbjct: 119 LTLLLKAQAAQISGDREAAEQAFKRMADDPETRVLGLRGLFVEARRREDEGAARAYATEA 178

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQK----KKNAKEWNRNRAILLIARSLEN 236
             ++P   W  EAV++      EWS A   + ++      +     R RA+LL A + ++
Sbjct: 179 ARLAPSVTWANEAVLEAQCADGEWSAATETVERRASLGLMDKSVARRQRAVLLTA-AAQS 237

Query: 237 ADKGDMIASYHDA 249
            + G+   +   A
Sbjct: 238 HEAGEPETATEQA 250


>gi|294085039|ref|YP_003551799.1| HemY domain-containing protein [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664614|gb|ADE39715.1| HemY domain protein [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 445

 Score =  198 bits (503), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 80/442 (18%), Positives = 152/442 (34%), Gaps = 16/442 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++RL   F  I     S   ++  P  V + W          + ++++  F    +    
Sbjct: 2   LIRLAVLFLFILAAAASASWLAAQPGHVQVEWLGWRLEMRTSLAVALVIIFALGMVFFDR 61

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R   S P  L   + KR    G+KAL  GLM+++A               +       
Sbjct: 62  LYRLIKSLPGWLGSSVQKRRDVAGHKALTLGLMAVSAGEPAE--AKRQAARARRLLDAPQ 119

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L  LL  Q +     +  A      ++    +       +   +      ++A   A KA
Sbjct: 120 LTNLLAAQASALAGDHQAARRYFTSLIAEDDSAFLGHIGMMRLALDDDAPDAALASARKA 179

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSR---AITFLNQKKKNAKEW--------NRNRAILL 229
           L + P +      +VQ       W     A+  L  ++++ +             R  LL
Sbjct: 180 LALRPKSTLAAAHIVQLEAARHNWQAALPALDVLASQRRSGQSGSDEDGNNIQSQRTALL 239

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
              + E+A   D   +    I  +K     + A +  +   +     RKA  +LEK + +
Sbjct: 240 YMDACEHAQNADRQGAQKVLIRIIKDVPGFLPAVLMLSDIYLETGANRKAVKVLEKAFGI 299

Query: 290 NPHPEIANIYTHLLSENTVGKLKRALRLEEINKE-SVESLVIVSKIALEMGSIDQAHAKA 348
            PH E+AN        N  G + + + L   +++ +  +  I++  AL++G   +A  + 
Sbjct: 300 IPHIEVANRLKPAWQVNDGGFIAKLMTLIPADEDIADAARCIIANQALDVGLDGEAAGQI 359

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGY-LSSVWLP 407
               +     + + + A+I QA   + D       +A  A     W       L   W  
Sbjct: 360 TAIPESRRDADAWQVAARIAQA-HGHQDDANAALVAASKAPRPQGWQCGACRSLHDDWQS 418

Query: 408 LSPISKTLCYFEWKIPTKSPEY 429
             P   +     W+ P +    
Sbjct: 419 HCPDCDSFAQLVWQRPDRVTPL 440


>gi|83310058|ref|YP_420322.1| hypothetical protein amb0959 [Magnetospirillum magneticum AMB-1]
 gi|82944899|dbj|BAE49763.1| Uncharacterized membrane-bound protein [Magnetospirillum magneticum
           AMB-1]
          Length = 469

 Score =  196 bits (499), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 87/438 (19%), Positives = 149/438 (34%), Gaps = 15/438 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           +LRLI     +S V+ + +  S     V + W      T+  V+L IL      +  L  
Sbjct: 2   LLRLIVLLIFMSPVVLATLWFSDNAGTVQVEWLGWHVDTNVPVLLGILLAVFMLFSGLTR 61

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +S      PA L      R  +KG  AL   L +  + ++   R++ +  +      +  
Sbjct: 62  LSALVADLPAKLGKSRQARGREKGMLALLAALDAAESGDVGDGRRLGAEAA--RLLDSPE 119

Query: 121 LV----YLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRY 176
           L      L+    A           K  +  + P                          
Sbjct: 120 LAARLDRLIPRPAAPPAATLRPEPAKGRLFAKKPPAPPVVEREPPPPVKAAPPPAPVAVV 179

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAIT----FLNQKKKNAKEWNRNRAILLIAR 232
            T A    P A        +      EW+ A       L+  + +     R RA++L  +
Sbjct: 180 ETPAAPADPSAEDAAAFAAKLR--DGEWAAAQACIDATLSAGRLSPALAARWRAVVLEGQ 237

Query: 233 SLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPH 292
           +     + D   S   A E+L      + A++   +  +S+ ++ +AE +L  +W+  P 
Sbjct: 238 AC-LDSQDDPARSLRLAREALAADPGFLPAALHVLRQEVSEGRRSEAEAVLAAVWRSAPA 296

Query: 293 PEIANIYTHLLSENTVG-KLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLA 351
             +    + L  E+    +LKR   L E      E  +   + A+       A    M A
Sbjct: 297 RILLETCSPLWREDDAESRLKRLEVLAEWAPHDPEGHLAAGEAAVAAAKWGVARRHLMAA 356

Query: 352 MKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISD-DGYLSSVWLPLSP 410
           +KIAP      L+A+IE       ++   W +    A   P W+ +  G  S  W P   
Sbjct: 357 LKIAPDALGCRLMAEIEDKEPGGAERAEIWRRREREAPAAPTWVCEACGATSGSWAPYCS 416

Query: 411 ISKTLCYFEWKIPTKSPE 428
                   +W  P   PE
Sbjct: 417 ACAAGAAIQWTRPAHKPE 434


>gi|78033476|emb|CAJ30093.1| TPR-like protein [Magnetospirillum gryphiswaldense MSR-1]
 gi|144901138|emb|CAM78002.1| TPR-like protein [Magnetospirillum gryphiswaldense MSR-1]
          Length = 449

 Score =  178 bits (451), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 84/455 (18%), Positives = 155/455 (34%), Gaps = 23/455 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           +LRLI     +S V+ + +  S     V + W      ++  V+L+++      +  L  
Sbjct: 2   LLRLIVLLIFMSPVVFATLWFSDNVGSVQVEWLGWHVDSNMPVLLAVILVVFLIFSALSR 61

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +S      P+ L      R  +KG  AL   L +  + ++   R+  +  +     +N  
Sbjct: 62  LSALVADLPSKLGKSRQARGLEKGMSALLAALDAAESGDVGEGRRFAAEAA--RLLNNPG 119

Query: 121 LV----YLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRY 176
           L      LL    A       +A  +LE        R+                   ++ 
Sbjct: 120 LAARLDRLLPRPPAQ-----PVAPTRLEAAKGRLFARKPGPPPPPTPVVDKIQPVVVEKL 174

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILLIAR 232
           A      S +      A +     A EW  A  ++ +     +       R R++ L  +
Sbjct: 175 AAAPAGPSREDLEAFSAKI----RAGEWGAAQAWIGEAVLAGRLTPLVAARWRSVALEGQ 230

Query: 233 SLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPH 292
           +LE A  GD       A E++      +  ++   ++ +S+ +K +AE +L  +W   P 
Sbjct: 231 ALE-ASPGDPARPLRLAREAMAADQTFLPPALHVIRAEVSEGRKAEAETLLASVWPHVPA 289

Query: 293 PEIANIYTHLLSENTVGK-LKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLA 351
             + +    L  +      LKR   L  I     +  +   + A  +     A    M A
Sbjct: 290 RVLLDACAPLWRDEDQDACLKRLEALAAIAPHHPDGHLAAGEAAFAVQKWGVARRHIMAA 349

Query: 352 MKIAPRKEIFLLLAQIEQANSHNTDK-ILYWTQSALHAMPDPLWISDDGY-LSSVWLPLS 409
           +KIAP      L+A+IE+     + +    W +    A   P W+      +   W    
Sbjct: 350 LKIAPDALGCRLMAEIEEREPGGSARSAEIWRRREHEASLSPAWVCGACARVVEAWAACC 409

Query: 410 PISKTLCYFEWKIPTKSPEYISSENINFSLEMAYP 444
           P    +   EW    K+ E +       S      
Sbjct: 410 PSCAGVATIEWTRSVKAEEALLPPATTASSMETPR 444


>gi|46202657|ref|ZP_00208607.1| hypothetical protein Magn03007324 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 471

 Score =  162 bits (410), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 51/241 (21%), Positives = 89/241 (36%), Gaps = 7/241 (2%)

Query: 200 LAKEWSRAIT----FLNQKKKNAKEWNRNRAILLIARSLENADKGDMIASYHDAIESLKL 255
              EW+ A       L+  + +     R R ++L  ++     + D   S   A E+L  
Sbjct: 203 RDGEWAAAQACIDATLSAGRLSPALAARWRVVVLQGQAC-LDSQDDPARSLRLAREALAA 261

Query: 256 CDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVG-KLKRA 314
               + A++   +  +S+ ++ +AE +L  +W+  P   +      L  E+    +LKR 
Sbjct: 262 DPGFLPAALHVLRQEVSEGRRSEAEAVLAAVWRSAPARILLETCAPLWREDDAESRLKRL 321

Query: 315 LRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHN 374
             L E      E  +   + A+       A    M A+KIAP      L+A+IE      
Sbjct: 322 EALAEWAPHDPEGHLAAGEAAVAAAKWGVARRHLMAALKIAPDALGCRLMAEIEDKEPGG 381

Query: 375 TDKILYWTQSALHAMPDPLWISD-DGYLSSVWLPLSPISKTLCYFEWKIPTKSPEYISSE 433
            ++   W +    A   P W+ +  G  S  W P           +W  P   PE   + 
Sbjct: 382 AERAEIWRRREREAAAAPTWVCEACGATSGSWAPYCSACGAGAAIQWTRPAHKPENPPTP 441

Query: 434 N 434
            
Sbjct: 442 A 442



 Score = 61.1 bits (147), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 28/126 (22%), Positives = 49/126 (38%), Gaps = 2/126 (1%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           +LRLI     +S V+ + +  S     V + W      T+  V+L IL      +  L  
Sbjct: 4   LLRLIVLLIFMSPVVLATLWFSDNAGTVQVEWLGWHVDTNIPVLLGILLAVFMLFSGLTR 63

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +S      PA L      R  +KG  AL   L +  + ++   R++ +  +      +  
Sbjct: 64  LSALVADLPAKLGKSRQARGREKGMLALLAALDAAESGDVGDGRRLGAEAA--RLLDSPE 121

Query: 121 LVYLLE 126
           L   L+
Sbjct: 122 LAARLD 127


>gi|58584738|ref|YP_198311.1| membrane-bound protoheme IX biogenesis protein, HemY [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|58419054|gb|AAW71069.1| Membrane-bound protoheme IX biogenesis protein, HemY [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 387

 Score =  159 bits (403), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 51/229 (22%), Positives = 87/229 (37%), Gaps = 14/229 (6%)

Query: 195 VQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILLIARSLENADKGDMIASYHDAI 250
           ++   L ++W  AI+ L +  K       +  +  A+   A + +   KG+   +     
Sbjct: 163 IEHCALQEDWVNAISRLKEAIKFNVFLPFDCKKMLAVFYCALAKQYESKGNFKEAVKSLF 222

Query: 251 ESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGK 310
            +   C      +   A+  I   K RKA  +LE  + VNP P+ A IY  L SE     
Sbjct: 223 RAQSYCVTFQPINYLKAELYIRLGKIRKASAVLEAEYTVNPTPQSAKIYISLNSEG---- 278

Query: 311 LKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQA 370
              A RL  +  +   S  +++  ++  G  D A      A+K A    I+L++ Q++  
Sbjct: 279 ---AERLYNLRPDYYFSYCLLASSSISSGKYDLASQYLNTAIKKANYMSIYLIMVQLKVV 335

Query: 371 NSHNTDKILYWTQS-ALHAMPDPLWISDDGYLS-SVWLPLSPISKTLCY 417
                D+ +YW       A+PDP W   +       W            
Sbjct: 336 -LQEQDQTIYWLSKMGSEALPDPCWKCKNCNKELERWDYKCSSCNGFNC 383


>gi|58698408|ref|ZP_00373319.1| conserved hypothetical protein [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225630891|ref|YP_002727682.1| Membrane-bound protoheme IX biogenesis protein, HemY [Wolbachia sp.
           wRi]
 gi|58535063|gb|EAL59151.1| conserved hypothetical protein [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225592872|gb|ACN95891.1| Membrane-bound protoheme IX biogenesis protein, HemY [Wolbachia sp.
           wRi]
          Length = 406

 Score =  154 bits (389), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 50/229 (21%), Positives = 89/229 (38%), Gaps = 14/229 (6%)

Query: 195 VQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILLIARSLENADKGDMIASYHDAI 250
           ++  +L ++W  AI  L +  K+      +     A+   A + +   KG+   +     
Sbjct: 181 IEHCILKEDWINAILRLKEAVKSNIFLPFDHKEMFAVFYCALAKQYESKGNFKEAIKSLF 240

Query: 251 ESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGK 310
            + +        +   A+  I   K RKA  +LE  + VNP P+ A +Y +L S      
Sbjct: 241 RAQRYSAIFQPINYLKAELYIKLGKIRKASAVLEAEYTVNPTPQSAKMYINLNS------ 294

Query: 311 LKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQA 370
            K A RL  +  +   S  +++  ++  G  D A      AMK A    I+ ++ Q+ + 
Sbjct: 295 -KGAERLYNLRPDYYFSYCLLALSSMSSGKYDLASQYLDTAMKKANYMSIYFIVIQL-KV 352

Query: 371 NSHNTDKILYWTQS-ALHAMPDPLWISDDGYLS-SVWLPLSPISKTLCY 417
                DK++YW       A+PDP W   +       W        +   
Sbjct: 353 TLQEHDKVIYWLNKMGSEALPDPGWKCKNCNRELEQWDHKCSSCNSFNC 401



 Score = 40.7 bits (94), Expect = 0.55,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 47/121 (38%), Gaps = 7/121 (5%)

Query: 4   LIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSR 63
           +I +       +   I V    E + +  GN       + I+      LF   LL  + R
Sbjct: 1   MIYFIIFAFSFLFG-IWVKVSGEVIKLELGNYTISIDLYFIIFTCVVLLF---LLITLVR 56

Query: 64  FFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVY 123
           FF S  +   ++ + R  D+    L+    SI   NI  A+K+   +S++       L+ 
Sbjct: 57  FFSSISSTFANIRN-RRRDREELLLFEAFFSIDLDNIENAQKLVKSLSEE--SDRLSLIK 113

Query: 124 L 124
           L
Sbjct: 114 L 114


>gi|42521029|ref|NP_966944.1| hypothetical protein WD1232 [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410770|gb|AAS14878.1| hypothetical protein WD_1232 [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 233

 Score =  153 bits (387), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 50/229 (21%), Positives = 89/229 (38%), Gaps = 14/229 (6%)

Query: 195 VQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILLIARSLENADKGDMIASYHDAI 250
           ++  +L ++W  AI  L +  K+      +     A+   A + +   KG+   +     
Sbjct: 8   IEHCILKEDWINAILRLKEAVKSNIFLPFDHKEMFAVFYCALAKQYESKGNFKEAIKSLF 67

Query: 251 ESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGK 310
            + +        +   A+  I   K RKA  +LE  + VNP P+ A +Y +L S      
Sbjct: 68  RAQRYSAIFQPINYLKAELYIKLGKIRKASAVLEAEYTVNPTPQSAKMYINLNS------ 121

Query: 311 LKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQA 370
            K A RL  +  +   S  +++  ++  G  D A      AMK A    I+ ++ Q+ + 
Sbjct: 122 -KGAERLYNLRPDCYFSYCLLALSSMSSGKYDLASQYLDTAMKKANYMSIYFIVIQL-KV 179

Query: 371 NSHNTDKILYWTQS-ALHAMPDPLWISDDGYLS-SVWLPLSPISKTLCY 417
                DK++YW       A+PDP W   +       W        +   
Sbjct: 180 TLQEHDKVIYWLNKMGSEALPDPGWKCKNCNRELEQWDHKCSSCNSFNC 228


>gi|225677319|ref|ZP_03788296.1| Membrane-bound protoheme IX biogenesis protein, HemY [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
 gi|225590646|gb|EEH11896.1| Membrane-bound protoheme IX biogenesis protein, HemY [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
          Length = 406

 Score =  152 bits (385), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 50/229 (21%), Positives = 89/229 (38%), Gaps = 14/229 (6%)

Query: 195 VQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILLIARSLENADKGDMIASYHDAI 250
           ++  +L ++W  AI  L +  K+      +     A+   A + +   KG+   +     
Sbjct: 181 IEHGILKEDWINAILRLKEAVKSNIFLPFDHKEMFAVFYCALAKQYESKGNFKEAIKSLF 240

Query: 251 ESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGK 310
            + +        +   A+  I   K RKA  +LE  + VNP P+ A +Y +L S      
Sbjct: 241 RAQRYSAIFQPINYLKAELYIKLGKIRKASAVLEAEYTVNPTPQSAKMYINLNS------ 294

Query: 311 LKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQA 370
            K A RL  +  +   S  +++  ++  G  D A      AMK A    I+ ++ Q+ + 
Sbjct: 295 -KGAERLYNLRPDYYFSYCLLALSSMSSGKYDLASQYLDTAMKKANYMSIYFIVIQL-KV 352

Query: 371 NSHNTDKILYWTQS-ALHAMPDPLWISDDGYLS-SVWLPLSPISKTLCY 417
                DK++YW       A+PDP W   +       W        +   
Sbjct: 353 TLQEHDKVIYWLNKMGSEALPDPGWKCKNCNRELEQWDHKCSSCNSFNC 401



 Score = 40.7 bits (94), Expect = 0.55,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 47/121 (38%), Gaps = 7/121 (5%)

Query: 4   LIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSR 63
           +I +       +   I V    E + +  GN       + I+      LF   LL  + R
Sbjct: 1   MIYFIIFAFSFLFG-IWVKVSGEVIKLELGNYTISIDLYFIIFTCVVLLF---LLITLVR 56

Query: 64  FFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVY 123
           FF S  +   ++ + R  D+    L+    SI   NI  A+K+   +S++       L+ 
Sbjct: 57  FFSSISSTFANIRN-RRRDREELLLFEAFFSIDLDNIENAQKLVKSLSEE--SDRLSLIK 113

Query: 124 L 124
           L
Sbjct: 114 L 114


>gi|88607729|ref|YP_505844.1| hypothetical protein APH_1339 [Anaplasma phagocytophilum HZ]
 gi|88598792|gb|ABD44262.1| conserved domain protein [Anaplasma phagocytophilum HZ]
          Length = 412

 Score =  146 bits (368), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 68/429 (15%), Positives = 159/429 (37%), Gaps = 26/429 (6%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+     F V+SL  C F +  +    + +         +   ++ +++     ++ +  
Sbjct: 1   MITYFLIFIVVSL-ACGFAVQGYEGLALKLEVLGYSVEAN---VVFVVFMLCVLFLFIVL 56

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V R   +C   ++ +       K Y  +      ++  ++   RK+     +   F +  
Sbjct: 57  VGRACFACALCMYRVRRGSVSKK-YDEVGKSFAFLSVGHVDNVRKIVGISERFAKFDSPV 115

Query: 121 LVYLLEVQIALAERQYNIAHEKL-----EMMLQIPATR-EFAVYSLYFESCRIGDLNSAQ 174
           L  LLE   +    QY IA +       + + ++        +  L  E  R    +   
Sbjct: 116 L-QLLEGCASFRIGQYEIAEKHFSLIPSKALQEVDLGAWLVGI--LANEKSR----DCKL 168

Query: 175 RYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSL 234
           R  ++  D+     W     ++   +  +W   +T L   +K       +   L +    
Sbjct: 169 RVLSRLYDVFHSRRWSVLFRLEIARMEGQWDEVLTALKLIEKYGVSHPYDLNDLELIARC 228

Query: 235 ENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPE 294
           + A+   M   + + +  +K       A++  AK     N  ++A   LE  ++V+PHP+
Sbjct: 229 KLAELHYMQGDFKEGLGVIKGSSGLQ-ATLWRAKFNAKLNNVKRAMEELEAYYRVDPHPD 287

Query: 295 IANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKI 354
           +A++Y  ++ +  +       +L  +N +S  S +++ +  +++   + A      A+  
Sbjct: 288 VASLYLSMVQDKNLA----VEKLNALNPDSYMSFLLMVRKYMDLKQYNAAEKHLKQALTQ 343

Query: 355 APRKEIFLLLAQIEQANSHNTDKILYWTQSALH-AMPDPLWISDDGYLSS-VWLPLSPIS 412
                ++ ++ +I      N D+I YW       ++PD  W  +    S   W       
Sbjct: 344 YKYAGLYGMMLEI-MVRLGNLDEIEYWIDMMRRDSVPDMHWACEKCCYSPKEWCQECDEC 402

Query: 413 KTLCYFEWK 421
           +     +W+
Sbjct: 403 EGFNTIKWR 411


>gi|111073632|emb|CAL29494.1| hypothetical protein OW2-H [Wolbachia endosymbiont of Onchocerca
           volvulus]
          Length = 420

 Score =  145 bits (367), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 51/229 (22%), Positives = 95/229 (41%), Gaps = 14/229 (6%)

Query: 195 VQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILLIARSLENADKGDMIASYHDAI 250
           ++ Y+L ++W  AI  L +  K       +  +  A+   A + +  +KG+   +     
Sbjct: 195 IEGYILHEDWINAILKLKEAIKFNIFLPFDCEKMLAVFYCASAKQYENKGNYKKALRSLF 254

Query: 251 ESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGK 310
           ++   C      +   A+  I   K RKA V+LE+ + VNP P+ A IY  L S      
Sbjct: 255 KAQSYCAAFQPINYLRAELYIKLGKIRKASVVLEEEYTVNPTPQSAKIYISLNS------ 308

Query: 311 LKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQA 370
            K A +L  +  +   S  +++  ++ +   D A     +AM+ A    I+L++ Q++ A
Sbjct: 309 -KGAEKLYNLRSDYYFSYCLLALSSISLSKYDLASQHLDIAMRKANYVSIYLIMIQLKVA 367

Query: 371 NSHNTDKILYWTQS-ALHAMPDPLWISDDGYLS-SVWLPLSPISKTLCY 417
                ++++YW       A+ DP W   D       W        +   
Sbjct: 368 -LQEYEQVIYWLNKMDSEAISDPYWKCADCNKKLKQWGYKCSSCNSFNC 415


>gi|56417190|ref|YP_154264.1| hypothetical protein AM1180 [Anaplasma marginale str. St. Maries]
 gi|56388422|gb|AAV87009.1| hypothetical protein AM1180 [Anaplasma marginale str. St. Maries]
          Length = 412

 Score =  128 bits (322), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 64/430 (14%), Positives = 135/430 (31%), Gaps = 30/430 (6%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+  +    +++ +     I ++    + I     +   +   I+ +          L  
Sbjct: 1   MITYLL-ICIVASLAAGLAIQNYEELVLKIEIAGYVIEANTVFIVFMACALALLLAALLR 59

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +          +      R     Y++L  G   ++        ++ + V +        
Sbjct: 60  LCLACALLVYKIKCKSVARQ----YESLGRGYALLSLGGAMNHEQIVNTVEKLRALDRYS 115

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQI--PATREFAVYSLYFESCRIGDLNS--AQRY 176
           L  +LE        QY +A + L ++     P  R      L+      G+ +     R 
Sbjct: 116 LA-MLETCAWFRLGQYEMAEKPLLLLKGSGLPDARL----GLWLVESLNGERSKDCKLRV 170

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK--EWNRNRA--ILLIAR 232
             +  D+   APW     ++   +  +W   +  +    K      +   R   I  +  
Sbjct: 171 LRRLCDVFHRAPWAAMFRLEIARIEGDWDTVLVEVKLAAKRGIVLPYKHERMADIACLML 230

Query: 233 SLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPH 292
           +     +GD          +  +      A+I  AK+       +KA   LE  +K  PH
Sbjct: 231 ARSCYQRGDYKEGLKLVGRATDMH-----AAILKAKTHEKLGNPQKARDALEACYKTTPH 285

Query: 293 PEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAM 352
           PEI   Y  +  +          RL  +N +   S+++  K  +     + A   A  A+
Sbjct: 286 PEIVTAYLAVSQDYDTA----TERLSSLNPDHYVSMILSVKRYMNAKQYNAAEQHAKRAI 341

Query: 353 KIAPRKEIFLLLAQIEQANSHNTDKILYWTQS-ALHAMPDPLWIS-DDGYLSSVWLPLSP 410
                 E++ L+A +     +  + + YW       ++P+  W       +   W     
Sbjct: 342 ARYKYVELYCLMADVMARIGNIDEVV-YWITKMQKDSVPNMQWRCTKCCSVLPEWSHECS 400

Query: 411 ISKTLCYFEW 420
                   +W
Sbjct: 401 ACNAFNSVQW 410


>gi|222475555|ref|YP_002563972.1| hypothetical protein AMF_890 [Anaplasma marginale str. Florida]
 gi|255004673|ref|ZP_05279474.1| hypothetical protein AmarV_05254 [Anaplasma marginale str.
           Virginia]
 gi|222419693|gb|ACM49716.1| Conserved hypothetical protein [Anaplasma marginale str. Florida]
          Length = 412

 Score =  128 bits (322), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 64/430 (14%), Positives = 135/430 (31%), Gaps = 30/430 (6%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+  +    +++ +     I ++    + I     +   +   I+ +          L  
Sbjct: 1   MITYLL-ICIVASLAAGLAIQNYEELVLKIEIAGYVIEANTVFIVFMACALALLLAALLR 59

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +          +      R     Y++L  G   ++        ++ + V +        
Sbjct: 60  LCLACALLVYKIKCKSVARQ----YESLGRGYALLSLGGAMNHEQIVNTVEKLRALDRYS 115

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQI--PATREFAVYSLYFESCRIGDLNS--AQRY 176
           L  +LE        QY +A + L ++     P  R      L+      G+ +     R 
Sbjct: 116 LA-MLETCAWFRLGQYEMAEKPLLLLKGSSLPDARL----GLWLVESLNGERSKDCKLRV 170

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK--EWNRNRA--ILLIAR 232
             +  D+   APW     ++   +  +W   +  +    K      +   R   I  +  
Sbjct: 171 LRRLCDVFHRAPWAAMFRLEIARIEGDWDTVLVEVKLAAKRGIVLPYKHERMADIACLML 230

Query: 233 SLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPH 292
           +     +GD          +  +      A+I  AK+       +KA   LE  +K  PH
Sbjct: 231 ARSCYQRGDYKEGLKLVGRATDMH-----AAILKAKTHEKLGNPQKARDALEACYKTTPH 285

Query: 293 PEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAM 352
           PEI   Y  +  +          RL  +N +   S+++  K  +     + A   A  A+
Sbjct: 286 PEIVTAYLAVSQDYDTA----TERLSSLNPDHYVSMILSVKRYMNAKQYNAAEQHAKRAI 341

Query: 353 KIAPRKEIFLLLAQIEQANSHNTDKILYWTQS-ALHAMPDPLWIS-DDGYLSSVWLPLSP 410
                 E++ L+A +     +  + + YW       ++P+  W       +   W     
Sbjct: 342 ARYKYVELYCLMADVMARIGNIDEVV-YWITKMQKDSVPNMQWRCTKCCSVLPEWSHECS 400

Query: 411 ISKTLCYFEW 420
                   +W
Sbjct: 401 ACNAFNSVQW 410


>gi|269958417|ref|YP_003328204.1| hypothetical protein ACIS_00214 [Anaplasma centrale str. Israel]
 gi|269848246|gb|ACZ48890.1| hypothetical protein ACIS_00214 [Anaplasma centrale str. Israel]
          Length = 412

 Score =  124 bits (311), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 71/424 (16%), Positives = 140/424 (33%), Gaps = 30/424 (7%)

Query: 9   FVISLVICSFIIVSHYPED---VSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFF 65
           F+I +V      ++    +     I     +   S     ++   F+   + L   +   
Sbjct: 5   FLICIVTSLAAGLAIQNYEELVFKIDIAGYVIEAS-----TVFVVFVACALALLLTALLR 59

Query: 66  LSCPAMLFHMLHKRNY-DKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYL 124
           L     L     K     K Y++L  G   +++  +    ++   V +        L  +
Sbjct: 60  LCLTCALIAYKIKCRSVAKRYESLGRGYALLSSGGVMNHGQIVDTVEKLRGLDCYSLA-I 118

Query: 125 LEVQIALAERQYNIAHEKLEMMLQI--PATREFAVYSLYFESCRIGDLNSAQRYATKALD 182
           LE        QY +A + L  +     P  R            R  D     R   +  D
Sbjct: 119 LETCAWFRLGQYEMAEKPLLTLKNSCLPDGRLGLWLLELLNRERSKDCR--LRVLRRLCD 176

Query: 183 ISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK--EWNRNRA--ILLIARSLENAD 238
           +    PW T   V+   +  +W  A+       +      +   R   +  +  +     
Sbjct: 177 VFRRVPWATMFKVEIARIEGDWDTALVETRLAARRGVVLPYKHERMGDVACLMLARACCQ 236

Query: 239 KGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANI 298
           +G+         +   +      A+I  A         RKA  +LE  +K  PHPE+   
Sbjct: 237 RGNYREGLKLVEKVTDMH-----ATILKATIHEKLGNLRKARDVLEVCYKTAPHPEVVTA 291

Query: 299 YTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRK 358
           Y  +  +          RL  +N E   S+++  +  + +   + A   A  A+      
Sbjct: 292 YLAVSQDQDAA----MERLSSLNAEHYVSMLLAIRRYVSVKQYNAAEQYAKRALAKYKYV 347

Query: 359 EIFLLLAQIEQANSHNTDKILYWTQSA-LHAMPDPLWIS-DDGYLSSVWLPLSPISKTLC 416
           E++  + ++  A   N D++ YW +     ++P+  W   +   +SS W     +  T  
Sbjct: 348 ELYCAMMEV-MACIGNVDEVAYWLEKMRKDSLPNMQWRCTECCAVSSGWSHECSVCSTFD 406

Query: 417 YFEW 420
             +W
Sbjct: 407 SIQW 410


>gi|254995360|ref|ZP_05277550.1| hypothetical protein AmarM_05429 [Anaplasma marginale str.
           Mississippi]
          Length = 411

 Score =  123 bits (308), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 63/431 (14%), Positives = 135/431 (31%), Gaps = 33/431 (7%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+  +    +++ +     I ++    + I     +   +   I+ +          L  
Sbjct: 1   MITYLL-ICIVASLAAGLAIQNYEELVLKIEIAGYVIEANTVFIVFMACALALLLAALLR 59

Query: 61  VSRFFLSCPAMLF-HMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
           +          +    + ++    G  AL      ++        ++ + V +       
Sbjct: 60  LCLACALLVYKIKCKSVARQYESLGRYAL------LSLGGAMNHEQIVNTVEKLRALDRY 113

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQI--PATREFAVYSLYFESCRIGDLNS--AQR 175
            L  +LE        QY +A + L ++     P  R      L+      G+ +     R
Sbjct: 114 SLA-MLETCAWFRLGQYEMAEKPLLLLKGSSLPDARL----GLWLVESLNGERSKDCKLR 168

Query: 176 YATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK--EWNRNRA--ILLIA 231
              +  D+   APW     ++   +  +W   +  +    K      +   R   I  + 
Sbjct: 169 VLRRLCDVFHRAPWAAMFRLEIARIEGDWDTVLVEVKLAAKRGIVLPYKHERMADIACLM 228

Query: 232 RSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
            +     +GD          +  +      A+I  AK+       +KA   LE  +K  P
Sbjct: 229 LARSCYQRGDYKEGLKLVGRATDMH-----AAILKAKTHEKLGNPQKARDALEACYKTTP 283

Query: 292 HPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLA 351
           HPEI   Y  +  +          RL  +N +   S+++  K  +     + A   A  A
Sbjct: 284 HPEIVTAYLAVSQDYDTA----TERLSSLNPDHYVSMILSVKRYMNAKQYNAAEQHAKRA 339

Query: 352 MKIAPRKEIFLLLAQIEQANSHNTDKILYWTQS-ALHAMPDPLWIS-DDGYLSSVWLPLS 409
           +      E++ L+A +     +  + + YW       ++P+  W       +   W    
Sbjct: 340 IARYKYVELYCLMADVMARIGNIDEVV-YWITKMQKDSVPNMQWRCTKCCSVLPEWSHEC 398

Query: 410 PISKTLCYFEW 420
                    +W
Sbjct: 399 SACNAFNSVQW 409


>gi|99034641|ref|ZP_01314590.1| hypothetical protein Wendoof_01000593 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 155

 Score =  119 bits (298), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 40/156 (25%), Positives = 63/156 (40%), Gaps = 10/156 (6%)

Query: 264 ICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKE 323
              A+  I   K RKA  +LE  + VNP P+ A +Y +L S       K A RL  +  +
Sbjct: 3   YLKAELYIKLGKIRKASAVLEAEYTVNPTPQSAKMYINLNS-------KGAERLYNLRPD 55

Query: 324 SVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQ 383
              S  +++  ++  G  D A      AMK A    I+ ++ Q+ +      DK++YW  
Sbjct: 56  YYFSYCLLALSSMSSGKYDLASQYLDTAMKKANYMSIYFIVIQL-KVTLQEHDKVIYWLN 114

Query: 384 S-ALHAMPDPLWISDDGYLS-SVWLPLSPISKTLCY 417
                A+PDP W   +       W        +   
Sbjct: 115 KMGSEALPDPGWKCKNCNRELEQWDHKCSSCNSFNC 150


>gi|332304811|ref|YP_004432662.1| HemY domain protein [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332172140|gb|AEE21394.1| HemY domain protein [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 393

 Score =  115 bits (288), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 68/386 (17%), Positives = 132/386 (34%), Gaps = 20/386 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++  F  + + +    ++      V I +   +   + F +  +    +   +L   
Sbjct: 1   MIRILMVFVALLIAVLIGSLIFDDKGYVFIDFAGYVVEMNVFSMAIMTILVIVGLLLFSW 60

Query: 61  VSR----FFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTF 116
           + +            L +   ++       A   GL+++A  +   ARK  + + Q+   
Sbjct: 61  LVKKLIMIISGSKNWLGNWGTRKKKR----AFTNGLIALAEQDYLEARKQLASIEQEDFD 116

Query: 117 HNEYLVYLLEVQIALAE-RQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQR 175
                + LL    A  + +    A E   +    P +   A   L  +  +      A  
Sbjct: 117 G----LNLLAAAEAELQLQNPEGAQEYWRLATSYPKSAFAAKLCLVRDHLQNQQPMKALE 172

Query: 176 YATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLI----A 231
                 D       V     Q  V A +W      L   KK   E   +   L      A
Sbjct: 173 ILDDVNDKQKRQKSVLTLRAQALVQAGKWQELKDRLPSWKKALGEHYEHYMQLASSGNFA 232

Query: 232 RSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
                     +  ++H   +S +       A +   K LI Q     AE  L +  K  P
Sbjct: 233 EIASKEGANQLKENWHALPKSTRRDPALQAAYV---KQLIDQGMHIDAEAALGEYHKNKP 289

Query: 292 HPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLA 351
           HP +  +Y  L   +    LK+  +  +++  +VE L  +  +A     +  A      A
Sbjct: 290 HPMLLPLYKELRLSHPTTALKQLEQWLKVDDMNVELLSTLGTLAYHANDLSLAEKALSKA 349

Query: 352 MKIAPRKEIFLLLAQIEQANSHNTDK 377
           +K+  R++  LLLA+I+++   +   
Sbjct: 350 IKLGNRQQDILLLAKIKESQQDDQQA 375


>gi|109896669|ref|YP_659924.1| HemY-like [Pseudoalteromonas atlantica T6c]
 gi|109698950|gb|ABG38870.1| HemY-like protein [Pseudoalteromonas atlantica T6c]
          Length = 393

 Score =  114 bits (286), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 70/386 (18%), Positives = 130/386 (33%), Gaps = 20/386 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++  F  + + +    ++      V I +   +   + F +  +    +   +L   
Sbjct: 1   MIRILMVFVALLIAVLVGSLIFDDKGYVFIDFAGYVVEMNVFSMAIMTILVIVGLLLFSW 60

Query: 61  VSR----FFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTF 116
           + +            L +   ++       A   GL+++A  N   ARK  + + Q+   
Sbjct: 61  LIKKLIMIISGSKNWLGNWGSRKKKR----AFTNGLIALAEQNFLEARKQLASIEQEDFD 116

Query: 117 HNEYLVYLLEVQIALAE-RQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQR 175
                + LL    A  + +    A E   +    P +   A   L  +  +      A  
Sbjct: 117 G----LNLLAAAEAELQLQNPAGAQEYWRLATSYPKSAFAARLCLVRDHLQNQHPVKALD 172

Query: 176 YATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLI----A 231
              +  D       V     Q  V A +W      L   KK   E   +   L      A
Sbjct: 173 ILDELDDKQKRQRSVLTLRAQALVQAGKWQELKDRLPSWKKALGEHYEHYMQLASKGNFA 232

Query: 232 RSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
                     +  ++H   +S +       A +   K LI Q     AE  L +  K  P
Sbjct: 233 EIASKEGANQLKENWHSLPKSTRRDPALQAAYV---KQLIDQGMHIDAEAALGEYHKNKP 289

Query: 292 HPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLA 351
           HP +  +Y  L        LK+  +  + +  +VE L  +  +A        A      A
Sbjct: 290 HPMLLPLYKELKLSQPTTSLKQLEQWLKADDMNVELLSTLGAVAYNAKDFSLAEKALSKA 349

Query: 352 MKIAPRKEIFLLLAQIEQANSHNTDK 377
           +K+  R++  LLLA+I+++   N   
Sbjct: 350 IKLGNRQQDILLLAKIKESQQDNQQA 375


>gi|148259145|ref|YP_001233272.1| HemY domain-containing protein [Acidiphilium cryptum JF-5]
 gi|326402298|ref|YP_004282379.1| hypothetical protein ACMV_01500 [Acidiphilium multivorum AIU301]
 gi|146400826|gb|ABQ29353.1| HemY domain protein [Acidiphilium cryptum JF-5]
 gi|325049159|dbj|BAJ79497.1| hypothetical protein ACMV_01500 [Acidiphilium multivorum AIU301]
          Length = 394

 Score =  113 bits (282), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 62/441 (14%), Positives = 136/441 (30%), Gaps = 59/441 (13%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR  R+  V   ++     ++     V++  G      S  V + +L   +   +L+  
Sbjct: 1   MLRAFRFALVAITLLGIAWFLAGLQGHVTVEIGTYAATASTPVAILLLVLLIVVVVLVLG 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R  LS P  +     +   D    A    L ++AA +   A       + +       
Sbjct: 61  LLRGALSLPRRISVRRGRARRDAADSAALRALSALAAGDTEAAA--GHARTARRHAPEAP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFES-CRIGDLNSAQRYATK 179
           L   +  + A        A      + +           L         D +   R A +
Sbjct: 119 LTLYVSAETARQAGDAAGAEALFSNLAKHGDAGFLGWRGLLTARPLPQDDPDRLARSAEQ 178

Query: 180 ALDIS---PDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLEN 236
           A   +   P++ W+ E  V+  +    +S A          A               + +
Sbjct: 179 ARQAAASYPNSAWLREQRVRIALGQGRFSEAARLATDPAARAA-----------LAIMAS 227

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
            +      +   A ++++L      A +   ++     +  +A+  L++ W++ PHP++A
Sbjct: 228 REVAGEPLAIDWARDAVRLAPGLPEAHLALFEARAKAGQAWRAKRALKRGWRIAPHPDLA 287

Query: 297 NIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAP 356
           + +   L+ + + +   A +L E+N    ES  ++++ A     + +A            
Sbjct: 288 DAWLAALT-SPLERATAAAKLAELNPGHPESEALLARTARAANLVGEAERH--------- 337

Query: 357 RKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDG-YLSSVWLPLSPISKTL 415
                      E+                       +W+          W P       +
Sbjct: 338 -----------ERHGGGKG-----------------VWVCATCDTEHEAWQPTCRKCGAI 369

Query: 416 CYFEW---KIPTKSPEYISSE 433
               W     P  +P  + + 
Sbjct: 370 GSLGWLRRTNPESTPRLLPAP 390


>gi|292493891|ref|YP_003529330.1| HemY domain protein [Nitrosococcus halophilus Nc4]
 gi|291582486|gb|ADE16943.1| HemY domain protein [Nitrosococcus halophilus Nc4]
          Length = 428

 Score =  113 bits (282), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 64/396 (16%), Positives = 138/396 (34%), Gaps = 15/396 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVS-HYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLF 59
           M++ + +  ++ ++     +++      + + +G  +  T+  + + +         L  
Sbjct: 1   MMKAVIFGLIVLILAVGLELLTHDDSGYLVVGYGQWMVETTLTLAVIVAGLAFIGGYLAL 60

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
                    P  L     +R   +  K L  GL+ I   N   A +  + V      +  
Sbjct: 61  RFFSNMWRAPQRLGETRQRRRNSRASKMLIEGLIDIEEGNWDRAER--ALVKDIAHSNTP 118

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQI--PATREFAVYSLYFESCRIGDLNSAQRYA 177
            L Y+   + A  +  Y    +    + +   PA       +        G  + A    
Sbjct: 119 LLNYIAAARAAQNQGAYER-RDHYLDLARETTPAANFAVELAQAELQISSGQFDQALATI 177

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENA 237
                + P  P   + +   Y   ++W + +  L + +K           L +   +E  
Sbjct: 178 RHLRALDPRHPQPLKLLKSLYSQHRDWGQLLGLLPELRKRRLVNKEESQSLEVMAHVELL 237

Query: 238 DKGDMIASYHDAIESLKLCDN------SIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
            +     S    IE+ K   N       I+A+   A  L+ +N+   AE +L++  K N 
Sbjct: 238 QEAARSESDAYLIEAWKAVPNRLRRHPRIVAAYVYA--LLERNELDLAEQLLQETLKRNW 295

Query: 292 HPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLA 351
             E+  +Y  + S + V +L RA         +   L+ + ++A   G   +A      +
Sbjct: 296 SDELIYLYGLVRSSDLVAQLTRAEAWLSQQGNNPWLLLTLGRLAQYNGLWGKARQYLETS 355

Query: 352 MKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALH 387
           +  APR E +  L ++ +    +++  L      L 
Sbjct: 356 IAYAPRPEAYRELGKVLE-EIGDSEAALECYSKGLS 390


>gi|330957340|gb|EGH57600.1| hemY protein [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 414

 Score =  111 bits (279), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 63/390 (16%), Positives = 140/390 (35%), Gaps = 23/390 (5%)

Query: 4   LIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSR 63
           ++ +  +++  +     ++ +   V I + N  Y +S +  L++L   +    L+  V  
Sbjct: 6   VLLFIAIVAAALIGVA-IADHAGYVLIAYKNFRYESSLWATLALLLAVMLVIFLVRLVIT 64

Query: 64  FFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVY 123
              +   ++     +  + +   A+  G M +A      A++     ++     +  L Y
Sbjct: 65  LLTTSGGVVNPWSRRNRHRRVQMAIEQGQMDLAEGRWASAQRHLQRAAEADA--HPLLYY 122

Query: 124 LLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFES---CRIGDLNSAQRYATKA 180
           +   + A  + +Y      LE  L+     E A+      +      GD + A       
Sbjct: 123 IGAARAANEQGRYEDCDSLLERALERQPQAELAI--ALNHAQLQQDRGDTDGALITLQAM 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRA----------ILLI 230
               P  P V   + + Y    +WS  I  L + +K+     +  A          + L 
Sbjct: 181 QQRHPHNPQVLRQLQRLYQQRGDWSELIRLLPELRKDKVLPPKELAELERRAWGENLTLA 240

Query: 231 ARSLENADKGDMIASYHDAIESLKLCDNSIMASICA-AKSLISQNKKRKAEVILEKIWKV 289
               ++      + S   A +SL          + A A  L     + +AE +L    K 
Sbjct: 241 GHRNDSEGTLTGLPSLEQAWQSLSAAQRQEPQLVLAYADQLRRLGAETQAEEVLRTALKR 300

Query: 290 NPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAM 349
           + H  +A +Y  +   + + +L+ A    + +      L+ + +I L+     +A     
Sbjct: 301 DYHSHLARLYGLVRGSDPLKQLQAAEGWLKHHPSDPSLLLSLGRICLQGRLWGKARDYLE 360

Query: 350 LAMKI----APRKEIFLLLAQIEQANSHNT 375
            ++++        E+  LLAQ+ + +  N 
Sbjct: 361 SSLRLQRNPETCAELARLLAQMGETDRSNQ 390


>gi|270158069|ref|ZP_06186726.1| protoporphyrinogen IX and coproporphyrinogen III oxidase HemY
           [Legionella longbeachae D-4968]
 gi|289163666|ref|YP_003453804.1| protoporphyrinogen IX and coproporphyrinogen III oxidase HemY
           [Legionella longbeachae NSW150]
 gi|269990094|gb|EEZ96348.1| protoporphyrinogen IX and coproporphyrinogen III oxidase HemY
           [Legionella longbeachae D-4968]
 gi|288856839|emb|CBJ10650.1| protoporphyrinogen IX and coproporphyrinogen III oxidase HemY
           [Legionella longbeachae NSW150]
          Length = 394

 Score =  103 bits (257), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 58/382 (15%), Positives = 134/382 (35%), Gaps = 41/382 (10%)

Query: 1   MLRLIR-YFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLF 59
           M+R++  +  +++ VI   I ++  P  V I   +    T+ +V +  L        L  
Sbjct: 1   MIRVLFAFLILLAAVILG-IQLNKDPGYVLIAINHWTIETTVWVAIFTLILLFMIVYLFL 59

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYT-GLMSIAAHNIPLARKMHSYVSQQHTFHN 118
            + +     P+ L     ++ + K  +A+   GL+  +  N   A+  +  +        
Sbjct: 60  GICQKISLTPSKLTRWHARKRFRKA-QAITRKGLIEYSEGNWVKAK--NHLIQGLPNSDT 116

Query: 119 EYLVYLLEVQIALAERQY----NIAHEKLEMMLQIPATREFAVYSLYFES---CRIGDLN 171
             L YL   + A          +   E  + M +     E        ++          
Sbjct: 117 PLLNYLTAARAAQKMGDNQLRDDYLREAQQSMPEAKIAVEL------TQAELQLSNHQWE 170

Query: 172 SAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFL----NQKKKNAKEWNRNRAI 227
            A         I+P  P+V   +++ Y   ++W + IT L      K  N +E+ + +  
Sbjct: 171 QALATLKHLHTIAPRHPYVLMLMMRLYQEIRDWPQLITLLPDLKKYKVINQQEFEQIQYD 230

Query: 228 LLIARSLENADKGDMIASYHDAIESLKLCDNSIMASIC--------AAKSLISQNKKRKA 279
             + R  + A +            ++     SI  +I           + L+  N+   A
Sbjct: 231 TYLQRLRDLAKQNQSS--------AVNSFFQSIPKTIVNNPEVIAEYTRFLLKNNEFTTA 282

Query: 280 EVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMG 339
           + ++ +  + + +P +  +Y  L ++     L  A  L +    S    + + ++ +++ 
Sbjct: 283 KNLVYRTLRKDFNPRLIELYAMLPADEHQ--LTFAESLLKKKPHSAALYLCLGQLCIKLQ 340

Query: 340 SIDQAHAKAMLAMKIAPRKEIF 361
              +A      + +I P    +
Sbjct: 341 LWGKAKYYLEKSNEIEPTPLAY 362


>gi|237801595|ref|ZP_04590056.1| hemY protein [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331024455|gb|EGI04511.1| hemY protein [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 414

 Score =  103 bits (256), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 63/392 (16%), Positives = 137/392 (34%), Gaps = 29/392 (7%)

Query: 4   LIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSR 63
           ++ +  +++  +     V+ +   V I + N  Y +S +  L++L   L     +  V  
Sbjct: 6   VLLFIAIVAAALIGVA-VAEHSGYVLIAYQNFRYESSLWATLALLVAVLLVIAAIRLVIT 64

Query: 64  FFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVY 123
              +   ++     +    +   A+  G M +A      A++     ++     +  L Y
Sbjct: 65  LLTTSGGVVNPWSRRNRSRRVQLAIEQGQMDLAEGRWSSAQRHLQRAAEADA--HPLLYY 122

Query: 124 LLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFES---CRIGDLNSAQRYATKA 180
           +   + A  + +Y      LE  L+     E A+      +      GD + A       
Sbjct: 123 IGAARAANEQGRYEDCDALLERALERQPQAELAI--ALNHAQLQQDRGDTDGALTTLQAM 180

Query: 181 LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRA----------ILLI 230
               P  P V   + + Y    EWS  I  + + +K+     +  A          + L 
Sbjct: 181 HQRHPHNPQVLRQLQRLYQQRGEWSDLIRLMPELRKDKVLPPKELAELERRAWGENLTLA 240

Query: 231 ARSLENADKGDMIASYHDAIE----SLKLCDNSIMASICAAKSLISQNKKRKAEVILEKI 286
           A   +       + S   A +    + +     + A    A  L     + +AE +L   
Sbjct: 241 AYRDDTDGALTGLPSLEKAWQGLSAAQRQEPQLVQA---YADQLRRLGAEAQAEEVLRVA 297

Query: 287 WKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHA 346
            K   H  +A +Y  +   + + +L+ A    + +      L+ + +I L+     +A  
Sbjct: 298 LKREYHSPLARLYGLVRGGDPLKQLQVAEGWLKHHPADPSLLLSLGRICLQGRLWGKARD 357

Query: 347 KAMLAMKI----APRKEIFLLLAQIEQANSHN 374
               ++++        E+  LLAQ+ + +  N
Sbjct: 358 YLESSLRLERNPETCAELARLLAQLGETDRSN 389


>gi|70733283|ref|YP_263057.1| hemY protein [Pseudomonas fluorescens Pf-5]
 gi|68347582|gb|AAY95188.1| hemY protein [Pseudomonas fluorescens Pf-5]
          Length = 412

 Score =  101 bits (253), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 62/385 (16%), Positives = 128/385 (33%), Gaps = 16/385 (4%)

Query: 5   IRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRF 64
           +    VI+ +    + ++ +P  V I + N  Y +S +  L+++         +  +   
Sbjct: 6   VIVLLVIAAIGLLGLAIAEHPGYVLIAYSNFRYESSLWATLALVALVWLVVWGIKLLIEL 65

Query: 65  FLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYL 124
            +    ++     +    +   A+  G M +A      A+K     +         L YL
Sbjct: 66  VMVSGGVVNPWSRRNRSRRVQIAIEQGQMDLAEGRWASAQKHLQRAA--EAERQPLLYYL 123

Query: 125 LEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCR-IGDLNSAQRYATKALDI 183
              + A  +  Y      LE  L      E AV   + +     GD   A        + 
Sbjct: 124 GAARAANEQGHYEECDRLLERALTRQPQAELAVALSHAQLQTDRGDTEGALSTLQAMHER 183

Query: 184 SPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEW--------NRNRAILLIARSLE 235
            P +  V   + + +    +WS  I  L + +K+             R     L   +  
Sbjct: 184 HPHSVQVLRQLQRLHQQRGDWSALIRLLPELRKDKALPASELQELERRAWGENLSLAARR 243

Query: 236 NADKGDMIASYHDAIESLKLCDNSIMASICA-AKSLISQNKKRKAEVILEKIWKVNPHPE 294
             D+   + S + A + L          + A A+ L       +AE  L    K      
Sbjct: 244 EEDEVAGLQSLNRAWQQLTSAQRQEPQLVLAYAEQLRQLGAGAEAEEALRTAIKRKYESH 303

Query: 295 IANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKI 354
           +A +Y  +   +   +L+ A    + + +    L+ + ++ L+     +A      ++++
Sbjct: 304 LARLYGLVRGSDPSRQLQTAEHWLKEHADDPSLLLTLGRLCLQNSLWGKARDYLESSLRL 363

Query: 355 ----APRKEIFLLLAQIEQANSHNT 375
                   E+  LLAQ+      N 
Sbjct: 364 QRNPEACAELARLLAQLGDTERSNQ 388


>gi|294787826|ref|ZP_06753070.1| HemY family protein [Simonsiella muelleri ATCC 29453]
 gi|294484119|gb|EFG31802.1| HemY family protein [Simonsiella muelleri ATCC 29453]
          Length = 397

 Score =  101 bits (253), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 57/384 (14%), Positives = 123/384 (32%), Gaps = 27/384 (7%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M  LI    + ++ + + +++ H+P DV    GN + R +  + +  L   +     L  
Sbjct: 1   MKGLIWIIVLFAIAVGAALLIQHFPGDVYAHVGNYMLRMNLRLFIIGLLLSMVVLYFLIK 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQ-QHTFHNE 119
                L+ P  +      R   K   AL    ++        A +  + V    H  +N 
Sbjct: 61  FVFGILATPGKMSRFGSSRKSRKAIAALNDAGVAYFEGRYQKAEQEAAKVLANNHAGNNR 120

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFE--SCRIGDLNSAQRYA 177
            L  ++  Q +            L  M Q+   +      L     +    D  +A+   
Sbjct: 121 VLALMIAAQSSQKIGNLTKRDSYLRDMEQVLPAKAQLPRYLLLAESAMLRQDYVTAEENL 180

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQ--KKKNAKEWNRNRAILLIARSLE 235
           + A  +  + P + +  ++  +        +  L    K + A + +    +     +  
Sbjct: 181 SAAAQLDRNLPELLQMQLRLAIAK---DNPLEILESVDKLQKASQLSNEEVLNYRNVAYR 237

Query: 236 NADKGDMIASYHDAIESLKLCDNSIMAS---ICAAKSLISQNKKRKAEVILEKIWKVN-- 290
           +       AS   A  +L+   + + +    +  A         + A       W  +  
Sbjct: 238 SLVANAANASQLKA--ALRRIPDEVKSGELCVSIATQYQHLGLYQDAT-----AWVRSYY 290

Query: 291 PH-------PEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQ 343
           PH       P  AN   +L        +  A    +   +  E L+ + ++ +      +
Sbjct: 291 PHTHYVDLLPIFANSMRYLNDSEQRKSIDIADGWLKSQPKDAELLICLGELCINKQLWGK 350

Query: 344 AHAKAMLAMKIAPRKEIFLLLAQI 367
           A      ++ I P     L LA++
Sbjct: 351 AQGYLEASVAIKPTTRARLALAKV 374


>gi|254490246|ref|ZP_05103436.1| HemY N-terminal domain protein [Methylophaga thiooxidans DMS010]
 gi|224464593|gb|EEF80852.1| HemY N-terminal domain protein [Methylophaga thiooxydans DMS010]
          Length = 399

 Score =  101 bits (251), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 60/385 (15%), Positives = 141/385 (36%), Gaps = 12/385 (3%)

Query: 2   LRLIRYFFVISLVICSFIIVSH-YPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++++    +  ++  +FI  +   P    + +GN    TS  V+ +   F L A  LL  
Sbjct: 1   MKVLIIVALALVLGAAFIWAADFEPGFALLQYGNWSLETSLVVLSTAFIFLLVAGYLLLR 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
                   P  L      + + +  +AL  GL+++       A ++   +   +      
Sbjct: 61  SVVLVKQSPKRLSAWKQNQRHKRASQALTRGLITLEEGRWAEAERV--LLRHANNSETPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCR--IGDLNSAQRYAT 178
           L YL   + A  +   +     L +  +     + AV  +     +   G    A     
Sbjct: 119 LHYLAAARAAQKQHAPDRRDNYLRLAHETTDGADIAV-GVVQAELQLSAGQKEQALATLQ 177

Query: 179 KALDISPDAPWVTEAVVQQYVLAKEWSRAITFL-NQKKKNAKEWNRNRAI----LLIARS 233
              +++P  P+V + +   Y    +W    + L + +K++  E    RA+     +    
Sbjct: 178 HLREVAPKHPYVLQLLQTLYQDMDQWQEVQSVLPDLRKRHVLETAEVRALDQEAAVGQLE 237

Query: 234 LENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHP 293
           L  + +     +        ++     M     A  LI Q ++ +A  ++E+  + N   
Sbjct: 238 LALSRQEWSKMARVWEKSPARMRQTEAMLRPYVA-GLIKQGEQEQAIELIEQFLRKNWSD 296

Query: 294 EIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMK 353
           ++   Y  +   + + +L  A +  +  K++   L+ + ++A       +A      +++
Sbjct: 297 QLVYQYGQIAQGDLLKRLAIAEKWLKDKKDNPWLLLTLGRLAKASELWKKAEEYLHASLE 356

Query: 354 IAPRKEIFLLLAQIEQANSHNTDKI 378
              R E +  LA+++ A   +    
Sbjct: 357 QGARGETYQALAEVQLAEGRHDAAA 381


>gi|77461705|ref|YP_351212.1| HemY-like [Pseudomonas fluorescens Pf0-1]
 gi|77385708|gb|ABA77221.1| putative HemY domain protein [Pseudomonas fluorescens Pf0-1]
          Length = 412

 Score =  100 bits (250), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 59/379 (15%), Positives = 133/379 (35%), Gaps = 15/379 (3%)

Query: 1   MLRLIRYFF-VISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLF 59
           M RL    F VI+      + ++ +   V + + +  Y +S +  L+++         + 
Sbjct: 1   MKRLYVIVFLVIAATAALGLAIAEHSGYVLVAYKSFRYESSLWATLAVVAVLWLLVWGIK 60

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARK-MHSYVSQQHTFHN 118
           A+    L+   ++     +    +   A+  G + +A      A++ ++     +     
Sbjct: 61  ALVELVLTSGGVVNPWSRRNRSRRVQVAIEHGQLDLAEGRWASAQRHLYRAAEAER---Q 117

Query: 119 EYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCR-IGDLNSAQRYA 177
             L YL   + A  +  Y  +   LE  L+     E A+   + +     GD + A    
Sbjct: 118 PLLYYLGAARAANEQGNYEESDRLLERALERQPQAELAIALSHAQLQTDRGDTDGALVTL 177

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA--------KEWNRNRAILL 229
               +  P        + + +    +WS  I  L + +K+         +   R     L
Sbjct: 178 QAMHERHPHNVQTLRQLQRLHQQRGDWSSVIRLLPELRKDKVLPPAELTELERRAWGENL 237

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICA-AKSLISQNKKRKAEVILEKIWK 288
              +    D    + S + A + L        A + A A+ L     + +AE +L    K
Sbjct: 238 SLAAHREEDGAVGLQSLNRAWQQLTSAQRQEPALVLAYAEQLRQLGAQVEAEEVLRTALK 297

Query: 289 VNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
                 +A +Y  +   +   +L+ A    + +      L+ + ++ L+     +A    
Sbjct: 298 RKYDSHLARLYGLVRGSDPARQLQTAEGWLKDHPGDASLLLTLGRLCLQASLWGKARDYL 357

Query: 349 MLAMKIAPRKEIFLLLAQI 367
             ++++    E    LA++
Sbjct: 358 ESSLRVQRNPEACAELARL 376


>gi|261856744|ref|YP_003264027.1| HemY domain protein [Halothiobacillus neapolitanus c2]
 gi|261837213|gb|ACX96980.1| HemY domain protein [Halothiobacillus neapolitanus c2]
          Length = 400

 Score =  100 bits (248), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 54/395 (13%), Positives = 126/395 (31%), Gaps = 16/395 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R +    ++ L   +       P    I       +TS   +L+++        +++ 
Sbjct: 1   MKRFVLILIILVLAAGAGFYFIRDPGTADIALLGWDLQTSALGLLALIIVGFIVLAIIWR 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V    L  P++      ++      + +      +      +A K+      + +     
Sbjct: 61  VISAVLKLPSLWRRRSARQKQQAADEQVLRAWAELERGRFSVAEKLARTRLNEASL--PP 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMM-LQIPATREFAVYSLYFESCRIGDLNSAQRYATK 179
           L Y++     +A+ +       L+ +    P   +F    +     +  +L  A      
Sbjct: 119 LNYVIAADALMAQDETAATLSLLDEVRASFPRFADFLSLHIANRFRQQKNLAPALELLQS 178

Query: 180 ALDISPDAPWVTEAVVQQYVLAKEWSR------AITFLNQKKKNAKEWNRNRAILLIARS 233
                P    +  A  +    A +W +      A+  L       ++  R    +     
Sbjct: 179 LAAAHPKDEAIVCAFAETLFEAADWEKLRTLMPALRRLKWSGLTEQDVQRYDRAVYGGLI 238

Query: 234 LENADKGDMIASYHDAIESLK--LCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
            E A             ++ K    D+ ++AS+  A S ++  +  +AE ILE       
Sbjct: 239 QEAARHKQTAELAAIWNDAPKSLRQDDLMLASL--ANSWLTLGQPAEAERILETAQDQQC 296

Query: 292 HPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIV---SKIALEMGSIDQAHAKA 348
            P + + +  L   +    + R       +    +  ++    +++A      + A    
Sbjct: 297 TPALLHHWLALPPADPARAIARFNHWAGQSTCQPDKKLLAYANARLAWLNDDTEGAKQAL 356

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQ 383
              +   P      L AQI +    +T  ++Y+T+
Sbjct: 357 APVLGDHPDIPSLKLAAQIAEHERDSTQAVMYYTK 391


>gi|330827975|ref|YP_004390927.1| HemY protein [Aeromonas veronii B565]
 gi|328803111|gb|AEB48310.1| HemY protein [Aeromonas veronii B565]
          Length = 387

 Score = 98.5 bits (244), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 56/376 (14%), Positives = 122/376 (32%), Gaps = 21/376 (5%)

Query: 1   MLRLIRYFFV-ISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLF 59
           M+R+I    V ++ +I      S     V I  GN    +S    + +   F  A +++ 
Sbjct: 1   MIRIIILVAVMVAGLIFG-PQASGNKGYVLIALGNYTIESSVTSAVILAVLFYGALLIVE 59

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
            +                 R   K  +      +++A  +   A K+    +        
Sbjct: 60  WLLGRVFGLRRKTLGWYGSRRRRKANQQTVAATLAMAEGHYSQAEKLMIKGASN--SDTP 117

Query: 120 YLVYLLEVQIALAERQYNIAHEKL-EMMLQIPATREFAVYSLYFESCRIGDLNSAQRYAT 178
            L YL   + A A        + L +   + P        +        G  ++A     
Sbjct: 118 LLNYLSAAKAAQARGDDARRDQYLQKAQEENPKAELALTLTQTQLQIEQGQYDTALAMLE 177

Query: 179 KALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILL-------IA 231
               ++P  P V + + Q ++  ++WS     +    K  K   +    LL       + 
Sbjct: 178 SVYALNPRHPMVLDQLRQVHLARQDWSALCDLIPALHKVGKLTPKQEEDLLQQAWCGRLQ 237

Query: 232 RSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
           ++  + +    +  + D    L+L    +    C    L       +A  + ++  +  P
Sbjct: 238 QAAGSLETLKAV--WQDLPRKLRLEPELL---ACYGDLLRQLGADSEAATLWQEALRKQP 292

Query: 292 HPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLA 351
            P++      L  ++    L     L +  +   +    ++++ L  G +D A       
Sbjct: 293 MPQLLARLPKLKLDSYQPLL----ALLQKQQGQPDVDTALAQLYLLAGQLDDAQKLLEQE 348

Query: 352 MKIAPRKEIFLLLAQI 367
           ++ AP    +  L Q+
Sbjct: 349 VERAPSAAAYHALGQL 364


>gi|322834937|ref|YP_004214964.1| HemY protein [Rahnella sp. Y9602]
 gi|321170138|gb|ADW75837.1| HemY protein [Rahnella sp. Y9602]
          Length = 398

 Score = 98.1 bits (243), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 63/390 (16%), Positives = 124/390 (31%), Gaps = 21/390 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           MLR+   F ++   I    I++ +   V I   N    TS   ++ +L   +    L+  
Sbjct: 1   MLRVFVLFLIVFAGIIVGPILAGHQGYVLIQTDNYNIETSVTGLVIMLIVLIVVLFLIEW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R  L   A        R   K  K  +  ++ +A  +     K+ +  +         
Sbjct: 61  ILRRVLRTGARTRGWFAGRKSSKARKQTHAAMLKLAEGDHRQMEKLLARNADHA--EQPV 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQ--------IPATREFAVYSLYFESCRIGDLNS 172
           + YLL  + A         ++ LE   +        +  TR              G++++
Sbjct: 119 VNYLLAAEAAQQRGDDIRTNQYLERAAEIADIDQMPVDITRV-------RIQLARGEVHA 171

Query: 173 AQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAIL---- 228
           A+    + L  SP  P V     Q Y+L   +   +  L    K     +    +L    
Sbjct: 172 ARHGVDRLLGQSPRHPEVLRLAEQAYLLTGAYGSLLEILPSMAKADIHTDDEIRVLQEQA 231

Query: 229 LIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWK 288
            I    +   +           +  +   + +   +  A  LI  N +  A+ ++    K
Sbjct: 232 YIGMMNQLMAEEGSEGLKRWWKDQSRKTRHEVALQVAMATHLIECNDQDLAQEVILDGLK 291

Query: 289 VNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
                 +  +   L S N     K   +L + N  +      + ++ ++ G   QA    
Sbjct: 292 RQYDDRLVALMPKLRSGNPEQLEKTLRQLIKQNGTTPLLSSTLGQLLMKHGEWQQASEAF 351

Query: 349 MLAMKIAPRKEIFLLLAQIEQANSHNTDKI 378
             A+K  P    +  LA          +  
Sbjct: 352 REALKQRPDAYDYAWLADALDKLHKPAEAA 381


>gi|295095184|emb|CBK84274.1| hemY protein [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 400

 Score = 98.1 bits (243), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 58/391 (14%), Positives = 115/391 (29%), Gaps = 23/391 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ML++   F ++   I    +++ +   V I   N    TS   ++ IL   +   + +  
Sbjct: 2   MLKVFLLFILLIAGIVLGPMLAGHQGYVLIQTDNYNIETSVTGLVIILILGVVVLLAVEW 61

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARK-MHSYVSQQHTFHNE 119
           + R               R   +  K     L+ +A  +     K M             
Sbjct: 62  LLRRIFRTGVHTRGWFVGRKRRRARKQTEQALLKLAEGDYQQVEKLMSKNADH---AEQP 118

Query: 120 YLVYLLEVQIALAERQYNIA----HEKLEMMLQIP----ATREFAVYSLYFESCRIGDLN 171
            + YLL  + A        A        E+  + P     TR               + +
Sbjct: 119 VVNYLLAAEAAQQRGDEARANQHLERASELSTKDPIPVEITRV-------RLQLARNENH 171

Query: 172 SAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN--AKEWNRNRAILL 229
           +A+    + L+I+P  P V     Q Y+    W   +  +    K     + +R+    L
Sbjct: 172 AARHGVDRLLEITPRHPEVLRLAEQAYIRTGAWGSLLDIIPSMAKADVGDDEHRDELQRL 231

Query: 230 IARSLENADKGD--MIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIW 287
               L +  + D              +     +   +  A+ LI  +    A+ IL    
Sbjct: 232 AWIGLMDQARADLGSDGLKTWWKNQSRKTRQQVPLQVAMAEHLIECDDHDTAQEILLDGL 291

Query: 288 KVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAK 347
           K      +  +   L + N     K   +  +   +       + +  ++ G   +A   
Sbjct: 292 KRQYDDRLVMVIPRLKTNNPEQIEKALRQQIKTVGDRPLLWSTLGQSLMKHGEWQEASLA 351

Query: 348 AMLAMKIAPRKEIFLLLAQIEQANSHNTDKI 378
              A+K  P    +  LA          +  
Sbjct: 352 FRAALKQRPDAFDYAWLADSLDKQHKPEEAA 382


>gi|312963801|ref|ZP_07778272.1| HemY-like protein [Pseudomonas fluorescens WH6]
 gi|311281836|gb|EFQ60446.1| HemY-like protein [Pseudomonas fluorescens WH6]
          Length = 413

 Score = 97.3 bits (241), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 59/396 (14%), Positives = 139/396 (35%), Gaps = 28/396 (7%)

Query: 1   MLRLIRYFFVISLVICS-FIIVSHYPEDVSITWGNR-LYRTSPFVILSILYFFLFAWILL 58
           M R      ++  +  +  + +S +   V IT+ +   Y +S +  L  ++    A  ++
Sbjct: 1   MKRFYMILVLVIAIALALAVGISKHTGYVLITYPHVLHYESSLWATLVAVFAIGLAIYVI 60

Query: 59  FAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARK-MHSYVSQQHTFH 117
             +     +   ++     +    +   A+  G M +A      A + +H     +    
Sbjct: 61  RLLLSLVTTSGGVVNPWSRRNRSRRVQIAIEQGQMDLAEGRWASAERHLHRAAEAER--- 117

Query: 118 NEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFE-SCRIGDLNSAQRY 176
              L YL   + A  + +Y  +   LE  L+     E AV   + +     GD + A   
Sbjct: 118 QPLLYYLGAARAANEQGRYEESDGLLERALERQPQAELAVALSHAQLQLDRGDTDGALVT 177

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA-------KEWNRNRAILL 229
                +  P    V   + + +    +WS  I  L + +K+         E  R      
Sbjct: 178 LQAMHERHPHNAQVLRQLQRLHQQRGDWSSVIRLLPELRKDKVLPAGELAELERRAWGEN 237

Query: 230 IARSLENADKGDM-----IASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEV-IL 283
           ++ + +  ++G+        ++     + +     ++A     + L +  K  +A    L
Sbjct: 238 LSLAAQREEQGEAGLQSLERAWQQLTSAQRQEPQLVLAYAEQLRQLGADAKAEEALRGAL 297

Query: 284 EKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQ 343
           ++ +  +    +  +Y  L   +   +LK A    + +      L+ + ++ L+     +
Sbjct: 298 KRSYDSH----LIRLYGLLRGSDPTRQLKFAEGWLKDHPGDASLLLTLGRLCLQNSLWGK 353

Query: 344 AHAKAMLAMKI----APRKEIFLLLAQIEQANSHNT 375
           A      ++++        E+  LLAQ+      N 
Sbjct: 354 ARDYLESSLQVQRNPEACAELARLLAQLGDTERSNQ 389


>gi|37678262|ref|NP_932871.1| uncharacterized enzyme of heme biosynthesis [Vibrio vulnificus
           YJ016]
 gi|37197001|dbj|BAC92842.1| uncharacterized enzyme of heme biosynthesis [Vibrio vulnificus
           YJ016]
          Length = 393

 Score = 96.5 bits (239), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 62/397 (15%), Positives = 129/397 (32%), Gaps = 19/397 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RLI  F V+   +      S     V I+  N     S   ++  +   L     L  
Sbjct: 1   MIRLIFLFVVLGAGLFVGTQFSGQQGYVLISIANTTIEMSVTTLVIFIVAALAGLFGLEY 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  L      ++    R   +  +    G++ +   +   A K  +  +  H      
Sbjct: 61  LVKKVLYTGFTTWNWFSVRKMRRSRRYTNEGIIKLLEGDWKGAEKKVTRWASHH--DMPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAV---YSLYFESCRIGDLNSAQRYA 177
           L YL+  + A  +       +    +         AV    S   +  R G+   A    
Sbjct: 119 LCYLVASEAADGQGDKAK-RDHYLALAAEQENAYLAVELTRS--KQLVREGEFAQAFDSL 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFL----NQKKKNAKEWNRNRAILLIARS 233
                  P+ P V   +   Y+  K W   I  L     Q   + ++  +          
Sbjct: 176 QSLKGRYPNNPIVLNLLKTTYLELKLWQPLIDLLPTLNKQALISPEDAEQMHQRAQCGLL 235

Query: 234 LENADKGDMIASYHDAI---ESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
            + A +                +K   + +    C AK LI++    +A  ++++  K +
Sbjct: 236 ADVAGQQGSEGLIKHWNTLPRKVKQDPHLV---ACFAKQLIARKADHEALTVIKEALKKS 292

Query: 291 PHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           P PE+  +   L   +    +    +  + +  + E+   ++++    G   QA +    
Sbjct: 293 PSPELYALLPQLNLSDVHPVIVMLEQNVKNDNHNAEAHSALAQLYFREGKWPQAQSHFET 352

Query: 351 AMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALH 387
           A+K+      +  LA   +  + N       ++ AL 
Sbjct: 353 ALKVRSSVSDYAFLADALEKQNLNKA-AHEVSRKALT 388


>gi|320154941|ref|YP_004187320.1| HemY-like protein [Vibrio vulnificus MO6-24/O]
 gi|319930253|gb|ADV85117.1| HemY-like protein [Vibrio vulnificus MO6-24/O]
          Length = 393

 Score = 96.5 bits (239), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 62/397 (15%), Positives = 129/397 (32%), Gaps = 19/397 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RLI  F V+   +      S     V I+  N     S   ++  +   L     L  
Sbjct: 1   MIRLIFLFVVLGAGLFVGTQFSGQQGYVLISIANTTIEMSVTTLVIFIVAALAGLFGLEY 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  L      ++    R   +  +    G++ +   +   A K  +  +  H      
Sbjct: 61  LVKKVLYTGFTTWNWFSVRKMRRSRRYTNEGIIKLLEGDWKGAEKKVTRWASHH--DMPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAV---YSLYFESCRIGDLNSAQRYA 177
           L YL+  + A  +       +    +         AV    S   +  R G+   A    
Sbjct: 119 LCYLVASEAADGQGDRAK-RDHYLALAAEQENAYLAVELTRS--KQLVREGEFALAFDSL 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFL----NQKKKNAKEWNRNRAILLIARS 233
                  P+ P V   +   Y+  K W   I  L     Q   + ++  +          
Sbjct: 176 QSLKGRYPNNPIVLNLLKTTYLELKLWQPLIDLLPTLNKQALISPEDAEQMHQRAQCGLL 235

Query: 234 LENADKGDMIASYHDAI---ESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
            + A +                +K   + +    C AK LI++    +A  ++++  K +
Sbjct: 236 ADVAGQQGSEGLIKHWNTLPRKVKQNPHLV---ACFAKQLIARKADHEALTVIKEALKKS 292

Query: 291 PHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           P PE+  +   L   +    +    +  + +  + E+   ++++    G   QA +    
Sbjct: 293 PSPELYALLPQLNLSDVHPVIVMLEQNVKNDNHNAEAHSALAQLYFREGKWPQAQSHFET 352

Query: 351 AMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALH 387
           A+K+      +  LA   +  + N       ++ AL 
Sbjct: 353 ALKVRSSVSDYAFLADALEKQNLNKA-AHEVSRKALT 388


>gi|78484460|ref|YP_390385.1| HemY-like [Thiomicrospira crunogena XCL-2]
 gi|78362746|gb|ABB40711.1| HemY-like [Thiomicrospira crunogena XCL-2]
          Length = 391

 Score = 96.5 bits (239), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 67/388 (17%), Positives = 130/388 (33%), Gaps = 21/388 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M +++++ F + +      +  +    VS+ W + +  TS    L+ +     +  LL  
Sbjct: 1   MSKILKWSFFLLIATGLTSLALYDNGQVSMVWNDWVIETSLSFALAAVVVIFGSVYLLMR 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +       PA   +    + Y+K   ++  GL+++   +  +A K    +++Q    +  
Sbjct: 61  LLISVWHFPAYWRNRQQLKRYNKAETSISKGLIALEYGDWQMAEKHLIKMAKQ---SDAG 117

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVY---SLYFES-CRIGDLNSAQRY 176
           L++ L    A        A  + E  L     R    Y    L           + A   
Sbjct: 118 LIHYLTA--AKMAHN-QGALTRREQYLNEARKRFPQDYVTIGLVESRLLANEQPDMALVI 174

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLEN 236
             +    +P    +    VQ     K+W      L Q KK           L I      
Sbjct: 175 LAELHQQNPKNRPILSEYVQLLEQQKQWQTLEGLLGQIKKIRAMDKAALQALEIRLIAGK 234

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRK---AEVILE---KIWKVN 290
             K + +       +SL      + A I A          ++   AE+I++   K W   
Sbjct: 235 VAKAENLDVLDTLWKSLSAKQQLMPA-ILAEFVEQRMGWGKEQGLAELIVKSVSKQWDDR 293

Query: 291 PHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
               +   Y  +       +LKRA +  +   ++   L+ + ++A       QA      
Sbjct: 294 ----LVYQYGRIELGPAFERLKRAEKWLKGQDDNPVLLLTLGRLACMSQLWGQAKHYFQQ 349

Query: 351 AMKIAPRKEIFLLLAQIEQANSHNTDKI 378
           ++ + P  E F  LA+  +A    T   
Sbjct: 350 SLTLQPELETFHALAKCYEAEGLETQAA 377


>gi|27364540|ref|NP_760068.1| HemY-like protein [Vibrio vulnificus CMCP6]
 gi|27360659|gb|AAO09595.1| HemY-like protein [Vibrio vulnificus CMCP6]
          Length = 393

 Score = 96.2 bits (238), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 62/397 (15%), Positives = 129/397 (32%), Gaps = 19/397 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RLI  F V+   +      S     V I+  N     S   ++  +   L     L  
Sbjct: 1   MIRLIFLFVVLGAGLFVGTQFSGQQGYVLISIANTTIEMSVTTLVIFIVAALAGLFGLEY 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  L      ++    R   +  +    G++ +   +   A K  +  +  H      
Sbjct: 61  LVKKVLYTGFTTWNWFSVRKMRRSRRYTNEGIIKLLEGDWKGAEKKVTRWANHH--DMPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAV---YSLYFESCRIGDLNSAQRYA 177
           L YL+  + A  +       +    +         AV    S   +  R G+   A    
Sbjct: 119 LCYLVASEAADGQGDKAK-RDHYLALAAEQENAYLAVELTRS--KQLVREGEFALAFDSL 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFL----NQKKKNAKEWNRNRAILLIARS 233
                  P+ P V   +   Y+  K W   I  L     Q   + ++  +          
Sbjct: 176 QSLKGRYPNNPIVLNLLKTTYLELKLWQPLIDLLPTLNKQALISPEDAEQMHQRAQCGLL 235

Query: 234 LENADKGDMIASYHDAI---ESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
            + A +                +K   + +    C AK LI++    +A  ++++  K +
Sbjct: 236 ADVAGQQGSEGLIKHWNTLPRKVKQDPHLV---ACFAKQLIARKADHEALTVIKEALKKS 292

Query: 291 PHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           P PE+  +   L   +    +    +  + +  + E+   ++++    G   QA +    
Sbjct: 293 PSPELYALLPQLNLSDVHPVIVMLEQNVKNDNHNAEAHSALAQLYFREGKWPQAQSHFET 352

Query: 351 AMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALH 387
           A+K+      +  LA   +  + N       ++ AL 
Sbjct: 353 ALKVRSSVSDYAFLADALEKQNLNKA-AHEVSRKALT 388


>gi|254508815|ref|ZP_05120926.1| HemY protein [Vibrio parahaemolyticus 16]
 gi|219548272|gb|EED25286.1| HemY protein [Vibrio parahaemolyticus 16]
          Length = 392

 Score = 96.2 bits (238), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 58/382 (15%), Positives = 130/382 (34%), Gaps = 18/382 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R+I  F ++   + +    +     V I+  N+    S   ++  +   L     L  
Sbjct: 1   MFRIIFLFVILGAGLFAGTQYAGQQGYVLISIANKTIEMSVTTLVIFIIAALATLFALEF 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
             +  LS  +  ++    R   +  +    G++ +   +  LA K  +  +  H      
Sbjct: 61  FIKKALSASSATWNWFSVRKMRRSRRYTNEGIIKLLEGDFKLAEKKVTRWANHH--DMPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAV---YSLYFESCRIGDLNSAQRYA 177
           L YL+  + A    + +   ++   +         AV        +  R  D  +A    
Sbjct: 119 LCYLVASEAAQGMGESDK-RDRYLELASQQENSLLAVELTR--AKQQVRESDFTAALETL 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAIL-------LI 230
           T      P    V   +   Y+  K W   +  L    K        +A L       L+
Sbjct: 176 TTLKASYPTNTIVLNLLKSVYIELKLWQPLLDALPNLVKAKIISKDEQAQLTQRAQCGLL 235

Query: 231 ARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
           A   E      +++ +++    LK   + +    C AK LIS+    +A  ++++  K +
Sbjct: 236 AEVAEQKGSEGLVSHWNNLPRKLKSDSHLVE---CFAKQLISRKADNEAFTLIKENIKKH 292

Query: 291 PHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           P+  +  +   +   ++   +     +   +  + E+   +++  L      +A      
Sbjct: 293 PNSSLYALLPEMNLADSHPAIVFLETVLNKDGNNAEAHSALAQFHLRNEKWSEAQQHLEK 352

Query: 351 AMKIAPRKEIFLLLAQIEQANS 372
           A+ + P    +  LA   +  +
Sbjct: 353 ALSLRPNVSDYAYLADALEKQN 374


>gi|300115113|ref|YP_003761688.1| HemY domain-containing protein [Nitrosococcus watsonii C-113]
 gi|299541050|gb|ADJ29367.1| HemY domain protein [Nitrosococcus watsonii C-113]
          Length = 430

 Score = 95.0 bits (235), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 61/396 (15%), Positives = 138/396 (34%), Gaps = 17/396 (4%)

Query: 2   LRLIRYFFVISLVICSFIIVS-HYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++ + +  ++ ++     +++      + I +G  +  T+  + + +L        L   
Sbjct: 1   MKAVIFGLIVLILAAGLELLTHDDSGYLVIGYGQWMIETTLTLAVIVLGLAFIGGYLALR 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
                   P  L     +R   +  K L  GL+ I   N   A +  + V      +   
Sbjct: 61  FISHIGKTPRRLGKTRQRRRSSRASKMLIEGLIDIEEGNWDRAER--ALVKDIAYSNTPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQI--PATREFAVYSLYFESCRIGDLNSAQRYAT 178
           L Y+   + A  +  Y    +    + +   PA       +        G    A     
Sbjct: 119 LNYIAAARSAQNQGAYER-RDHYLRLAREAVPAATFAVELTQAELQVNSGQFEQALAILN 177

Query: 179 KALDISPDAPWVTEAVVQQYVLAKEWSRAITFL----NQKKKNAKEWNRNRAIL---LIA 231
               + P        +   Y+  ++W++ +  L     ++  N +E +    +    L+ 
Sbjct: 178 HLRTLDPRHSQPLRLLKSLYLQQRDWNQLLGLLPQLCKRRLVNKEEAHSLEVMAHVELLQ 237

Query: 232 RSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
            + +N     +I  +       +     + A + A   LI +N++  AE +L+   K N 
Sbjct: 238 EAAQNESDAALIDRWKAVPNRFRKHPKIVAAYVYA---LIDRNEQDLAEQLLQDTLKGNW 294

Query: 292 HPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLA 351
             E+  +Y  + S + V +L RA         +   L+ + ++A   G   +A      +
Sbjct: 295 SDELIYLYGLVQSSDLVAQLARAEAWLSQQGNNPWLLLTLGRLAQHNGLWGKARQYLETS 354

Query: 352 MKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALH 387
           +  APR E +  L ++ +    +++  L      L 
Sbjct: 355 IAYAPRSEAYRELGKVLE-EIGDSEAALECYSKGLS 389


>gi|121997819|ref|YP_001002606.1| HemY domain-containing protein [Halorhodospira halophila SL1]
 gi|121589224|gb|ABM61804.1| HemY domain protein [Halorhodospira halophila SL1]
          Length = 441

 Score = 95.0 bits (235), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 62/388 (15%), Positives = 126/388 (32%), Gaps = 17/388 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M RL  Y  +++  + + +  +     V ++ G      S      +L   +    L  A
Sbjct: 1   MRRLFIYLLILAGAVLTALYFNQQEGYVMLSIGPWRLEMSLLFSAVVLGLLVLLLYLALA 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
                 S P  L     +R  +     L +GL+  A  +   A +   + +++       
Sbjct: 61  ALGRLWSMPRRLRSWQGQRRQESARTELTSGLLRFAEGDYDTAEQQLVHSARR---SEAP 117

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATRE-FAVYSLYFESCRI-GDLNSAQRYAT 178
           LV  L   IA   R      +      +        AV  L  +     G    AQ   +
Sbjct: 118 LVNYLTAAIAAQRRGAREVRDGYLTTAEKSGPDANLAVRLLQAQLQAESGQWEEAQASVS 177

Query: 179 KALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENAD 238
             LD  P      E +V       +W R    L + ++           L    + E   
Sbjct: 178 AVLDKEPKHRRALELMVGCCRALGDWERLEPLLPRIERQGILPKNELTELNRWVARERLA 237

Query: 239 KG---DMIASYHDAIE---SLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPH 292
           +    D  A      E    L+   + I + +     L +  + + A  +++K      +
Sbjct: 238 QAAGEDTQALQEAWRELSRGLRKDPDVICSYV---DGLTTLGEVQSAVELIQKQLHKEWN 294

Query: 293 PEIANIYTHLLSENT---VGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAM 349
           P++   Y  L +++      +L++A    E +++  ++L     +AL+    ++      
Sbjct: 295 PDLLQRYARLPADDIDTYAARLEKAEGWIEAHRDDPKALYAAGVLALQAEQWERGRDYLQ 354

Query: 350 LAMKIAPRKEIFLLLAQIEQANSHNTDK 377
            A+    R E    L  +++        
Sbjct: 355 AAVDQTARPEYLRTLGALQEHLGDYDGA 382


>gi|226326703|ref|ZP_03802221.1| hypothetical protein PROPEN_00556 [Proteus penneri ATCC 35198]
 gi|225204924|gb|EEG87278.1| hypothetical protein PROPEN_00556 [Proteus penneri ATCC 35198]
          Length = 388

 Score = 94.2 bits (233), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 64/379 (16%), Positives = 131/379 (34%), Gaps = 23/379 (6%)

Query: 1   MLRLIR-YFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLF 59
           ML+++  +  +I+ +I    +++ +   V I   +    TS   ++ +      A +L+ 
Sbjct: 1   MLKILLLFVVLIAGIIFG-PLLAGHQGYVLIQTDDWDIETSVTSLVIMFVLLQLALLLIG 59

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
              R F+   +  +     R  ++  K     LM +A  +     K+ S  +        
Sbjct: 60  WSYRRFIGTGSKAYSWFSFRKRNRARKQTSMALMKLAEGDFKEVEKLMSRNA--DYAEQP 117

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPAT-----REFAVYSLYFESCRIGDLNSAQ 174
            + YLL  + A          + LE   ++  T         V  L  +     + ++A+
Sbjct: 118 VVNYLLAAEAAQQRGDEFRVQQHLERAAELADTNQLPVDITRVRILLAQ----NENHAAR 173

Query: 175 RYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWN------RNRAIL 228
               + L+ +P  P V       Y     W   +  +   +K A   +      R +A +
Sbjct: 174 TGVDELLNQAPRHPEVLRLAETAYTRTAAWQALLDIIPSMQKIALHTDDELAQLRQKAYI 233

Query: 229 LIARSLENADKGDMIASYHDAIESLKLCDNSIMAS-ICAAKSLISQNKKRKAEVILEKIW 287
            I     + +  D      +  ++     +   A  +  A+ LI  N    A+ I+    
Sbjct: 234 GIMGQKMSENGCD---GLKNWWKAQPRKVHHDNALRVVLAEHLIECNDPDSAQTIILDGI 290

Query: 288 KVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAK 347
           K      +  +   L + +    LK    L + +  +      + +IA++ G   QA   
Sbjct: 291 KRQYDERLILLLPRLKNTDASVILKVLNSLIKQHGPTPLLNSTLGQIAMQQGQWGQAEEA 350

Query: 348 AMLAMKIAPRKEIFLLLAQ 366
              A+K  P    F  LA 
Sbjct: 351 FRNALKQRPDVHDFAWLAD 369


>gi|328472408|gb|EGF43274.1| HemY protein [Vibrio parahaemolyticus 10329]
          Length = 393

 Score = 94.2 bits (233), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 53/380 (13%), Positives = 121/380 (31%), Gaps = 14/380 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RLI  F V+   + +    S     V I+  N+    S   ++  +   L    LL  
Sbjct: 1   MIRLIFLFVVLGAGLFAGTQFSGQQGYVLISIANKTIEMSVTTLVIFVIAALAGLFLLEY 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +   +  ++    R   +  +    G++ +   +   A K  +  +  H      
Sbjct: 61  LIKKLVYASSSTWNYFSVRKMRRSRRYTNEGIIKLLEGDWKGAEKKVTRWANHH--DMPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAV---YSLYFESCRIGDLNSAQRYA 177
           L YL+  + A  +       +    +         AV        +  R  +  +A    
Sbjct: 119 LCYLVASEAAQGQGDKAK-RDHYLALASQQENAHLAVELTR--AKQFIRDNEFEAAFDTL 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENA 237
                  P+   V   +   Y+  K W   I  + Q  K        +A L+        
Sbjct: 176 QSLKGQYPNNSIVLNLLKTTYMQLKLWQPLIDLMPQLAKAKLVTEEEQAELIQKAQCGLL 235

Query: 238 DKGDMIASYHDAIE-----SLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPH 292
            +          I      + K+  ++ + +  A + +  +    +A  +L++  K  P 
Sbjct: 236 HEVAQQQGSEGLISHWNSLARKVRQDTHLIACFARELIARKADT-EAFTVLKEALKKQPE 294

Query: 293 PEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAM 352
           PE+  +   L   +    +     + +   ++  +   ++          QA     +A+
Sbjct: 295 PELYQLLPDLNLPDIHPVVVFLEGVVKKEADNAAAHSALAHFYFRQEKWQQAQEHFEIAL 354

Query: 353 KIAPRKEIFLLLAQIEQANS 372
           K+      +  LA   +  +
Sbjct: 355 KLRSDVSDYAFLADTLEKQN 374


>gi|206580430|ref|YP_002241135.1| HemY protein [Klebsiella pneumoniae 342]
 gi|288937775|ref|YP_003441834.1| HemY protein [Klebsiella variicola At-22]
 gi|290513170|ref|ZP_06552532.1| hemY protein [Klebsiella sp. 1_1_55]
 gi|206569488|gb|ACI11264.1| HemY protein [Klebsiella pneumoniae 342]
 gi|288892484|gb|ADC60802.1| HemY protein [Klebsiella variicola At-22]
 gi|289774381|gb|EFD82387.1| hemY protein [Klebsiella sp. 1_1_55]
          Length = 398

 Score = 93.5 bits (231), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 56/370 (15%), Positives = 107/370 (28%), Gaps = 21/370 (5%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I   N    TS   ++ IL   +     +  + R      A        R 
Sbjct: 21  IAGHQGYVLIQTDNYNIETSVTGLVIILILAMVVLFAIEWLLRRIFRTGAHTRGWFVGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A        A+
Sbjct: 81  RRRARKQTEQALLKLAEGDYQQVEKLMAKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 138

Query: 141 EKLEM--------MLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
           + LE         ++ +  TR               + ++A+    K L+I+P  P V  
Sbjct: 139 QHLERATELAGDDLIPVEITRV-------RLQLARNENHAARHGIDKLLEITPRHPEVLR 191

Query: 193 AVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADK----GDMIASYHD 248
              Q Y     W   +  +    K       +RA L     +   DK    G        
Sbjct: 192 LAEQAYTRTGAWQSLLDIIPSMAKANVGDEEHRAALEQLAWVGLMDKALADGGSEGLREW 251

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
                +     +   +  A+ LI  +    A+ I+    K      +      L + N  
Sbjct: 252 WRNQSRKTRALVPLQVAMAERLIESDDHDTAQQIIIDGLKKQYDDRLVMPIPRLKTNNPE 311

Query: 309 GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIE 368
              K   +  +   +       + +  +  G   +A      A+K  P    +  LA   
Sbjct: 312 QLEKVLRQQIKAVGDRPLLWSTLGQSLMRHGEWQEASIAFRAALKQRPDAFDYAWLADAL 371

Query: 369 QANSHNTDKI 378
                  +  
Sbjct: 372 DRLHQPEEAA 381


>gi|238892402|ref|YP_002917136.1| putative protoheme IX biogenesis protein [Klebsiella pneumoniae
           NTUH-K2044]
 gi|238544718|dbj|BAH61069.1| hypothetical protein KP1_0160 [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
          Length = 398

 Score = 93.5 bits (231), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 56/370 (15%), Positives = 107/370 (28%), Gaps = 21/370 (5%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I   N    TS   ++ IL   +     +  + R      A        R 
Sbjct: 21  IAGHQGYVLIQTDNYNIETSVTGLVIILILAMVVLFAIEWLLRRIFRTGAHTRGWFVGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A        A+
Sbjct: 81  RRRARKQTEQALLKLAEGDYQQVEKLMAKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 138

Query: 141 EKLEM--------MLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
           + LE         ++ +  TR               + ++A+    K L+I+P  P V  
Sbjct: 139 QHLERATELAGDDLIPVEITRV-------RLQLARNENHAARHGIDKLLEITPRHPEVLR 191

Query: 193 AVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADK----GDMIASYHD 248
              Q Y     W   +  +    K       +RA L     +   DK    G        
Sbjct: 192 LAEQAYTRTGAWQSLLDIIPSMAKANVGDEAHRAALEQLAWVGLMDKALADGGSEGLREW 251

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
                +     +   +  A+ LI  +    A+ I+    K      +      L + N  
Sbjct: 252 WRNQSRKTRALVPLQVAMAERLIESDDHDTAQQIIIDGLKKQYDDRLVMPIPRLKTNNPE 311

Query: 309 GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIE 368
              K   +  +   +       + +  +  G   +A      A+K  P    +  LA   
Sbjct: 312 QLEKVLRQQIKAVGDRPLLWSTLGQSLMRHGEWQEASIAFRAALKQRPDAFDYAWLADAL 371

Query: 369 QANSHNTDKI 378
                  +  
Sbjct: 372 DRLHQPEEAA 381


>gi|197287142|ref|YP_002153014.1| protoheme IX biogenesis protein [Proteus mirabilis HI4320]
 gi|227357165|ref|ZP_03841534.1| possible porphoryin biosynthesis protein HemY [Proteus mirabilis
           ATCC 29906]
 gi|194684629|emb|CAR46529.1| putative porphyrin biosynthesis protein [Proteus mirabilis HI4320]
 gi|227162697|gb|EEI47664.1| possible porphoryin biosynthesis protein HemY [Proteus mirabilis
           ATCC 29906]
          Length = 409

 Score = 93.5 bits (231), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 64/394 (16%), Positives = 134/394 (34%), Gaps = 27/394 (6%)

Query: 1   MLRLIR-YFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLF 59
           M +++  +  +I+ +I   + ++ +   V I   N    TS   ++ +        +LL 
Sbjct: 1   MFKILLLFVVLIAGIIFGPV-LAGHQGYVFIQTDNWDIETSVTSLVIMFVLLQLILLLLG 59

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
              R F+   +  +     R   +  K     LM +A  +     K+ S  +        
Sbjct: 60  WCYRRFIGTGSKAYSWFSLRKRSRARKQTRLALMKLAEGDFKQVEKLMSRNA--DYAEQP 117

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPAT-----REFAVYSLYFESCRIGDLNSAQ 174
            + YLL  + A          + LE   ++  T         V  L  +     + ++A+
Sbjct: 118 VVNYLLAAEAAQQRGDEFRVQQHLERASELADTNQLPVDITRVRILLAQ----NENHAAR 173

Query: 175 RYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWN------RNRAIL 228
               + L+  P  P V       Y+  + W   +  +   +K A   +      R +A +
Sbjct: 174 TGVDELLNQVPRHPEVLRLAETAYIRTEAWQALLDIIPSMQKIALHTDDELEQLRQQAYI 233

Query: 229 LIARSLENADKGDMIASYHDAIE---SLKLCDNSIMASICAAKSLISQNKKRKAEVILEK 285
            +     + +  D + ++  A             +      A+ LI  N  + A+ I+  
Sbjct: 234 GLMGQKMSENGCDGLKNWWKAQPRKIQHDNGLRFV-----LAEHLIECNDPQTAQTIILD 288

Query: 286 IWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAH 345
             K +    +  +   L + +    LK    L + +  +      V +IA++ G   QA 
Sbjct: 289 GIKRHYDERLILLLPRLKNSDPDSILKVLNSLIKQHGPTPLLNSTVGQIAMQQGQWAQAE 348

Query: 346 AKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKIL 379
                A+K  P    F  LA +    + + +   
Sbjct: 349 TAFRNALKQRPDVHDFAWLADVLDKQNKSVESAK 382


>gi|28899765|ref|NP_799370.1| HemY protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|260365167|ref|ZP_05777732.1| HemY protein [Vibrio parahaemolyticus K5030]
 gi|260878133|ref|ZP_05890488.1| HemY protein [Vibrio parahaemolyticus AN-5034]
 gi|260895810|ref|ZP_05904306.1| HemY protein [Vibrio parahaemolyticus Peru-466]
 gi|260900857|ref|ZP_05909252.1| HemY protein [Vibrio parahaemolyticus AQ4037]
 gi|28808017|dbj|BAC61254.1| HemY protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|308087172|gb|EFO36867.1| HemY protein [Vibrio parahaemolyticus Peru-466]
 gi|308092785|gb|EFO42480.1| HemY protein [Vibrio parahaemolyticus AN-5034]
 gi|308110581|gb|EFO48121.1| HemY protein [Vibrio parahaemolyticus AQ4037]
 gi|308111031|gb|EFO48571.1| HemY protein [Vibrio parahaemolyticus K5030]
          Length = 393

 Score = 93.5 bits (231), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 55/380 (14%), Positives = 122/380 (32%), Gaps = 14/380 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RLI  F V+   +      S     V I+  N+    S   ++  +   L    LL  
Sbjct: 1   MIRLIFLFVVLGAGLFVGTQFSGQQGYVLISIANKTIEMSVTTLVIFVIATLAGLFLLEY 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +   +  ++    R   +  +    G++ +   +   A K  +  +  H      
Sbjct: 61  LIKKLVYASSSTWNYFSVRKMRRSRRYTNEGIIKLLEGDWKGAEKKVTRWANHH--DMPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAV---YSLYFESCRIGDLNSAQRYA 177
           L YL+  + A  +       +    +         AV        +  R  +  +A    
Sbjct: 119 LCYLVASEAAQGQGDKAK-RDHYLALASQQENAHLAVELTR--AKQFIRDNEFEAAFDTL 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENA 237
                  P+   V   +   Y+  K W   I  + Q  K        +A L+        
Sbjct: 176 QSLKGQYPNNSIVLNLLKTTYMQLKLWQPLIDLMPQLAKAKLVTEEEQAELIQKAQCGLL 235

Query: 238 DKGDMIASYHDAIE-----SLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPH 292
            +          I      + K+  ++ + +   A+ LI++    +A  +L++  K  P 
Sbjct: 236 HEVAQQQGSEGLISHWNSLARKVKQDTHLIACF-ARDLIARKADTEAFTVLKEALKKQPE 294

Query: 293 PEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAM 352
           PE+  +   L   +    +     + +   ++  +   ++          QA     +A+
Sbjct: 295 PELYQLLPDLNLPDIHPVVVFLEGVVKKEADNAAAHSALAHFYFRQEKWQQAQEHFEIAL 354

Query: 353 KIAPRKEIFLLLAQIEQANS 372
           K+      +  LA   +  +
Sbjct: 355 KLRSDVSDYAFLADTLEKQN 374


>gi|262040888|ref|ZP_06014114.1| porphoryin biosynthesis protein HemY [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259041777|gb|EEW42822.1| porphoryin biosynthesis protein HemY [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 398

 Score = 93.1 bits (230), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 56/370 (15%), Positives = 107/370 (28%), Gaps = 21/370 (5%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I   N    TS   ++ IL   +     +  + R      A        R 
Sbjct: 21  IAGHQGYVLIQTDNYNIETSVTGLVIILILAMVVLFAIEWLLRRIFRTGAHTRGWFVGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A        A+
Sbjct: 81  RRRARKQTEQALLKLAEGDYQQVEKLMAKNADHA--EQPVVNYLLAAKAAQQRGDEARAN 138

Query: 141 EKLEM--------MLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
           + LE         ++ +  TR               + ++A+    K L+I+P  P V  
Sbjct: 139 QHLERATELAGDDLIPVEITRV-------RLQLARNENHAARHGIDKLLEITPRHPEVLR 191

Query: 193 AVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADK----GDMIASYHD 248
              Q Y     W   +  +    K       +RA L     +   DK    G        
Sbjct: 192 LAEQAYTRTGAWQSLLDIIPSMAKANVGDEAHRAALEQLAWVGLMDKALADGGSEGLREW 251

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
                +     +   +  A+ LI  +    A+ I+    K      +      L + N  
Sbjct: 252 WRNQSRKTRALVPLQVAMAERLIESDDHDTAQQIIIDGLKKQYDDRLVMPIPRLKTNNPE 311

Query: 309 GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIE 368
              K   +  +   +       + +  +  G   +A      A+K  P    +  LA   
Sbjct: 312 QLEKVLRQQIKAVGDRPLLWSTLGQSLMRHGEWQEASIAFRAALKQRPDAFDYAWLADAL 371

Query: 369 QANSHNTDKI 378
                  +  
Sbjct: 372 DRLHQPEEAA 381


>gi|153214862|ref|ZP_01949670.1| hemY protein [Vibrio cholerae 1587]
 gi|124115105|gb|EAY33925.1| hemY protein [Vibrio cholerae 1587]
          Length = 398

 Score = 93.1 bits (230), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 60/382 (15%), Positives = 115/382 (30%), Gaps = 18/382 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFV-ILSILYFFLFAWILLF 59
           M+RLI  F V+ L +      +     V I+  NR    S    ++ I+      + L F
Sbjct: 1   MIRLIFLFVVLGLGLFVGTQYAGQQGYVLISIANRTIEMSVTTLVIFIIGALAALFALEF 60

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
            V +   +      +    R   +  +    G++ +   +   A K  +  +  H     
Sbjct: 61  LVKKILYTSFHTW-NWFSVRKQRRSRRYTNEGIIKLLEGDWTQAEKKVTRWANHH--DMP 117

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCR--IGDLNSAQRYA 177
            L YL+  + A          +    +         AV  L     +   GD  +A    
Sbjct: 118 LLCYLVASEAANGMGDRAK-RDHYLALAAQQNNSTLAVE-LTRAKQQLGDGDNQAALETL 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENA 237
           T+     P    V   + Q Y    EW   +  L +  K  +  N     L I       
Sbjct: 176 TQLQRNHPHNTVVLNLLKQCYQALGEWQPLLALLPKLVKAKRLSNEEAQHLEITAQRGIL 235

Query: 238 DKGDMIASYHDAIE-------SLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
                       ++        LK     +M  I     LI +    +A  ++++  K  
Sbjct: 236 QDIASQKGSEGLMQHWAQLSRKLKAEPELLMCFIT---QLIQRKADYEAFSMIKESLKKQ 292

Query: 291 PHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
             PE+  +   L   +    +         +  + E+   + ++ L       A      
Sbjct: 293 ATPELYALLPELNISDRHPLIALLQEALRRDGNNAEAHSALGQLYLREKHWADAQKHLEK 352

Query: 351 AMKIAPRKEIFLLLAQIEQANS 372
           A+ +      +  LA   +  +
Sbjct: 353 ALSLRSSVSDYAYLADALEKQN 374


>gi|330812533|ref|YP_004356995.1| heme biosynthesis protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327380641|gb|AEA71991.1| putative heme biosynthesis protein [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 415

 Score = 92.7 bits (229), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 69/391 (17%), Positives = 140/391 (35%), Gaps = 19/391 (4%)

Query: 1   MLRL-IRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLF 59
           M RL +  F VI+      + ++ +   V + + N  Y    +V L+++      W  L 
Sbjct: 1   MKRLYVILFVVIAAAALLGVAIAEHSGYVLVAYKNFRYEAGLWVTLALVAVLWLLWRGLR 60

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARK-MHSYVSQQHTFHN 118
           A+     +   ++     +    +   A+  G + +A      A++ +H     +     
Sbjct: 61  ALIGLVTTSSGVVNPWSRRNRSRRVQVAIEHGQLDLAEGRWASAQRHLHRAAEAER---Q 117

Query: 119 EYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCR-IGDLNSAQRYA 177
             L YL   + A  +  Y  +   LE  L+     E A+   + +     GD + A    
Sbjct: 118 PLLYYLGAARAANEQGLYEQSDSLLERALERQPQAELAIALTHAQLQTDRGDTDGALTTL 177

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAIL--------L 229
               +  P    V   + + +    +WS  I  L + +K+        A L        L
Sbjct: 178 QAMHERHPHNVQVLRQLQRLHQQRGDWSALIRLLPELRKDKVLPPAELAELERRAWGENL 237

Query: 230 IARSLENADKGDMIASYHDAIESLKLCDNSIMASICA-AKSLISQNKKRKAEVILEKIWK 288
              +    D    + S + A + L        A + A A+ L     + +AE +L    K
Sbjct: 238 TLAAHREEDGSVGLQSLNRAWQQLTSAQRQESALVLAYAEQLRQLGAQVEAEEVLRSALK 297

Query: 289 VNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKA 348
            +    +A +Y  +   + V +L+ A    + +      L+ + ++ L+     +A    
Sbjct: 298 RHYDSHLARLYGLVRGNDPVRQLQTAEGWLKDHPADPSLLLTLGRLCLQSSLWGKARDYL 357

Query: 349 MLAMKI----APRKEIFLLLAQIEQANSHNT 375
             ++++        E+  LLAQ+  A   N 
Sbjct: 358 ESSLRVQRNPEACAELARLLAQLGDAERSNQ 388


>gi|149928340|ref|ZP_01916581.1| putative enzyme of heme biosynthesis [Limnobacter sp. MED105]
 gi|149822925|gb|EDM82170.1| putative enzyme of heme biosynthesis [Limnobacter sp. MED105]
          Length = 396

 Score = 92.3 bits (228), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 48/362 (13%), Positives = 109/362 (30%), Gaps = 10/362 (2%)

Query: 28  VSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKA 87
           V I +G      S    ++ +        ++    R     P         R  +   +A
Sbjct: 28  VLIFFGQYRIDMSLNFAVAAILLLFLVLYVMMRAWRASSQLPGKFKEYWMNRKQNALLRA 87

Query: 88  LYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKL---E 144
              GL+++   +   A K  +  S+     +  L YL+    A+   +Y++A E L   +
Sbjct: 88  NTQGLIALITGDEQGAHKALNQASKTGIETD--LSYLIRAMSAMQADRYDVAEEILNQEK 145

Query: 145 MMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEW 204
             +   +     +      +    D + A         ++   P V    +   +    W
Sbjct: 146 AKVGEHSHALVVLRG--KVALSKQDFSGALGMLEAMDPLAAKLPQVQRLRMLALMGLGRW 203

Query: 205 SRAITFLNQ--KKKNAKEWNRNRAILLIARSLENADKGDMIASYHDAIESLKLCDNSIMA 262
             A+                +N A++ I   L      D          +  +   ++  
Sbjct: 204 QDALVQYRACVAVSALTNGEKNEALMRIYAGLGENAGQDASKMQEVLSNAKPVELENVGV 263

Query: 263 SICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINK 322
               A  L+       A  +LE     N + ++  +Y  +        L    RL   + 
Sbjct: 264 LRMLATGLLRTGLITAARTLLETALNQNYNKDLLPVYHQVSVLEPREALPNVERLLAQHP 323

Query: 323 ESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWT 382
             +  L + + +        +A ++        P   +   L ++ +A +   ++   W 
Sbjct: 324 ADLRLLELAADVCEREQLWGKAISRFEAVYAKQPSAHVAGKLERLYEAANQG-ERAKAWR 382

Query: 383 QS 384
           + 
Sbjct: 383 EK 384


>gi|254291926|ref|ZP_04962707.1| hemY protein [Vibrio cholerae AM-19226]
 gi|150422136|gb|EDN14102.1| hemY protein [Vibrio cholerae AM-19226]
          Length = 398

 Score = 92.3 bits (228), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 60/382 (15%), Positives = 115/382 (30%), Gaps = 18/382 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFV-ILSILYFFLFAWILLF 59
           M+RLI  F V+ L +      +     V I+  NR    S    ++ I+      + L F
Sbjct: 1   MIRLIFLFVVLGLGLFVGTQYAGQQGYVLISIANRTIEMSVTTLVIFIIGALAALFALEF 60

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
            V +   +      +    R   +  +    G++ +   +   A K  +  +  H     
Sbjct: 61  LVKKILYTSFHTW-NWFSVRKQRRSRRYTNEGIIKLLEGDWTQAEKKVTRWANHH--DMP 117

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCR--IGDLNSAQRYA 177
            L YL+  + A          +    +         AV  L     +   GD  +A    
Sbjct: 118 LLCYLVASEAANGMGDRAK-RDHYLALAAQQNNSTLAVE-LTRAKQQLGDGDNQAALETL 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENA 237
           T+     P    V   + Q Y    EW   +  L +  K  +  N     L I       
Sbjct: 176 TQLQRNHPHNTVVLNLLKQCYQALGEWQPLLALLPRLVKAKRLSNEEAQQLEITAQRGIL 235

Query: 238 DKGDMIASYHDAIE-------SLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
                       ++        LK     +M  I     LI +    +A  ++++  K  
Sbjct: 236 QDIASQKGSEGLMQHWAQLSRKLKAEPELLMCFIT---QLIQRKADYEAFSMIKESLKKQ 292

Query: 291 PHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
             PE+  +   L   +    +         +  + E+   + ++ L       A      
Sbjct: 293 ATPELYALLPELNISDRHPLIALLEEALRRDGNNAEAHSALGQLYLREKHWADAQKHLEK 352

Query: 351 AMKIAPRKEIFLLLAQIEQANS 372
           A+ +      +  LA   +  +
Sbjct: 353 ALSLRSSVSDYAYLADALEKQN 374


>gi|269964922|ref|ZP_06179092.1| hemY protein [Vibrio alginolyticus 40B]
 gi|269830398|gb|EEZ84622.1| hemY protein [Vibrio alginolyticus 40B]
          Length = 393

 Score = 92.3 bits (228), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 59/386 (15%), Positives = 121/386 (31%), Gaps = 26/386 (6%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M RLI  F V+   +      S     V I+   +    S   ++  +   L    LL  
Sbjct: 1   MFRLIFLFVVLGAGLFVGTQFSGQQGYVLISIAEKTIEMSVTTLVVFVIAALAGLFLLEY 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +   +  ++    R      +    G++ +   +   A K  +  +  H      
Sbjct: 61  LIKKLVYASSTTWNYFSVRKMRHSRRYTNEGIIKLLEGDWKGAEKKVTRWANHH--DMPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L YL+  + A  +       +    +         AV  L      I D          A
Sbjct: 119 LCYLVASEAAQGQGDKAK-RDHYLELASQQENAHLAVE-LTRAKQFIRDNE-----FESA 171

Query: 181 LD--ISPDAPWVTEA-VVQQ----YVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARS 233
            D   S  + + + + V+      Y+  K W   I  L Q  K     +   A L+    
Sbjct: 172 FDTLQSLKSQYASNSIVLNLLKTTYMQLKLWQPLIDLLPQLTKAKLISDEEHAELIQKAQ 231

Query: 234 LENADKGDMIASYHDAI-------ESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKI 286
                +          I         +K   + +    C A+ LI++    +A  +L++ 
Sbjct: 232 CGLLHEVAQQQGSEGLISHWNSLSRKVKQDTHLV---ACFARELITRKADAEAFTVLKEA 288

Query: 287 WKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHA 346
            K  P PE+  +   L   +T   +     + +   ++  +   ++          +A  
Sbjct: 289 LKKQPAPELYQLLPDLNLPDTHPVVVFLEGVVKKEPDNAAAHSALAHFYFRQEKWQEAQD 348

Query: 347 KAMLAMKIAPRKEIFLLLAQIEQANS 372
              +A+K+      +  LA   +  +
Sbjct: 349 HFEIALKLRSDVSDYAFLADTLEKQN 374


>gi|153826289|ref|ZP_01978956.1| hemY protein [Vibrio cholerae MZO-2]
 gi|153830627|ref|ZP_01983294.1| hemY protein [Vibrio cholerae 623-39]
 gi|229515849|ref|ZP_04405307.1| HemY-like protein [Vibrio cholerae TMA 21]
 gi|148873899|gb|EDL72034.1| hemY protein [Vibrio cholerae 623-39]
 gi|149739957|gb|EDM54136.1| hemY protein [Vibrio cholerae MZO-2]
 gi|229347112|gb|EEO12073.1| HemY-like protein [Vibrio cholerae TMA 21]
 gi|327483018|gb|AEA77425.1| HemY protein [Vibrio cholerae LMA3894-4]
          Length = 398

 Score = 92.3 bits (228), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 60/382 (15%), Positives = 115/382 (30%), Gaps = 18/382 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFV-ILSILYFFLFAWILLF 59
           M+RLI  F V+ L +      +     V I+  NR    S    ++ I+      + L F
Sbjct: 1   MIRLIFLFVVLGLGLFVGTQYAGQQGYVLISIANRTIEMSVTTLVIFIIGALAALFALEF 60

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
            V +   +      +    R   +  +    G++ +   +   A K  +  +  H     
Sbjct: 61  LVKKILYTSFHTW-NWFSVRKQRRSRRYTNEGIIKLLEGDWTQAEKKVTRWANHH--DMP 117

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCR--IGDLNSAQRYA 177
            L YL+  + A          +    +         AV  L     +   GD  +A    
Sbjct: 118 LLCYLVASEAANGMGDRAK-RDHYLALAAQQNNSTLAVE-LTRAKQQLGDGDNQAALETL 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENA 237
           T+     P    V   + Q Y    EW   +  L +  K  +  N     L I       
Sbjct: 176 TQLQRNHPHNTVVLNLLKQCYQALGEWQPLLALLPKLVKAKRLSNEEAQQLEITAQRGIL 235

Query: 238 DKGDMIASYHDAIE-------SLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
                       ++        LK     +M  I     LI +    +A  ++++  K  
Sbjct: 236 QDIASQKGSEGLMQHWAQLSRKLKAEPELLMCFIT---QLIQRKADYEAFSMIKESLKKQ 292

Query: 291 PHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
             PE+  +   L   +    +         +  + E+   + ++ L       A      
Sbjct: 293 ATPELYALLPELNISDRHPLIALLEEALRRDGNNAEAHSALGQLYLREKHWADAQKHLEK 352

Query: 351 AMKIAPRKEIFLLLAQIEQANS 372
           A+ +      +  LA   +  +
Sbjct: 353 ALSLRSSVSDYAYLADALEKQN 374


>gi|229527141|ref|ZP_04416535.1| HemY-like protein [Vibrio cholerae 12129(1)]
 gi|229335372|gb|EEO00855.1| HemY-like protein [Vibrio cholerae 12129(1)]
          Length = 398

 Score = 91.9 bits (227), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 59/383 (15%), Positives = 115/383 (30%), Gaps = 20/383 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFV-ILSILYFFLFAWILLF 59
           M+RLI  F V+ L +      +     V I+  NR    S    ++ I+      + L F
Sbjct: 1   MIRLIFLFVVLGLGLFVGTQYAGQQGYVLISIANRTIEMSVTTLVIFIIGALAALFALEF 60

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
            V +   +      +    R   +  +    G++ +   +   A K  +  +  H     
Sbjct: 61  LVKKILYTSFHTW-NWFSVRKQRRSRRYTNEGIIKLLEGDWTQAEKKVTRWANHH--DMP 117

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAV---YSLYFESCRIGDLNSAQRY 176
            L YL+  + A          ++   +         AV        +    GD  +A   
Sbjct: 118 LLCYLVASEAANGMGDRAK-RDRYLALAAQQNNSTLAVELTR--AKQQLSDGDNQAALET 174

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLEN 236
            T+     P    V   + Q Y    EW   +  L +  K  +  N     L I      
Sbjct: 175 LTQLQRNHPHNTVVLNLLKQCYQALGEWQPLLALLPKLVKAKRLSNEEVQQLEITAQRGI 234

Query: 237 ADKGDMIASYHDAIE-------SLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
                        ++        LK     +M  I     LI +    +A  ++++  K 
Sbjct: 235 LQDIASQKGSEGLMQHWAQLSRKLKAEPELLMCFIT---QLIQRKADYEAFSMIKESLKK 291

Query: 290 NPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAM 349
              PE+  +   L   +    +         +  + E+   + ++ L       A     
Sbjct: 292 QATPELYALLPELNISDRHPLIALLEEALRRDGNNAEAHSALGQLYLRDKHWADAQKHLE 351

Query: 350 LAMKIAPRKEIFLLLAQIEQANS 372
            A+ +      +  LA   +  +
Sbjct: 352 KALSLRSSVSDYAYLADALEKQN 374


>gi|152972790|ref|YP_001337936.1| putative protoheme IX biogenesis protein [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|329997500|ref|ZP_08302802.1| hemY protein [Klebsiella sp. MS 92-3]
 gi|150957639|gb|ABR79669.1| hypothetical protein KPN_04301 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|328539068|gb|EGF65107.1| hemY protein [Klebsiella sp. MS 92-3]
          Length = 398

 Score = 91.9 bits (227), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 56/370 (15%), Positives = 107/370 (28%), Gaps = 21/370 (5%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I   N    TS   ++ IL   +     +  + R      A        R 
Sbjct: 21  IAGHQGYVLIQTDNYNIETSVTGLVIILILAMVVLFAIEWLLRRIFRTGAHTRGWFVGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A        A+
Sbjct: 81  RRRARKQTEQALLKLAEGDYQQVEKLMAKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 138

Query: 141 EKLEM--------MLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
           + LE         ++ +  TR               + ++A+    K L+I+P  P V  
Sbjct: 139 QHLERATELAGDDLIPVEITRV-------RLQLARNENHAARHGIDKLLEITPRHPEVLR 191

Query: 193 AVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADK----GDMIASYHD 248
              Q Y     W   +  +    K       +RA L     +   DK    G        
Sbjct: 192 LAEQAYTRTGAWQSLLDIIPSMAKANVGDEAHRAALEQLAWVGLMDKALADGGSEGLREW 251

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
                +     +   +  A+ LI  +    A+ I+    K      +      L + N  
Sbjct: 252 WRNQSRKTRAMVPLQVAMAERLIESDDHDTAQQIIIDGLKKQYDDRLVMPIPRLKTNNPE 311

Query: 309 GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIE 368
              K   +  +   +       + +  +  G   +A      A+K  P    +  LA   
Sbjct: 312 QLEKVLRQQIKAVGDRPLLWSTLGQSLMRHGEWQEASIAFRAALKQRPDAFDYAWLADAL 371

Query: 369 QANSHNTDKI 378
                  +  
Sbjct: 372 DRLHQPEEAA 381


>gi|77164033|ref|YP_342558.1| HemY-like [Nitrosococcus oceani ATCC 19707]
 gi|254435079|ref|ZP_05048586.1| HemY N-terminal domain protein [Nitrosococcus oceani AFC27]
 gi|76882347|gb|ABA57028.1| HemY-like protein [Nitrosococcus oceani ATCC 19707]
 gi|207088190|gb|EDZ65462.1| HemY N-terminal domain protein [Nitrosococcus oceani AFC27]
          Length = 427

 Score = 91.9 bits (227), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 66/402 (16%), Positives = 137/402 (34%), Gaps = 16/402 (3%)

Query: 2   LRLIRYFFVISLVICSFIIVS-HYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++ + +  ++ ++     +++      + I +G  +  T+  + + +L        L   
Sbjct: 1   MKAVIFGLIVLILAIGLELLTHDDSGYLVIGYGQWMIETTLTLAVIVLGLIFIGGYLALR 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
                   P  L     +R   +  K L  GL+ I   N   A +  + V      +   
Sbjct: 61  FVSHIGKAPRRLGESRQRRRSSRASKMLIEGLIDIEEGNWDRAER--ALVKDIAYSNTPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCR--IGDLNSAQRYAT 178
           L Y+   + A  +  Y    +    + +           L     +   G    A     
Sbjct: 119 LNYIAAARSAQNQGAYER-RDHYLHLAREAVPAATFAIELIQAELQVNSGQFEEALAILN 177

Query: 179 KALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENAD 238
               + P  P   + +   Y+  ++W + +  L Q  K           L +   +E   
Sbjct: 178 HLRTLDPRHPQPLKLLKSLYLQQRDWDQLLGLLLQLCKRRLVSKEEAHSLEVMAHVELLQ 237

Query: 239 KGDMIASYHDAIESLKLCDNS------IMASICAAKSLISQNKKRKAEVILEKIWKVNPH 292
           +     S    I+  K   N       I+A+   A  LI +N+   AE +L+   K N  
Sbjct: 238 EAAQSESNAALIDRWKAVPNRFRKHPKIVAAYVYA--LIDRNEHDLAEQLLQDTLKGNWS 295

Query: 293 PEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAM 352
            E+  +Y  + S + V +L RA        ++   L+ + ++A   G   +A      ++
Sbjct: 296 DELIYLYGLVQSSDLVAQLTRAEAWLSQQGDNPWLLLTLGRLAQYNGLWGKARQYLETSI 355

Query: 353 KIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALH-AMPDPL 393
             APR E +  L ++ +    +++  L      L  A    +
Sbjct: 356 AYAPRSEAYHELGKVLE-EIGDSEAALECYSKGLSMATRGAV 396


>gi|254226595|ref|ZP_04920176.1| hemY protein [Vibrio cholerae V51]
 gi|125620867|gb|EAZ49220.1| hemY protein [Vibrio cholerae V51]
          Length = 398

 Score = 91.5 bits (226), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 60/382 (15%), Positives = 115/382 (30%), Gaps = 18/382 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFV-ILSILYFFLFAWILLF 59
           M+RLI  F V+ L +      +     V I+  NR    S    ++ I+      + L F
Sbjct: 1   MIRLIFLFVVLGLGLFVGTQYAGQQGYVLISIANRTIEMSVTTLVIFIIGALAALFALEF 60

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
            V +   +      +    R   +  +    G++ +   +   A K  +  +  H     
Sbjct: 61  LVKKILYTSFHTW-NWFSVRKQRRSRRYTNEGIIKLLEGDWTQAEKKVTRWANHH--DMP 117

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCR--IGDLNSAQRYA 177
            L YL+  + A          +    +         AV  L     +   GD  +A    
Sbjct: 118 LLCYLVASEAANGMGDRAK-RDHYLALAAQQNNSTLAVE-LTRAKQQLGDGDNQAALETL 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENA 237
           T+     P    V   + Q Y    EW   +  L +  K  +  N     L I       
Sbjct: 176 TQLQRNHPHNTVVLNLLKQCYQALGEWQPLLALLPKLVKAKRLSNEEAQQLEITAQRGIL 235

Query: 238 DKGDMIASYHDAIE-------SLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
                       ++        LK     +M  I     LI +    +A  ++++  K  
Sbjct: 236 QDIASQKGSEGLMQHWAQLSRKLKAEPELLMCFIT---QLIQRKADYEAFSMIKESLKKQ 292

Query: 291 PHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
             PE+  +   L   +    +         +  + E+   + ++ L       A      
Sbjct: 293 ATPELYALLPELNISDRHPLIALLQEALRRDGNNAEAHSALGQLYLREKHWADAQKHLEK 352

Query: 351 AMKIAPRKEIFLLLAQIEQANS 372
           A+ +      +  LA   +  +
Sbjct: 353 ALSLRSSVSDYAYLADALEKQN 374


>gi|262273220|ref|ZP_06051036.1| HemY-like protein [Grimontia hollisae CIP 101886]
 gi|262222798|gb|EEY74107.1| HemY-like protein [Grimontia hollisae CIP 101886]
          Length = 395

 Score = 91.5 bits (226), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 55/397 (13%), Positives = 123/397 (30%), Gaps = 17/397 (4%)

Query: 1   MLRLIRYFFVISLVICSFII--VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILL 58
           M++++    VI+L+    +   ++     V I+  N+    S   ++ ++ F   A  +L
Sbjct: 1   MIKIL--LLVIALIAGLVVGPDLAGNQGYVLISAANQTIEMSVSTLVILVVFAFAALFIL 58

Query: 59  FAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHN 118
             + R   S  +        R   K       GL+ +   +   + K+   +   +    
Sbjct: 59  EWLIRKLFSLSSSTRGWFSGRKNKKARMLTNEGLLKLLEGDWKQSEKL--LLKGVNHSDA 116

Query: 119 EYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESC--RIGDLNSAQRY 176
             L YL   + A      +   ++             A  +L       R G    A   
Sbjct: 117 PLLNYLAAAEAAQGRGDIDN-RDRYLQQAADFGIDNLAT-ALTRAKLQYRQGQYEEALAS 174

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQ----KKKNAKEWNRNRAILLIAR 232
               +D +P  P +   +   Y+  ++W   +  +      K  +  E  R         
Sbjct: 175 LQGLVDANPRNPVLLSLLKDTYLKLQDWQALLRLMPSLKRVKAVSEAEAERLELKAECGL 234

Query: 233 SLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPH 292
               A +              +          C  K LI++    +A +IL +  K +P 
Sbjct: 235 MAHIATQKGSDGLLAHWNSLSRSARQQPKLIGCLVKQLIARKADSEAYIILRENLKKHPD 294

Query: 293 PEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAM 352
             + ++   L   +    + +   +   N+ +  +   + ++    G   +A      A+
Sbjct: 295 ESLISLVPELSLPDYHPAILKLQDVLRYNENNPVTHSALGQLYFREGKWAEARTHFEKAL 354

Query: 353 KIAPRKEIFLLLAQIEQANSHNTDK---ILYWTQSAL 386
            I P    +  L    +  +  +          + AL
Sbjct: 355 DIRPDVSDYAWLVDTLEKLNDPSAANHLSREALKLAL 391


>gi|119475321|ref|ZP_01615674.1| uncharacterized enzyme of heme biosynthesis [marine gamma
           proteobacterium HTCC2143]
 gi|119451524|gb|EAW32757.1| uncharacterized enzyme of heme biosynthesis [marine gamma
           proteobacterium HTCC2143]
          Length = 407

 Score = 91.5 bits (226), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 62/365 (16%), Positives = 129/365 (35%), Gaps = 19/365 (5%)

Query: 25  PEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRNYDKG 84
           P  + I++G+    +S ++ L +   F F     F+V R  ++  + L   L  R + + 
Sbjct: 26  PGYLLISYGHYTVESSVWIGLGVFLLFFFMIYGFFSVLRRTINGGSALSGWLSGRGHRRS 85

Query: 85  YKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLE 144
            K    G++S    N  L+++  S  +   T     L YL+  + +              
Sbjct: 86  QKQTTKGIISFIEGNWRLSQRTLSRAAA--TSETPLLNYLIAARASHRLGDEKETR-AFL 142

Query: 145 MMLQIPATREFAVYSL--YFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAK 202
              +   T       L         G    +    T+    +   P+V   + Q Y    
Sbjct: 143 KKAEASTTGASNAVGLTQAELQLSSGQFEQSLATLTRVRRNASKQPFVLHLLRQVYEGLN 202

Query: 203 EWSRAITFLNQKKKNAK-EWNRNRAILLIARSLENADKGDMIASYHDAIESLKLCDNSIM 261
           +W   +  + + KK++     +   ++L A      D           +E  KL      
Sbjct: 203 DWQALLALIPELKKHSVLSVEKLDDLVLEASQKSLVDAAKTRGVSASQLE--KLWAQLPK 260

Query: 262 ASI-------CAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRA 314
           A++       C A  LI+  + +KAE ++    K +    + + Y  + +++   +L  A
Sbjct: 261 AAVKNSETVACYADQLIALGEMQKAEKLIRSQLKKDWDRALISRYGKVEADDVAKQLIHA 320

Query: 315 LRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIF----LLLAQIEQA 370
               +        L+ + +I+L      +A      ++K+    E++     LLA + + 
Sbjct: 321 ENWLKERNNDAALLLCLGRISLRNSLWGKAREYFENSLKLEKSAEVYGELARLLAHLGEV 380

Query: 371 NSHNT 375
              N 
Sbjct: 381 EKSND 385


>gi|229525013|ref|ZP_04414418.1| HemY-like protein [Vibrio cholerae bv. albensis VL426]
 gi|297581841|ref|ZP_06943762.1| hemY protein [Vibrio cholerae RC385]
 gi|229338594|gb|EEO03611.1| HemY-like protein [Vibrio cholerae bv. albensis VL426]
 gi|297533935|gb|EFH72775.1| hemY protein [Vibrio cholerae RC385]
          Length = 398

 Score = 91.5 bits (226), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 60/382 (15%), Positives = 116/382 (30%), Gaps = 18/382 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFV-ILSILYFFLFAWILLF 59
           M+RLI  F V+ L +      +     V I+  NR    S    ++ I+      + L F
Sbjct: 1   MIRLIFLFVVLGLGLFVGTQYAGQQGYVLISIANRTIEMSVTTLVIFIIGALAALFALEF 60

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
            V +   +      +    R   +  +    G++ +   +   A K  +  +  H     
Sbjct: 61  LVKKILYTSFHTW-NWFSVRKQRRSRRYTNEGIIKLLEGDWTQAEKKVTRWANHH--DMP 117

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCR--IGDLNSAQRYA 177
            L YL+  + A          ++   +         AV  L     +   GD  +A    
Sbjct: 118 LLCYLVASEAANGMGDRAK-RDRYLALAAQQNNSTLAVE-LTRAKQQLGDGDNQAALETL 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENA 237
           T+     P    V   + Q Y    EW   +  L +  K  +  N     L I       
Sbjct: 176 TQLQRNHPHNTVVLNLLKQCYQALGEWQPLLALLPKLVKAKRLSNEEAQQLEITAQRGIL 235

Query: 238 DKGDMIASYHDAIE-------SLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
                       ++        LK     +M  I     LI +    +A  ++++  K  
Sbjct: 236 QDIASQKGSEGLMQHWAQLSRKLKAEPELLMCFIT---QLIQRKADYEAFSMIKESLKKQ 292

Query: 291 PHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
             PE+  +   L   +    +         +  + E+   + ++ L       A      
Sbjct: 293 ATPELYALLPELNISDRHPLIALLQEALRRDGNNAEAHSALGQLYLREKHWADAQKHLEK 352

Query: 351 AMKIAPRKEIFLLLAQIEQANS 372
           A+ +      +  LA   +  +
Sbjct: 353 ALSLRSSVSDYAYLADALEKQN 374


>gi|229520091|ref|ZP_04409519.1| HemY-like protein [Vibrio cholerae TM 11079-80]
 gi|229342879|gb|EEO07869.1| HemY-like protein [Vibrio cholerae TM 11079-80]
          Length = 398

 Score = 91.1 bits (225), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 60/382 (15%), Positives = 115/382 (30%), Gaps = 18/382 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFV-ILSILYFFLFAWILLF 59
           M+RLI  F V+ L +      +     V I+  NR    S    ++ I+      + L F
Sbjct: 1   MIRLIFLFVVLGLGLFVGTQYAGQQGYVLISIANRTIEMSVTTLVIFIIGALAALFALEF 60

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
            V +   +      +    R   +  +    G++ +   +   A K  +  +  H     
Sbjct: 61  LVKKILYTSFHTW-NWFSVRKQRRSRRYTNEGIIKLLEGDWTQAEKKVTRWANHH--DMP 117

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCR--IGDLNSAQRYA 177
            L YL+  + A          +    +         AV  L     +   GD  +A    
Sbjct: 118 LLCYLVASEAANGMGDRAK-RDHYLALAAQQNNSTLAVE-LTRAKQQLGDGDNQAALETL 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENA 237
           T+     P    V   + Q Y    EW   +  L +  K  +  N     L I       
Sbjct: 176 TQLQRNHPHNTVVLNLLKQCYQALGEWQPLLALLPKLVKAKRLSNEEAQQLEITAQRGIL 235

Query: 238 DKGDMIASYHDAIE-------SLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
                       ++        LK     +M  I     LI +    +A  ++++  K  
Sbjct: 236 QDIASQKGSEGLMQHWAQLSRKLKAEPELLMCFIT---QLIQRKADYEAFSMIKESLKKQ 292

Query: 291 PHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
             PE+  +   L   +    +         +  + E+   + ++ L       A      
Sbjct: 293 AAPELYALLPELNISDRHPLIALLQEALRRDGNNAEAHSALGQLYLREKHWADAQKHLEK 352

Query: 351 AMKIAPRKEIFLLLAQIEQANS 372
           A+ +      +  LA   +  +
Sbjct: 353 ALSLRSSVSDYAYLADALEKQN 374


>gi|15640149|ref|NP_229776.1| hemY protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121587739|ref|ZP_01677500.1| hemY protein [Vibrio cholerae 2740-80]
 gi|121728284|ref|ZP_01681315.1| hemY protein [Vibrio cholerae V52]
 gi|147673163|ref|YP_001218301.1| hemY protein [Vibrio cholerae O395]
 gi|153822310|ref|ZP_01974977.1| hemY protein [Vibrio cholerae B33]
 gi|227080353|ref|YP_002808904.1| hemY protein [Vibrio cholerae M66-2]
 gi|229508395|ref|ZP_04397899.1| HemY-like protein [Vibrio cholerae BX 330286]
 gi|229508924|ref|ZP_04398414.1| HemY-like protein [Vibrio cholerae B33]
 gi|229517038|ref|ZP_04406484.1| HemY-like protein [Vibrio cholerae RC9]
 gi|229606668|ref|YP_002877316.1| HemY-like protein [Vibrio cholerae MJ-1236]
 gi|254851501|ref|ZP_05240851.1| hemY protein [Vibrio cholerae MO10]
 gi|298501114|ref|ZP_07010914.1| hemY protein [Vibrio cholerae MAK 757]
 gi|9654517|gb|AAF93295.1| hemY protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121548038|gb|EAX58116.1| hemY protein [Vibrio cholerae 2740-80]
 gi|121629414|gb|EAX61843.1| hemY protein [Vibrio cholerae V52]
 gi|126520136|gb|EAZ77359.1| hemY protein [Vibrio cholerae B33]
 gi|146315046|gb|ABQ19585.1| hemY protein [Vibrio cholerae O395]
 gi|227008241|gb|ACP04453.1| hemY protein [Vibrio cholerae M66-2]
 gi|227011881|gb|ACP08091.1| hemY protein [Vibrio cholerae O395]
 gi|229346101|gb|EEO11073.1| HemY-like protein [Vibrio cholerae RC9]
 gi|229354041|gb|EEO18974.1| HemY-like protein [Vibrio cholerae B33]
 gi|229354668|gb|EEO19590.1| HemY-like protein [Vibrio cholerae BX 330286]
 gi|229369323|gb|ACQ59746.1| HemY-like protein [Vibrio cholerae MJ-1236]
 gi|254847206|gb|EET25620.1| hemY protein [Vibrio cholerae MO10]
 gi|297540148|gb|EFH76209.1| hemY protein [Vibrio cholerae MAK 757]
          Length = 398

 Score = 91.1 bits (225), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 65/382 (17%), Positives = 119/382 (31%), Gaps = 18/382 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFV-ILSILYFFLFAWILLF 59
           M+RLI  F V+ L +      +     V I+  NR    S    ++ I+      + L F
Sbjct: 1   MIRLIFLFVVLGLGLFVGTQYAGQQGYVLISIANRTIEMSVTTLVIFIIGALAALFALEF 60

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
            V +   +      +    R   +  +    G++ +   +   A K  +  +  H     
Sbjct: 61  LVKKILYTSFHTW-NWFSVRKQRRSRRYTNEGIIKLLEGDWTQAEKKVTRWANHH--DMP 117

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCR--IGDLNSAQRYA 177
            L YL+  + A          ++   +         AV  L     +   GD  +A    
Sbjct: 118 LLCYLVASEAANGMGDRAK-RDRYLALAAQQNNSTLAVE-LTRAKQQLGDGDNQAALETL 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENA 237
           T+     P    V   + Q Y    EW   +  L +  K  +  N     L I       
Sbjct: 176 TQLQRNHPHNTVVLNLLKQCYQALGEWQPLLALLPKLVKAKRLSNEEAQQLEITAQRGIL 235

Query: 238 D-----KGDMIASYHDAIESLKLC--DNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
                 KG      H A  S KL      +M  I     LI +    +A  ++++  K  
Sbjct: 236 QDIASPKGSEGLMQHWAQLSRKLKAEPELLMCFIT---QLIQRKADYEAFSMIKESLKKQ 292

Query: 291 PHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
             PE+  +   L   +    +         +  + E+   + ++ L       A      
Sbjct: 293 ATPELYALLPELNISDRHPLIALLQEALRRDGNNAEAHSALGQLYLREKHWADAQKHLEK 352

Query: 351 AMKIAPRKEIFLLLAQIEQANS 372
           A+ +      +  LA   +  +
Sbjct: 353 ALSLRSSVSDYAYLADALEKQN 374


>gi|153803399|ref|ZP_01957985.1| hemY protein [Vibrio cholerae MZO-3]
 gi|124121056|gb|EAY39799.1| hemY protein [Vibrio cholerae MZO-3]
          Length = 398

 Score = 91.1 bits (225), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 60/382 (15%), Positives = 115/382 (30%), Gaps = 18/382 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFV-ILSILYFFLFAWILLF 59
           M+RLI  F V+ L +      +     V I+  NR    S    ++ I+      + L F
Sbjct: 1   MIRLIFLFVVLGLGLFVGTQYAGQQGYVLISIANRTIEMSVTTLVIFIIGALAALFALEF 60

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
            V +   +      +    R   +  +    G++ +   +   A K  +  +  H     
Sbjct: 61  LVKKILYTSFHTW-NWFSVRKQRRSRRYTNEGIIKLLEGDWTQAEKKVTRWANHH--DMP 117

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCR--IGDLNSAQRYA 177
            L YL+  + A          +    +         AV  L     +   GD  +A    
Sbjct: 118 LLCYLVASEAANGMGDRAK-RDHYLALAAQQNNSTLAVE-LTRAKQQLGDGDNRAALETL 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENA 237
           T+     P    V   + Q Y    EW   +  L +  K  +  N     L I       
Sbjct: 176 TQLQRNHPHNTVVLNLLKQCYQALGEWQPLLALLPKLVKAKRLSNEEAQQLEITAQRGIL 235

Query: 238 DKGDMIASYHDAIE-------SLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
                       ++        LK     +M  I     LI +    +A  ++++  K  
Sbjct: 236 QDIASQKGSEGLMQHWAQLSRKLKAEPELLMCFIT---QLIQRKADYEAFSMIKESLKKQ 292

Query: 291 PHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
             PE+  +   L   +    +         +  + E+   + ++ L       A      
Sbjct: 293 ATPELYALLPELNISDRHPLIALLEEALRRDGNNAEAHSALGQLYLREKHWADAQKHLEK 352

Query: 351 AMKIAPRKEIFLLLAQIEQANS 372
           A+ +      +  LA   +  +
Sbjct: 353 ALSLRSSVSDYAYLADALEKQN 374


>gi|91227537|ref|ZP_01261874.1| HemY protein [Vibrio alginolyticus 12G01]
 gi|91188561|gb|EAS74853.1| HemY protein [Vibrio alginolyticus 12G01]
          Length = 393

 Score = 91.1 bits (225), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 60/386 (15%), Positives = 120/386 (31%), Gaps = 26/386 (6%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M RLI  F V+   +      S     V I+   +    S   ++  +   L    LL  
Sbjct: 1   MFRLIFLFVVLGAGLFVGTQFSGQQGYVLISIAEKTIEMSVTTLVVFVIAALAGLFLLEY 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +   +  ++    R      +    G++ +   +   A K  +  +  H      
Sbjct: 61  LIKKLVYASSTTWNYFSVRKMRHSRRYTNEGIIKLLEGDWKGAEKKVTRWANHH--DMPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA 180
           L YL+  + A  +       +    +         AV  L      I D          A
Sbjct: 119 LCYLVASEAAQGQGDKAK-RDHYLELASQQENAHLAVE-LTRAKQFIRDNE-----FESA 171

Query: 181 LD--ISPDAPWVTEA-VVQQ----YVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARS 233
            D   S  + + + + V+      Y+  K W   I  L Q  K         A L+    
Sbjct: 172 FDTLQSLKSQYASNSIVLNLLKTTYMQLKLWQPLIDLLPQLTKAKLITEEEHAELIQKAQ 231

Query: 234 LENADKGDMIASYHDAI-------ESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKI 286
                +          I         +K   N +    C A+ LI++    +A  +L++ 
Sbjct: 232 CGLLHEVAQQQGSEGLISHWNSLSRKVKQDTNLV---ACFARELITRKADAEAFTVLKEA 288

Query: 287 WKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHA 346
            K  P PE+  +   L   +T   +     + +   ++  +   ++          +A  
Sbjct: 289 LKKQPAPELYQLLPDLNLPDTHPVVVFLEGVVKKEPDNAAAHSALAHFYFRQERWQEAQD 348

Query: 347 KAMLAMKIAPRKEIFLLLAQIEQANS 372
              +A+K+      +  LA   +  +
Sbjct: 349 HFEIALKLRSDVSDYAFLADTLEKQN 374


>gi|301386720|ref|ZP_07235138.1| hemY protein, putative [Pseudomonas syringae pv. tomato Max13]
          Length = 414

 Score = 90.4 bits (223), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 68/393 (17%), Positives = 142/393 (36%), Gaps = 23/393 (5%)

Query: 1   MLRL-IRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLF 59
           M R+ + +F  I       + V+ +   V I + N  Y +S +  L++L   L    +L 
Sbjct: 1   MKRVYVLFFIAIVAAALIGVAVAEHSGYVLIAYQNFRYESSLWATLALLVAVLLVIAILR 60

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
            +     +   ++     +    +   A+  G M +A      A++     ++     + 
Sbjct: 61  LLITLLTTSGRVVNPWSRRTRRRRVQIAIEQGQMDLAEGRWSSAQRHLQRAAEADA--HP 118

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFES---CRIGDLNSAQRY 176
            L Y+   + A  + +Y      LE  L+     E AV      +      GD + A   
Sbjct: 119 LLYYIGAARAANEQGRYEDCDALLERALERQPQAELAV--ALNHAQLQQDRGDTDGALVT 176

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAIL-------- 228
                +  P  P V   + + Y    +WS  I  + + +K+     +  A L        
Sbjct: 177 LQAMNERHPHNPQVLRQLQRLYQQRGDWSDLIRLMPELRKDKVLPPKELAELERRAWGEN 236

Query: 229 LIARSLENADKGDM--IASYHDAIESLKLCDNSIMASICA-AKSLISQNKKRKAEVILEK 285
           L   +  +  +G    + S   A + L          + A A  L     + +AE +L  
Sbjct: 237 LTLAAYRDEQEGAPTGLPSLEAAWQGLSSAQRQEPQLVLAYADQLRRLGAEAQAEEVLRA 296

Query: 286 IWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAH 345
             K + +  +A +Y  +   + + +L+ A    + +      L+ + +I L+     +A 
Sbjct: 297 ALKRDYNSHLARLYGLVRGSDPLKQLQTAEGWLKHHPADPSLLLSLGRICLQGRLWGKAR 356

Query: 346 AKAMLAMKI----APRKEIFLLLAQIEQANSHN 374
                ++++        E+  LLAQ+ + +  N
Sbjct: 357 DYLESSLRLERNPETCAELARLLAQLGETDRSN 389


>gi|213971707|ref|ZP_03399813.1| hemY protein [Pseudomonas syringae pv. tomato T1]
 gi|302062170|ref|ZP_07253711.1| hemY protein, putative [Pseudomonas syringae pv. tomato K40]
 gi|302130380|ref|ZP_07256370.1| hemY protein, putative [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|213923525|gb|EEB57114.1| hemY protein [Pseudomonas syringae pv. tomato T1]
          Length = 414

 Score = 90.4 bits (223), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 68/393 (17%), Positives = 142/393 (36%), Gaps = 23/393 (5%)

Query: 1   MLRL-IRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLF 59
           M R+ + +F  I       + V+ +   V I + N  Y +S +  L++L   L    +L 
Sbjct: 1   MKRVYVLFFIAIVAAALIGVAVAEHSGYVLIAYQNFRYESSLWATLALLVAVLLVIAILR 60

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
            +     +   ++     +    +   A+  G M +A      A++     ++     + 
Sbjct: 61  LLITLLTTSGRVVNPWSRRNRRRRVQIAIEQGQMDLAEGRWSSAQRHLQRAAEADA--HP 118

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESC---RIGDLNSAQRY 176
            L Y+   + A  + +Y      LE  L+     E AV      +      GD + A   
Sbjct: 119 LLYYIGAARAANEQGRYEDCDALLERALERQPQAELAV--ALNHAQLQQDRGDTDGALVT 176

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAIL-------- 228
                +  P  P V   + + Y    +WS  I  + + +K+     +  A L        
Sbjct: 177 LQAMNERHPHNPQVLRQLQRLYQQRGDWSDLIRLMPELRKDKVLPPKELAELERRAWGEN 236

Query: 229 LIARSLENADKGDM--IASYHDAIESLKLCDNSIMASICA-AKSLISQNKKRKAEVILEK 285
           L   +  +  +G    + S   A + L          + A A  L     + +AE +L  
Sbjct: 237 LTLAAYRDEQEGAPTGLPSLEAAWQGLSSAQRQEPQLVLAYADQLRRLGAEAQAEEVLRA 296

Query: 286 IWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAH 345
             K + +  +A +Y  +   + + +L+ A    + +      L+ + +I L+     +A 
Sbjct: 297 ALKRDYNSHLARLYGLVRGSDPLKQLQTAEGWLKHHPADPSLLLSLGRICLQGRLWGKAR 356

Query: 346 AKAMLAMKI----APRKEIFLLLAQIEQANSHN 374
                ++++        E+  LLAQ+ + +  N
Sbjct: 357 DYLESSLRLERNPETCAELARLLAQLGETDRSN 389


>gi|253997744|ref|YP_003049807.1| HemY domain-containing protein [Methylovorus sp. SIP3-4]
 gi|313199808|ref|YP_004038466.1| hemy domain-containing protein [Methylovorus sp. MP688]
 gi|253984423|gb|ACT49280.1| HemY domain protein [Methylovorus sp. SIP3-4]
 gi|312439124|gb|ADQ83230.1| HemY domain protein [Methylovorus sp. MP688]
          Length = 393

 Score = 90.0 bits (222), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 66/385 (17%), Positives = 130/385 (33%), Gaps = 23/385 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M  L     ++ L +   ++  +    V I         S  ++L ++     +  LL  
Sbjct: 1   MRWLFWILLILGLAVGISLLAVNNQGYVLIVRPPYRMELSLNLLLVMILGGFISLHLLLR 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + ++    PA +     +R    G  AL  GL S+A     LA K  +         N  
Sbjct: 61  LIQYTRHLPASVRSYKEERRIRLGRAALSEGLQSLAEGRYLLAEKAANKALA--LEENPG 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGD--LNSAQRYAT 178
           L  L+  + A   +  +   +      +  A        LY     + D   N A     
Sbjct: 119 LSTLVAARAAHKLKNKSQ-RDFYLAEAERIAPDAAVARLLYQAEFMLDDRRYNEALNVLH 177

Query: 179 KALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILLIARSL 234
           K   +    P      ++  V  K W + +  L + +K+           R         
Sbjct: 178 KLDKLESKYPPALRLELKAQVHLKNWEQVLVTLRRLEKHDAIESWHLRELRQQAHTHLLQ 237

Query: 235 ENADKGDMIASYHDAI-ESLKLCDNSIMASICAAKSLISQNKKRKAEVILE----KIWKV 289
             AD  D + +Y   + E  +L +     +  AA++ I      +A  I+E    K W  
Sbjct: 238 RLADDLDKLNAYWKKMPEEDRLNNR---IACIAAQTFIQAGAGDQAAEIVEMSLTKGWDS 294

Query: 290 NPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAM 349
                +A +    LS     +L++A      ++   + L  +  + + +    +A +   
Sbjct: 295 K----LAGMLGDCLSSQPQKQLQQAEHWLLSHENDADLLRSLGNLCVRLSLWGKAQSYFE 350

Query: 350 LAMKIAPRKEIFLLLAQI--EQANS 372
            ++ + P     L LA++  E+  +
Sbjct: 351 ASLSVKPSAATHLALARLLDERGET 375


>gi|317494821|ref|ZP_07953232.1| hemY protein [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917146|gb|EFV38494.1| hemY protein [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 401

 Score = 90.0 bits (222), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 63/395 (15%), Positives = 121/395 (30%), Gaps = 29/395 (7%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ML+++  F ++   I    + + +   V I        TS   ++ +L   +     +  
Sbjct: 1   MLKVLLLFIILIAGIVLGPMFAGHQGYVLIQTDTYNIETSVTTLVIMLILLIVVLFAIEW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R      A        R   +  K    GLM +A  +     K+ S  +         
Sbjct: 61  ILRRVFRTGARTRGWFVGRKRTRARKQTREGLMKLAEGDYTQVEKLLSRNADHA--EQPV 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQ--------IPATREFAVYSLYFESCRIGDLNS 172
           + YLL  + A         ++ LE   +        +  TR              G+ ++
Sbjct: 119 VNYLLAAEAAQQRGDELRVNQYLERASEVADSNQLPVDITRV-------RIQLARGENHA 171

Query: 173 AQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFL----NQKKKNAKEWNRNRAIL 228
           A+      L+++P  P V     Q YV  + +   +  L         N  E  + +   
Sbjct: 172 ARHGVDALLNVAPRHPEVLRLAEQAYVRTQAYQSLLEILPSLAKANVYNDDEIQQLQLKA 231

Query: 229 LIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWK 288
            I    E    G  +       +  +   +     +   + LI  N    A+ IL    K
Sbjct: 232 YIGLMNERMANGGSLGLKSWWNDQSRKTRHETALQVAMIEHLIECNDHDTAQQILVDGLK 291

Query: 289 VNPHPEIANIYTHLLSENTVGKLKRALRLEEIN-KESVESLVI---VSKIALEMGSIDQA 344
                 +  +   L S N         +L     K+   S ++   + ++ +  G   QA
Sbjct: 292 RKFDERLVLLMPKLKSGNPEQ----LEKLLNQQIKQHGASALLNSTLGQLLMRHGEWQQA 347

Query: 345 HAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKIL 379
                 A+K  P    +  LA +        +   
Sbjct: 348 SEAFRAALKQRPDAYDYAWLADVLDKLHRPEEAAQ 382


>gi|296105315|ref|YP_003615461.1| putative protoheme IX biogenesis protein [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
 gi|295059774|gb|ADF64512.1| putative protoheme IX biogenesis protein [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
          Length = 399

 Score = 90.0 bits (222), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 61/382 (15%), Positives = 114/382 (29%), Gaps = 26/382 (6%)

Query: 11  ISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPA 70
           I+ ++   + ++ +   V I   N    TS   ++ IL   +   + L  + R      A
Sbjct: 12  IAGIVLGPM-LAGHQGYVLIQTDNYNIETSVTGLVIILILGVVVLLALEWILRRIFRTGA 70

Query: 71  MLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARK-MHSYVSQQHTFHNEYLVYLLEVQI 129
                   R   +  K     L+ +A  +     K M              + YLL  + 
Sbjct: 71  HTRGWFVGRKRRRARKQTEQALIKLAEGDYQQVEKLMSKNADH---AEQPVVNYLLAAEA 127

Query: 130 ALAERQYNIAHEKLEM---MLQI-----PATREFAVYSLYFESCRIGDLNSAQRYATKAL 181
           A        A++ LE    M          TR               + ++A+    + L
Sbjct: 128 AQQRGDEARANQHLERASEMASDNQIPVEITRV-------RLQLARNENHAARHGVDRLL 180

Query: 182 DISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN--AKEWNR---NRAILLIARSLEN 236
           +I+P  P V     Q Y+    W   +  +    K     + +R    R   +       
Sbjct: 181 EITPRHPEVLRLAEQAYIRTGAWGSLLDIIPSMAKADVGDDEHRDELQRMAWIGLMDQAR 240

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIA 296
           AD G          +S K     +   +  A+ LI  +    A+ IL    K      + 
Sbjct: 241 ADLGSDGLKTWWKNQSRKTRQQ-VPLQVAMAEHLIECDDHDTAQEILLDGLKRQYDDRLV 299

Query: 297 NIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAP 356
            +   L + N     K   +  +   +       + +  ++ G   +A      A+K  P
Sbjct: 300 MVIPRLKTNNPEQIEKVLRQQIKTVGDRPLLWSTLGQSLMKHGEWQEASLAFRAALKQRP 359

Query: 357 RKEIFLLLAQIEQANSHNTDKI 378
               +  LA          +  
Sbjct: 360 DAFDYAWLADTLDKQHKPEEAA 381


>gi|28867371|ref|NP_789990.1| hemY protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|28850605|gb|AAO53685.1| hemY protein, putative [Pseudomonas syringae pv. tomato str.
           DC3000]
          Length = 414

 Score = 90.0 bits (222), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 68/393 (17%), Positives = 141/393 (35%), Gaps = 23/393 (5%)

Query: 1   MLRL-IRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLF 59
           M R+ + +F  I       + V+ +   V I + N  Y +S +  L++L   L    +L 
Sbjct: 1   MKRVYVLFFIAIVAAALIGVAVAEHSGYVLIAYQNFRYESSLWATLALLVAVLLVIAILR 60

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
            +     +   ++     +    +   A+  G M +A      A++     ++     + 
Sbjct: 61  LLITLLTTSGRVVNPWSRRNRRRRVQIAIEQGQMDLAEGRWSSAQRHLQRAAEADA--HP 118

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESC---RIGDLNSAQRY 176
            L Y+   + A  + +Y      LE  L+     E AV      +      GD + A   
Sbjct: 119 LLYYIGAARAANEQGRYEDCDALLERALERQPQAELAV--ALNHAQLQQDRGDTDGALVT 176

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRA---------- 226
                +  P  P V   + + Y    +WS  I  + + +K+     +  A          
Sbjct: 177 LQAMNERHPHNPQVLRQLQRLYQQRGDWSDLIRLMPELRKDKVLPPKELAELERRAWGEN 236

Query: 227 ILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICA-AKSLISQNKKRKAEVILEK 285
           + L A   E+      + S   A + L          + A A  L     + +AE +L  
Sbjct: 237 LTLAAYRDEHEGAPTGLPSLEAAWQGLSSAQRQEPQLVLAYADQLRRLGAEAQAEEVLRA 296

Query: 286 IWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAH 345
             K + +  +A +Y  +   + + +L+ A    + +      L+ + +I L+     +A 
Sbjct: 297 ALKRDYNSHLARLYGLVRGSDPLKQLQTAEGWLKHHPADPSLLLSLGRICLQGRLWGKAR 356

Query: 346 AKAMLAMKI----APRKEIFLLLAQIEQANSHN 374
                ++++        E+  LLAQ+ + +  N
Sbjct: 357 DYLESSLRLERNPETCAELARLLAQLGETDRSN 389


>gi|331018511|gb|EGH98567.1| hemY protein, putative [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 414

 Score = 89.6 bits (221), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 68/393 (17%), Positives = 141/393 (35%), Gaps = 23/393 (5%)

Query: 1   MLRL-IRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLF 59
           M R+ + +F  I       + V+ +   V I + N  Y +S +  L++L   L    +L 
Sbjct: 1   MKRVYVLFFIAIVAATLIGVAVAEHSGYVLIAYQNFRYESSLWATLALLVAVLLVIAILR 60

Query: 60  AVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
            +     +   ++     +    +   A+  G M +A      A++     ++     + 
Sbjct: 61  LLITLLTTSGRVVNPWSRRNRRRRVQIAIEQGQMDLAEGRWSSAQRHLQRAAEADA--HP 118

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESC---RIGDLNSAQRY 176
            L Y+   + A  + +Y      LE  L+     E AV      +      GD + A   
Sbjct: 119 LLYYIGAARAANEQGRYEDCDALLERALERQPQAELAV--ALNHAQLQQDRGDTDGALVT 176

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRA---------- 226
                +  P  P V   + + Y    +WS  I  + + +K+     +  A          
Sbjct: 177 LQAMNERHPHNPQVLRQLQRLYQQRGDWSDLIRLMPELRKDKVLPPKELAELERRAWGEN 236

Query: 227 ILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICA-AKSLISQNKKRKAEVILEK 285
           + L A   E+      + S   A + L          + A A  L     + +AE +L  
Sbjct: 237 LTLAAYRDEHEGAPTGLPSLEAAWQGLSSAQRQEPQLVLAYADQLRRLGAEAQAEEVLRA 296

Query: 286 IWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAH 345
             K + +  +A +Y  +   + + +L+ A    + +      L+ + +I L+     +A 
Sbjct: 297 ALKRDYNSHLARLYGLVRGSDPLKQLQTAEGWLKHHPADPSLLLSLGRICLQGRLWGKAR 356

Query: 346 AKAMLAMKI----APRKEIFLLLAQIEQANSHN 374
                ++++        E+  LLAQ+ + +  N
Sbjct: 357 DYLESSLRLERNPETCAELARLLAQLGETDRSN 389


>gi|312795372|ref|YP_004028294.1| HemY protein [Burkholderia rhizoxinica HKI 454]
 gi|312167147|emb|CBW74150.1| HemY protein [Burkholderia rhizoxinica HKI 454]
          Length = 397

 Score = 89.6 bits (221), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 51/389 (13%), Positives = 124/389 (31%), Gaps = 10/389 (2%)

Query: 4   LIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSR 63
           ++    + +  +   ++ +H    V I W       S  + ++ L        ++    R
Sbjct: 6   ILWLMALFATAVLLALVGAHDAGQVLIIWAPYRIDISLNLFVAALVVSFVVLYIVVRSIR 65

Query: 64  FFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVY 123
             L  P  +     +      ++AL   + ++ A     A       S            
Sbjct: 66  AVLKMPERVAAYRARVRLANAHQALREAIGNLYAGRFSRAENAAREASAFDANKAPA--G 123

Query: 124 LLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDI 183
           L+    A   R++    ++    +     +E  + +         D + A    T+    
Sbjct: 124 LIGAAAAHRMREFAR-RDEWLAQVTDNDWQEARLMASAELRADARDADGALAALTEMRAQ 182

Query: 184 SPDAPWVTEAVVQQYVLAKEWSRAITFLN--QKKKNAKEWNRNRAILLIARSLENADKGD 241
                   +  ++     K W+  +  +   +K++            L A  L    + +
Sbjct: 183 GGRRIHALQIALRAQQQLKNWAEVLKLVKTLEKREAIHPAVSVHLKQLAAEHLLRDRRHN 242

Query: 242 MIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTH 301
             A              S   +  AA+ LI+ N+   A  I+E+    +  P +   Y  
Sbjct: 243 PDALLQLWQSLSAAERQSPRIADLAAELLIALNRPADARKIVEEALAHHWDPRLLRRYAD 302

Query: 302 LLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPR---- 357
              ++ +  ++RA   ++  ++  +    + ++ L+     +A A    A+K+A      
Sbjct: 303 CADDDPLPLIQRAEAWQKERQDDPDLSFTLGRLCLQQKLWGKAQAFLEQALKLAADNEPL 362

Query: 358 -KEIFLLLAQIEQANSHNTDKILYWTQSA 385
                  LA++ +   +      ++  SA
Sbjct: 363 QIRAHRALARLHEQLGNAQQAAEHYRASA 391


>gi|71909283|ref|YP_286870.1| HemY, N-terminal [Dechloromonas aromatica RCB]
 gi|71848904|gb|AAZ48400.1| HemY, N-terminal [Dechloromonas aromatica RCB]
          Length = 394

 Score = 89.6 bits (221), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 52/394 (13%), Positives = 116/394 (29%), Gaps = 12/394 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M  L     +  L +   +        V + +       S  +++  L     A+  +  
Sbjct: 1   MRGLFWILALFGLAVAVALGARLNDGYVLLVFPPWRAEVSLNLLILALIGLFMAFYAVMR 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V       P  +     ++  DK        +  +        + M              
Sbjct: 61  VFSATFGLPKRVREYRARQQRDKAGLVFQDAVRLLF--EGRFGQAMKKAAEAHGAGTAPG 118

Query: 121 LVYLLEVQIALAERQYNIAHEKL---EMMLQIPATREFAVYSLYFESCRIGDLNSAQRYA 177
           L  L+  + A        A ++          P T    +      +      ++A    
Sbjct: 119 LSALIAARAAQRM--REPAKQQYWLEHAKTDDPRTEAATLMLDAEMANEERRFDAALAAL 176

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQ-KKKNAKEWNRNRAILLIARSLEN 236
            K               ++    A +W   I  + Q  K++A        IL  A     
Sbjct: 177 EKLQGKQGRHIAALRLELRARQGAGDWDGVIKLVRQLAKRDALPDEVVGEILTQAHLASI 236

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP----H 292
           A +G         + +L   +      + AA++L +     +A+ ++E            
Sbjct: 237 AKRGVDERRLISYLRNLPNEERGRRVVLAAARALNALGANGEAQKLIESALDAAGDDAWQ 296

Query: 293 PEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAM 352
           PE+  IY  L       ++ +A      + +    L+ + ++        +A +    ++
Sbjct: 297 PELLAIYGRLSDGELTARIAKAEAWLRRHPDDALLLMALGRMCQRQRLWGKAQSYLEASL 356

Query: 353 KIAPRKEIFLLLAQIEQANSHNTDKILYWTQSAL 386
            +   +E  L LA++      + +   ++  SAL
Sbjct: 357 SVEVTQEAHLELARLFDQLGKSEEANKHYRASAL 390


>gi|254230104|ref|ZP_04923500.1| HemY protein [Vibrio sp. Ex25]
 gi|262392877|ref|YP_003284731.1| HemY-like protein [Vibrio sp. Ex25]
 gi|151937349|gb|EDN56211.1| HemY protein [Vibrio sp. Ex25]
 gi|262336471|gb|ACY50266.1| HemY-like protein [Vibrio sp. Ex25]
          Length = 393

 Score = 89.2 bits (220), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 54/380 (14%), Positives = 114/380 (30%), Gaps = 14/380 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M RLI  F V+   +      S     V I+   +    S   ++  +   L    LL  
Sbjct: 1   MFRLIFLFVVLGAGLFVGTQFSGQQGYVLISIAEKTIEMSVTTLVVFVIAALAGLFLLEY 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +   +  ++    R      +    G++ +   +   A K  +  +  H      
Sbjct: 61  LIKKLVYASSTTWNYFSVRKMRHSRRYTNEGIIKLLEGDWKGAEKKVTRWANHH--DMPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAV---YSLYFESCRIGDLNSAQRYA 177
           L YL+  + A  +       +    +         AV        +  R  +  +A    
Sbjct: 119 LCYLVASEAAQGQGDKAK-RDHYLELASQQENAHLAVELTR--AKQFIRDNEFEAAFDTL 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENA 237
                       V   +   Y+  K W   I  L Q  K         A L+        
Sbjct: 176 QSLKGQYASNSIVLNLLKTTYMQLKLWQPLIDLLPQLTKAKLITEEEHAELIQKAQCGLL 235

Query: 238 DKGDMIASYHDAIE-----SLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPH 292
            +          I      + K+  +      C A+ LI++    +A  +L++  K  P 
Sbjct: 236 HEVAQQQGSEGLISHWNGLARKVKQD-THLVACFARELIARKADAEAFTVLKEALKKQPA 294

Query: 293 PEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAM 352
           PE+  +   L   +    +     + +   ++  +   ++          +A     +A+
Sbjct: 295 PELYQLLPDLNLPDIHPVVVFLEGVVKKEPDNAAAHSALAHFYFRQEKWQEAQDHFEIAL 354

Query: 353 KIAPRKEIFLLLAQIEQANS 372
           K+      +  LA   +  +
Sbjct: 355 KLRSDVSDYAFLADTLEKQN 374


>gi|213018861|ref|ZP_03334669.1| Membrane-bound protoheme IX biogenesis protein, HemY [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
 gi|212995812|gb|EEB56452.1| Membrane-bound protoheme IX biogenesis protein, HemY [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
          Length = 243

 Score = 88.8 bits (219), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 59/142 (41%), Gaps = 14/142 (9%)

Query: 195 VQQYVLAKEWSRAITFLNQKKKNAK----EWNRNRAILLIARSLENADKGDMIASYHDAI 250
           ++  +L ++W  AI+ L +  K       +  +  A+   A + +   KG    +     
Sbjct: 104 IEHCILQEDWINAISKLKEAIKFNIFLPFDRKKMLAVFYCALAKQYESKGSFCKAIDYLA 163

Query: 251 ESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGK 310
           ++          +   A+  I   K RKA  +LE+ ++VNP P+ A +Y  L +      
Sbjct: 164 KAQSYYATFQPINYLKAELYIKLEKIRKASTVLEEEYRVNPTPQSARMYIKLNN------ 217

Query: 311 LKRALRLEEINKESVESLVIVS 332
            K A RL  +  +     ++++
Sbjct: 218 -KGAERLYNLRPDYY---LVIA 235


>gi|258626629|ref|ZP_05721459.1| hemY protein [Vibrio mimicus VM603]
 gi|258581133|gb|EEW06052.1| hemY protein [Vibrio mimicus VM603]
          Length = 398

 Score = 88.8 bits (219), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 63/382 (16%), Positives = 119/382 (31%), Gaps = 18/382 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RLI  F V+ L +      +     V I+  NR    S   ++  +   L A   L  
Sbjct: 1   MIRLIFLFVVLGLGLFVGTQYAGQQGYVLISIANRTIEMSVTTLVIFIIAALAALFALEF 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V +  L      ++    R   +  +    G++ +   +   A K  +  +  H      
Sbjct: 61  VIKKILYTSFHTWNWFSVRKLRRSRRYTNEGIIKLLEGDWKQAEKKVTRWANHH--DMPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAV---YSLYFESCRIGDLNSAQRYA 177
           L YL+  + A          +    +         AV        +    GD  +A    
Sbjct: 119 LCYLVASEAANGMGDRAK-RDHYLALAAKQDNATLAVELTR--AKQQLSDGDNEAALSTL 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENA 237
           T+  +  P+   V   + Q Y    +W   +  L +  K  +  N     L +       
Sbjct: 176 TQLQNSHPNNTVVLNLLKQCYQALGQWQPLLELLPKLVKAKRLTNEEAQQLELTAQRGIL 235

Query: 238 -----DKGDMIASYHDAIESLKLC--DNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
                 KG      H A  S KL      +M  I     LI +    +A  ++++  K  
Sbjct: 236 QSIASQKGSEGLVQHWAQMSRKLKAEPELLMCFIT---QLIQRKADYEAFSVIKESLKKQ 292

Query: 291 PHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           P  E+  +   L   +    +         +  + E+   + ++ L       A      
Sbjct: 293 PTAELYALLPELNITDRHPLIALLEDALRRDSNNAEAHSALGQLYLREKHWADAQKHLEK 352

Query: 351 AMKIAPRKEIFLLLAQIEQANS 372
           A+ +      +  LA   +  +
Sbjct: 353 ALSLRSSVSDYAYLADALEKQN 374


>gi|157144430|ref|YP_001451749.1| putative protoheme IX biogenesis protein [Citrobacter koseri ATCC
           BAA-895]
 gi|157081635|gb|ABV11313.1| hypothetical protein CKO_00144 [Citrobacter koseri ATCC BAA-895]
          Length = 399

 Score = 88.8 bits (219), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 52/365 (14%), Positives = 107/365 (29%), Gaps = 11/365 (3%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I   N    TS   ++ IL   +     +  + R      A        R 
Sbjct: 22  IAGHQGYVLIQTDNYNIETSVTGLVIILIVMMVILFAIEWLLRRVFRTGAHTRGWFVGRK 81

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A        A+
Sbjct: 82  RRRARKQTEQALLKLAEGDYQQVEKLMAKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 139

Query: 141 EKLEM---MLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQ 197
           + LE    +                      + ++A+    K L+++P  P V     Q 
Sbjct: 140 QHLERAAELAGNDTIPVEIAR--VRLQLARNENHAARHGVDKLLEVTPRHPEVLRLAEQA 197

Query: 198 YVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIAS----YHDAIESL 253
           Y+    WS  +  +    K       +RA+L     +   D+                  
Sbjct: 198 YIRTGAWSSLLDIIPSMAKANVGDEEHRAMLEQQAWIGLMDQARADQGSEGLREWWKNQS 257

Query: 254 KLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKR 313
           +   + +   +  A+ LI  +    A+ I+    K      +      L + N     K 
Sbjct: 258 RKTRHQVPLQVAMAEHLIECDDHDMAQQIIIDGLKRQYDDRLVLPIPRLKTNNPEQLEKV 317

Query: 314 ALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSH 373
             +  +   +       + +  ++ G   +A      A+K  P    +  LA        
Sbjct: 318 LRQQIKTVGDRPLLWSTLGQSLMKHGEWQEATFAFRAALKQRPDAYDYAWLADALDRLHQ 377

Query: 374 NTDKI 378
             +  
Sbjct: 378 PEEAA 382


>gi|229593298|ref|YP_002875417.1| putative HemY domain protein [Pseudomonas fluorescens SBW25]
 gi|229365164|emb|CAY53420.1| putative HemY domain protein [Pseudomonas fluorescens SBW25]
          Length = 413

 Score = 88.5 bits (218), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 56/375 (14%), Positives = 132/375 (35%), Gaps = 27/375 (7%)

Query: 21  VSHYPEDVSITWGNR-LYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKR 79
           +S +   V IT+ +   Y +S +  L  ++    A  L+  +     +   ++     + 
Sbjct: 22  ISKHTGYVLITYPHVLHYESSLWATLVAVFAVGLAIYLIRVLLSLITTSGGVVNPWSRRN 81

Query: 80  NYDKGYKALYTGLMSIAAHNIPLARK-MHSYVSQQHTFHNEYLVYLLEVQIALAERQYNI 138
              +   A+  G M +A      A + +H     +       L YL   + A  + +Y  
Sbjct: 82  RSRRVQVAIEQGQMDLAEGRWASAERHLHRAAEAER---QPLLYYLGAARAANEQGRYEE 138

Query: 139 AHEKLEMMLQIPATREFAVYSLYFE-SCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQ 197
           +   LE  L+     E AV   + +     GD + A        +  P    V   + + 
Sbjct: 139 SDGLLERALERQPQAELAVALSHAQLQLDRGDTDGALITLQAMHERHPHNAQVLRQLQRL 198

Query: 198 YVLAKEWSRAITFLNQKKKNAKEWNRNRAILL-------IARSLENADKGDM-----IAS 245
           +    +WS  I  L + +K+        A L        ++ + +  ++G+        +
Sbjct: 199 HQQRGDWSSVIRLLPELRKDKVLPASELAELERRAWGENLSLAAQREEQGEAGLQSLERA 258

Query: 246 YHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEV-ILEKIWKVNPHPEIANIYTHLLS 304
           +     + +     ++A     + L +  +  +A    +++ +  +    +  +Y  L  
Sbjct: 259 WQQLTSAQRQEPQLVLAYAEQLRQLGADTQAEEALRGAIKRGYDSH----LIRLYGLLRG 314

Query: 305 ENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKI----APRKEI 360
            +   +LK A    + +      L+ + ++ L+     +A      ++++        E+
Sbjct: 315 SDPARQLKFAEGWLKDHPSDASLLLTLGRLCLQNSLWGKARDYLESSLQVQRNPEACAEL 374

Query: 361 FLLLAQIEQANSHNT 375
             LLAQ+      N 
Sbjct: 375 ARLLAQLGDTERSNQ 389


>gi|330965077|gb|EGH65337.1| hemY protein [Pseudomonas syringae pv. actinidiae str. M302091]
          Length = 415

 Score = 88.5 bits (218), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 65/389 (16%), Positives = 145/389 (37%), Gaps = 20/389 (5%)

Query: 4   LIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSR 63
           ++ +  +++  +     V+ +   V I + N  Y +S +  L++L   L    +L  +  
Sbjct: 6   VLLFIAIVAAALIGVA-VAEHSGYVLIAYQNFRYESSLWATLALLVAVLLVIAILRLLIT 64

Query: 64  FFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVY 123
              +   ++     +    +   A+  G M +A      A++     ++     +  L Y
Sbjct: 65  LLTTSGRVVNPWSRRNRRRRVQIAIEQGQMDLAEGRWASAQRHLQRAAEADA--HPLLYY 122

Query: 124 LLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCR-IGDLNSAQRYATKALD 182
           +   + A  + +Y      LE  L+     E A+   + +  +  GD + A        +
Sbjct: 123 IGAARAANEQGRYEECDALLERALERQPQAELAIALNHAQLQQDRGDTDGALGTLQAMNE 182

Query: 183 ISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILL---------IARS 233
             P  P V   + + Y    +WS  I  L + +K+     +  A L          +A  
Sbjct: 183 RHPHNPQVLRQLQRLYQQRGDWSDLIRLLPELRKDKVLPPKELAELERRAWGENLTLAAY 242

Query: 234 LENADKGDM--IASYHDAIESLKLCDNSIMASICA-AKSLISQNKKRKAEVILEKIWKVN 290
            + +D+G    + S   A + L          + A A  L     + +AE +L    K +
Sbjct: 243 RDESDEGAPTGLPSLEAAWQGLSSAQRQEPQLVLAYADQLRRLGAEAQAEEVLRAALKRD 302

Query: 291 PHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
            +  +A +Y  +   + + +L+ A    + +      L+ + +I L+     +A      
Sbjct: 303 YNSHLARLYGLVRGSDPLKQLQTAEGWLKHHPADPSLLLSLGRICLQGRLWGKARDYLES 362

Query: 351 AMKI----APRKEIFLLLAQIEQANSHNT 375
           ++++        E+  LLAQ+ + +  N 
Sbjct: 363 SLRLERNPETCAELARLLAQLGETDRSNA 391


>gi|262163676|ref|ZP_06031417.1| HemY-like protein [Vibrio mimicus VM223]
 gi|262027892|gb|EEY46556.1| HemY-like protein [Vibrio mimicus VM223]
          Length = 398

 Score = 88.5 bits (218), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 63/382 (16%), Positives = 119/382 (31%), Gaps = 18/382 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RLI  F V+ L +      +     V I+  NR    S   ++  +   L A   L  
Sbjct: 1   MIRLIFLFVVLGLGLFVGTQYAGQQGYVLISIANRTIEMSVTTLVIFIIAALAALFALEF 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V +  L      ++    R   +  +    G++ +   +   A K  +  +  H      
Sbjct: 61  VIKKILYTSFHTWNWFSVRKLRRSRRYTNEGIIKLLEGDWKQAEKKVTRWANHH--DMPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAV---YSLYFESCRIGDLNSAQRYA 177
           L YL+  + A          +    +         AV        +    GD  +A    
Sbjct: 119 LCYLVASEAANGMGDRAK-RDHYLALAAKQDNATLAVELTR--AKQQLSDGDNEAALNTL 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENA 237
           T+  +  P+   V   + Q Y    +W   +  L +  K  +  N     L +       
Sbjct: 176 TQLQNSHPNNTVVLNLLKQCYQALGQWQPLLELLPKLVKAKRLTNEEAQQLELTAQRGIL 235

Query: 238 -----DKGDMIASYHDAIESLKLC--DNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
                 KG      H A  S KL      +M  I     LI +    +A  ++++  K  
Sbjct: 236 QSIASQKGSEGLVQHWAQMSRKLKAEPELLMCFIT---QLIQRKADYEAFSVIKESLKKQ 292

Query: 291 PHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           P  E+  +   L   +    +         +  + E+   + ++ L       A      
Sbjct: 293 PTAELYALLPELNITDRHPLIALLEDALRRDSNNAEAHSALGQLYLREKHWADAQKHLEK 352

Query: 351 AMKIAPRKEIFLLLAQIEQANS 372
           A+ +      +  LA   +  +
Sbjct: 353 ALSLRSSVSDYAYLADALEKQN 374


>gi|260774860|ref|ZP_05883762.1| HemY-like protein [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609285|gb|EEX35440.1| HemY-like protein [Vibrio coralliilyticus ATCC BAA-450]
          Length = 392

 Score = 88.5 bits (218), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 51/382 (13%), Positives = 124/382 (32%), Gaps = 18/382 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R+I  F V+   + +    +     V I+  ++    S   ++  +   L A   L  
Sbjct: 1   MFRIIFLFVVLGAGLFAGTQYAGQQGYVLISVADKTIEMSVTTLVIFVIATLAALFGLEF 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  L   +  ++    R   +  +    G++ +   +  LA K  +  +  H      
Sbjct: 61  LIKKTLYASSATWNYFSVRKMRRSRRYTNEGIIKLLEGDFKLAEKKVTRWANHH--DMPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAV---YSLYFESCRIGDLNSAQRYA 177
           L YL+  + A          +    +         AV        +  R  +  +A    
Sbjct: 119 LCYLVASEAAQGLGDNEK-RDHYLKLASEQENALLAVELTR--AKQQVREANYTAAFETL 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENA 237
           ++     P+   V   +   Y+  K W   +  L+   K+       +A L         
Sbjct: 176 SQLKSSYPNNRIVLNLLKNVYIELKMWQPLLNTLSTLVKSKIITKDEQAQLTQRAQCGLL 235

Query: 238 DKGDMIASYHDAIE-------SLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
           ++          I         LK   + +    C AK L+++    +A  ++++  K +
Sbjct: 236 EEVAEQKGSEGLIAHWNSLTRKLKSDTHLVE---CFAKQLMARKADSEAFTLVKENLKKH 292

Query: 291 PHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           P  E+  +   +   +    +     + + +  +  +   +++  L   +  +A      
Sbjct: 293 PDSELYALLPDMNLADDHPVVVFLEDVLKKDGNNASAHSALAQFHLRNENWSEAQQHLEK 352

Query: 351 AMKIAPRKEIFLLLAQIEQANS 372
           A+ +      +  LA   +  +
Sbjct: 353 ALSVRSSVSDYSYLADALEKQN 374


>gi|258623139|ref|ZP_05718151.1| hemY protein [Vibrio mimicus VM573]
 gi|258584622|gb|EEW09359.1| hemY protein [Vibrio mimicus VM573]
          Length = 398

 Score = 88.5 bits (218), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 63/382 (16%), Positives = 118/382 (30%), Gaps = 18/382 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RLI  F V+ L +      +     V I+  NR    S   ++  +   L A   L  
Sbjct: 1   MIRLIFLFVVLGLGLFVGTQYAGQQGYVLISIANRTIEMSVTTLVIFIIAALAALFALEF 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V +  L      ++    R   +  +    G++ +   +   A K  +  +  H      
Sbjct: 61  VIKKILYTSFHTWNWFSVRKLRRSRRYTNEGIIKLLEGDWKQAEKKVTRWANHH--DMPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAV---YSLYFESCRIGDLNSAQRYA 177
           L YL+  + A          +    +         AV        +    GD  +A    
Sbjct: 119 LCYLVASEAANGMGDRAK-RDHYLALAAKQDNATLAVELTR--AKQQLSDGDNEAALNTL 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENA 237
           T+  +  P    V   + Q Y    +W   +  L +  K  +  N     L +       
Sbjct: 176 TQLQNSHPHNTVVLNLLKQCYQALGQWQPLLELLPKLVKAKRLTNEEAQQLELTAQRGIL 235

Query: 238 -----DKGDMIASYHDAIESLKLC--DNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
                 KG      H A  S KL      +M  I     LI +    +A  ++++  K  
Sbjct: 236 QSIASQKGSEGLVQHWAQMSRKLKAEPELLMCFIT---QLIQRKADYEAFSVIKESLKKQ 292

Query: 291 PHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           P  E+  +   L   +    +         +  + E+   + ++ L       A      
Sbjct: 293 PTAELYALLPELNITDRHPLIALLEDALRRDSNNAEAHSALGQLYLREKHWADAQKHLEK 352

Query: 351 AMKIAPRKEIFLLLAQIEQANS 372
           A+ +      +  LA   +  +
Sbjct: 353 ALSLRSSVSDYAYLADALEKQN 374


>gi|238798582|ref|ZP_04642058.1| hypothetical protein ymoll0001_37320 [Yersinia mollaretii ATCC
           43969]
 gi|238717538|gb|EEQ09378.1| hypothetical protein ymoll0001_37320 [Yersinia mollaretii ATCC
           43969]
          Length = 399

 Score = 88.5 bits (218), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 56/365 (15%), Positives = 119/365 (32%), Gaps = 7/365 (1%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I   N    TS   ++ +L   L A++++  + R      A        R 
Sbjct: 21  LAGHQGYVLIQTDNYNVETSVTGLVIMLILVLVAFLIVEWILRRIFRTGARTRGWFMGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A         +
Sbjct: 81  RTRARKQTKAALIKLAEGDFKQVEKLLTRNADHA--EQPMVNYLLAAEAAQQRGDEFRTN 138

Query: 141 EKLEMMLQIPATREFAV-YSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYV 199
           + LE   ++  T +  V  +        G +++A+    + LD +P  P V     Q Y+
Sbjct: 139 QYLERAAEVADTDQLPVDITRVRIQLAQGHIHAARHGVDRLLDQAPRHPEVLRLAEQAYL 198

Query: 200 LAKEWSRAITFLNQ----KKKNAKEWNRNRAILLIARSLENADKGDMIASYHDAIESLKL 255
            +  +S  +  L      +   ++E +       I    +   +           +  + 
Sbjct: 199 RSGAYSSLLEILPAIGKVQLHTSEEISALEQQAYIGMMNQCMAEEGSDGLKRWWKDQSRK 258

Query: 256 CDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRAL 315
             N I   +  A+ LI  +    A+ I+    K      +  +   L S N     K   
Sbjct: 259 VRNEIPLQVALAEHLIECDDHDVAQQIILDGLKRQYDERLVLLIPRLKSGNPEPLEKSLR 318

Query: 316 RLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNT 375
           +  + +  +      + ++ L+ G  ++A      A+   P    +  LA          
Sbjct: 319 QQIKQHGATPLLNSTLGQLMLKHGEWEKAREAFTAALVQRPDGYDYAWLADALDKLHRPE 378

Query: 376 DKILY 380
           D    
Sbjct: 379 DAAQA 383


>gi|146313622|ref|YP_001178696.1| putative protoheme IX biogenesis protein [Enterobacter sp. 638]
 gi|145320498|gb|ABP62645.1| HemY protein [Enterobacter sp. 638]
          Length = 399

 Score = 88.5 bits (218), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 54/376 (14%), Positives = 110/376 (29%), Gaps = 14/376 (3%)

Query: 11  ISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPA 70
           I+ ++   + ++ +   V I   N    TS   ++ IL   + A   +  + R      A
Sbjct: 12  IAGIVLGPM-LAGHQGYVLIQTDNYNIETSVTGLVIILILTMVALFAIEWILRRIFRTGA 70

Query: 71  MLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARK-MHSYVSQQHTFHNEYLVYLLEVQI 129
                   R   +  K     L+ +A  +     K M              + YLL  + 
Sbjct: 71  HTRSWFVGRKRRRARKQTEQALLKLAEGDYQQVEKLMTKNADH---AEQPVVNYLLAAEA 127

Query: 130 ALAERQYNIAHEKLEM---MLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPD 186
           A        A++ LE    +                     G+ ++A+    + L+I+P 
Sbjct: 128 AQQRGDEMRANQHLERASELASNDQIPVEITR--VRLQLARGENHAARHGVDRLLEITPH 185

Query: 187 APWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIASY 246
            P V     Q Y+    W   +  +    K     + +R  L     +   D+       
Sbjct: 186 HPEVLRLAEQAYIRTGAWGSLLDIIPSMAKADVGDDEHRDALQRQAWIGLMDQARADLGS 245

Query: 247 H----DAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHL 302
                      +     +   +  A+ LI  +    A+ I+    K      +  +   L
Sbjct: 246 DGLKTWWKNQSRKTRQQVPLQVAMAEHLIECDDHDTAQAIILDGLKRQYDDRLVMVIPRL 305

Query: 303 LSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFL 362
            + N     K   +  +   +       + +  ++ G   +A      A+K  P    + 
Sbjct: 306 KTNNPEQMEKMLRQQIKTVGDRPLLWSTLGQSLMKHGEWQEASLAFRAALKQRPDAFDYA 365

Query: 363 LLAQIEQANSHNTDKI 378
            LA          +  
Sbjct: 366 WLADSLDKQHKPEEAA 381


>gi|117621176|ref|YP_854999.1| HemY protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117562583|gb|ABK39531.1| HemY protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 387

 Score = 88.1 bits (217), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 54/370 (14%), Positives = 118/370 (31%), Gaps = 21/370 (5%)

Query: 1   MLRLIRYFFVISLVICSFII---VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWIL 57
           M+RLI    +++ ++   I     S     V I+ GN    +S    + +   F  A ++
Sbjct: 1   MIRLIV---LVAAMVAGLIFGPQASGNKGYVLISLGNYTVESSVTSAVILAVLFYGALLI 57

Query: 58  LFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFH 117
           +  +                 R   K  +      +++A  +   A K+   +       
Sbjct: 58  VEWLLGRVFGLRRKTLGWYGSRRRRKANQQTVAATLAMAEGHYSQAEKLM--LKGASNSD 115

Query: 118 NEYLVYLLEVQIALAERQYNIAHEKL-EMMLQIPATREFAVYSLYFESCRIGDLNSAQRY 176
              L YL   + A A        + L +   + P        +        G  ++A   
Sbjct: 116 TPLLNYLSAAKAAQARGDDVRRDQYLQKAQEENPKAELALTLTQTQLQIEQGQYDTALAM 175

Query: 177 ATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLEN 236
                 ++P  P V + + Q ++  ++W+  I  +    K  K   +    LL       
Sbjct: 176 LESVYALNPRHPMVLDQLRQVHLAREDWAALIDLIPVLHKVGKLTPKQEEDLLQQAWRGR 235

Query: 237 ADK--GDMIASYHDAIE---SLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
            D   G +        E    L+   + + A     + L + N+   A  +     +   
Sbjct: 236 LDAASGALETLRPIWQELPRKLRQDPDLLAAYGDRLRQLGADNE---AAELWLDALRKQV 292

Query: 292 HPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLA 351
            P++      L  ++    L    +++    +       ++++ L  G +D A       
Sbjct: 293 SPQLLARLPKLKLDSYQPMLTLLQKIQ----DQPGVDAALAQVYLLAGQLDDAQRLLEQE 348

Query: 352 MKIAPRKEIF 361
           +  AP   ++
Sbjct: 349 VAKAPNAAVY 358


>gi|219871195|ref|YP_002475570.1| porphoryin biosynthesis protein HemY [Haemophilus parasuis SH0165]
 gi|219691399|gb|ACL32622.1| porphoryin biosynthesis protein HemY [Haemophilus parasuis SH0165]
          Length = 416

 Score = 88.1 bits (217), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 52/397 (13%), Positives = 125/397 (31%), Gaps = 30/397 (7%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R++    ++   +     +S +   V I    ++   S  +++      +     +  
Sbjct: 1   MFRVLFLMLIVLAGLILGPYISGHQGYVRIETAGKVIEMSLVMLVVFFAVAMAVVYAIEW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R F       +     R   K  +    GLM +   +   A ++ +  ++        
Sbjct: 61  IFRRFFGLSRGAYQWFGDRKRKKAQQQTLEGLMKMTEGDYSKAERLIAKNAKHAA--EPV 118

Query: 121 LVYLLEVQIALAERQYNIAHEKL----------EMMLQIPATREFAVYSLYFESCRIGDL 170
           L ++   + A        A++ L           + ++I  TR   +      +    D 
Sbjct: 119 LNFIKAAEAAQQRGDELNANKYLIEAAKIAGPNNVAVEIARTRILLLQGKLPAARSAVDS 178

Query: 171 NSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLN----QKKKNAKEWNRNRA 226
                     L+++P+        ++ Y  +K +      L     +   +A+E+ R   
Sbjct: 179 L---------LELAPNNVEALRLAIEIYQKSKAYKALDDVLEQIGQRSFLSAEEYERLEQ 229

Query: 227 ILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKI 286
            +      E  ++                   SI   +   K LI  +  + A+ I  + 
Sbjct: 230 QVNDGLLDEIMNEEGQEGLLKWWDNQPSRRRRSIYVRVGLIKRLIDTDDHQSAQEIALET 289

Query: 287 WKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESL-----VIVSKIALEMGSI 341
            K     ++A +Y  L       + K    L + N ++ E        ++  I    G+ 
Sbjct: 290 VKKYQDEQLALLYPELTRLQVDEEHKLFKVLLKRNSKAEERYSDDYARVLGYIHTRAGNF 349

Query: 342 DQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKI 378
           D+A    +  ++         ++A      +H+ +  
Sbjct: 350 DKAKPYFVQLLEHKECVAKDRIMALYVAEQTHDVELA 386


>gi|330876443|gb|EGH10592.1| hemY protein [Pseudomonas syringae pv. morsprunorum str. M302280PT]
          Length = 415

 Score = 88.1 bits (217), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 64/389 (16%), Positives = 144/389 (37%), Gaps = 20/389 (5%)

Query: 4   LIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSR 63
           ++ +  +++  +     V+ +   V I + N  Y +S +  L++L   L    +L  +  
Sbjct: 6   VLLFIAIVAAALIGVA-VAEHSGYVLIAYQNFRYESSLWATLALLVAVLLVIAILRLLIT 64

Query: 64  FFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVY 123
              +   ++     +    +   A+  G M +A      A++     ++     +  L Y
Sbjct: 65  LLTTSGRVVNPWSRRNRRRRVQIAIEQGQMDLAEGRWASAQRHLQGAAEADA--HPLLYY 122

Query: 124 LLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCR-IGDLNSAQRYATKALD 182
           +   + A  + +Y      LE  L+     E A+   + +  +  GD + A        +
Sbjct: 123 IGAARAANEQGRYEECDALLERALERQPQAELAIALNHAQLQQDRGDTDGALGTLQAMNE 182

Query: 183 ISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILL---------IARS 233
             P  P V   + + Y    +WS  I  L + +K+     +  A L          +A  
Sbjct: 183 RHPHNPQVLRQLQRLYQQRGDWSDLIRLLPELRKDKVLPPKELAELERRAWGENLTLAAY 242

Query: 234 LENADKGDM--IASYHDAIESLKLCDNSIMASICA-AKSLISQNKKRKAEVILEKIWKVN 290
            + +D+G    + S   A + L          + A A  L     + +AE +L    K +
Sbjct: 243 RDESDEGAPTGLPSLEAAWQGLSSAQRQEPQLVLAYADQLRRLGAEAQAEEVLRAALKRD 302

Query: 291 PHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
            +  +A +Y  +   + + +L+ A    + +       + + +I L+     +A      
Sbjct: 303 YNSHLARLYGLVRGSDPLKQLQTAEGWLKHHPADPSLSLSLGRICLQGRLWGKARDYLES 362

Query: 351 AMKI----APRKEIFLLLAQIEQANSHNT 375
           ++++        E+  LLAQ+ + +  N 
Sbjct: 363 SLRLERNPETCAELARLLAQLGETDRSNA 391


>gi|52842942|ref|YP_096741.1| protoporphyrinogen IX and coproporphyrinogen III oxidase HemY
           [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|52630053|gb|AAU28794.1| protoheme IX synthesis HemY [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 395

 Score = 88.1 bits (217), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 64/383 (16%), Positives = 126/383 (32%), Gaps = 51/383 (13%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++  F ++ L +   I ++  P  V I   N    T+ +V +  L+F  F    L  
Sbjct: 1   MIRVLFAFIILLLSVFLGIQLNKDPGYVLIAINNWTIETTLWVSVFGLFFLFFLIYGLVQ 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
                   P M+     +R   K       GL+  +      A+  +  +          
Sbjct: 61  FCNKITRMPGMVNKWHSRRLAQKAQATTRKGLIEYSEGYWQKAK--NHLIQALPNTDTPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKL--EMMLQIPATREFAVYSLYFESCRIGDLNSAQRYA- 177
           L YL   + A       +  +    E    +P  +             +    +  + A 
Sbjct: 119 LNYLTAARAAQKMGDSKL-RDHYLREAQQSMPEAK-----------IAVELTQAQLQLAN 166

Query: 178 ---TKALD-------ISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAI 227
               +AL        ++P  P+V + ++  Y   K+W + I  L   KKN          
Sbjct: 167 HQWEQALATLKHLQDLAPRHPYVLKLLMNLYEEIKDWQQLIALLPDLKKN---------H 217

Query: 228 LLIARSLENADKGDMIASYHDAIESL------KLCDNS-------IMASICAAKSLISQN 274
           ++  ++ E   K   + +  D  +        KL              +   A+ LI   
Sbjct: 218 IISDQAFEQLQKNTYLQAMIDLAKHNQSDGITKLYQTLPKTLVNDTAITAEYARFLIRNQ 277

Query: 275 KKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKI 334
              +AE  L++  +      +  +Y+ L  E     L  A  L + N  S    + + ++
Sbjct: 278 DYDQAEYHLKRCLRKELDNRLIELYSLLPCEENQ--LLFAESLLKKNPHSAALYLCLGRM 335

Query: 335 ALEMGSIDQAHAKAMLAMKIAPR 357
            L      +A      ++++ P 
Sbjct: 336 CLSRHLWGKAKHYLEQSIELNPT 358


>gi|323495301|ref|ZP_08100382.1| heme biosynthesis protein [Vibrio brasiliensis LMG 20546]
 gi|323310478|gb|EGA63661.1| heme biosynthesis protein [Vibrio brasiliensis LMG 20546]
          Length = 395

 Score = 88.1 bits (217), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 59/399 (14%), Positives = 133/399 (33%), Gaps = 11/399 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M RLI  F V+ L +      +     V I+  ++    S   ++  +   L A   L  
Sbjct: 1   MFRLIFLFVVLGLGLFVGTQYAGQQGYVLISIASKTIEMSVTTLVIFVIAALAALFGLEY 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +      +  ++    R   +  +    G++ +   +   A K  +  +  H      
Sbjct: 61  LVKKVFYASSATWNYFSVRKMRRSRRYTNEGIIKLLEGDFKQAEKKVTRWANHH--DMPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGD--LNSAQRYAT 178
           L YL+  + A      +   ++   +       + AV  L     +I D   N A    T
Sbjct: 119 LCYLVASEAAQGMGD-DAQRDRYLELAAQQDNSQLAVE-LTRAKQQIRDAKYNEALETLT 176

Query: 179 KALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENAD 238
                  +   V   + Q Y+  K W   +  L +  K+       +  L          
Sbjct: 177 SLKANYANNMIVLNLLKQVYIELKLWQPLLDLLPKLVKSNIVTKEEQEPLAQRAQCGLLA 236

Query: 239 KGDMIASYHDAIESLKLCDNSIMA----SICAAKSLISQNKKRKAEVILEKIWKVNPHPE 294
           +          I         + A      C AK LI++    +A  ++++  K +P+ +
Sbjct: 237 EVAEQKGSEGLIAHWNALPRKVKADSHLVECFAKQLINRQADSEAFTLIKETLKKHPNSD 296

Query: 295 IANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKI 354
           +  +   L   ++   +     + + +  + ++   +++  L   +  +A      A+ +
Sbjct: 297 LYRLLPELKLSDSHPVVTFLEGVLKKDANNAQANSALAQFHLRNENWSRAQQHLEKALSV 356

Query: 355 APRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPL 393
                 + LLA   +  +  T      ++ AL  + +P 
Sbjct: 357 RSNVSDYGLLADALEKQNL-TKAAHEVSKKALTLVSEPA 394


>gi|261365623|ref|ZP_05978506.1| HemY family protein [Neisseria mucosa ATCC 25996]
 gi|288565859|gb|EFC87419.1| HemY family protein [Neisseria mucosa ATCC 25996]
          Length = 407

 Score = 87.7 bits (216), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 53/390 (13%), Positives = 130/390 (33%), Gaps = 21/390 (5%)

Query: 2   LRLIRYFFVISLVICSFIIVSH-YPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++ + +  V+       ++ S  Y  +V I  G  + R +    +  L  F+ A   L  
Sbjct: 1   MKAVVWIVVLFAAAVGIVLTSGVYTGNVYIVVGQVMMRVNLHAFILGLVLFVVALYFLIK 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQH-TFHNE 119
                ++ PA +      R   +   AL +  ++        A +  + V +      N 
Sbjct: 61  FIVGLMNIPARMQRFGTARKGRQAAVALNSAGLAFFEGRFEKAEQEAAKVLENKEAGDNR 120

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFE-SCRIGDLNSAQRYAT 178
            L  +L    A     + +    L+ + ++P  ++ + Y L  E +    D  +A     
Sbjct: 121 NLALMLGAHAADQMENFELRDHYLKDIEKLPNKQQLSRYLLLAESALGRRDYPTALENLN 180

Query: 179 KALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK-------EWNRNRAILLIA 231
            A  I P+   +    ++      +    +    +  K          ++       L+A
Sbjct: 181 AAARIHPNLSRLARLQLRYAFDHGDAEDVLAKSEKLMKAGAINDFEAEQYQSWAYRRLLA 240

Query: 232 RSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNP 291
            + + A     +    +A+++ +LC       +  A+         +A   +   +  N 
Sbjct: 241 EASDAARLKACLKRIPEALKADELC-------VAIAEKYERLGLYTEAVKWVRHYYPQNR 293

Query: 292 HPEIANIYTHLLSENTVGKLKRALRLEEI----NKESVESLVIVSKIALEMGSIDQAHAK 347
            PE+   +   +        ++A+ L +       +    L+ + ++A       +A + 
Sbjct: 294 RPELLEAFVESVRFFNERGQQKAIDLADSWLKDKPDDAPLLMYLGQLAYGRSLWGKAQSY 353

Query: 348 AMLAMKIAPRKEIFLLLAQIEQANSHNTDK 377
              ++ + P     L+LA++          
Sbjct: 354 LEASIALQPSIAARLMLARVLDETGQPQKA 383


>gi|145300739|ref|YP_001143580.1| HemY protein [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142853511|gb|ABO91832.1| HemY protein [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 387

 Score = 87.3 bits (215), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 52/367 (14%), Positives = 113/367 (30%), Gaps = 15/367 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RLI    V+   +      S     V I  GN    +S    + +   F  A +++  
Sbjct: 1   MIRLIVLVAVMIAGLMFGPEASGNKGYVLIALGNYTVESSVTSAVILAVLFYGALLVIEW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +                 R   K  +      +++A  +   A K+   +          
Sbjct: 61  LLGRVFGLRRKTLGWYGSRRRRKANQQTVAATLAMAEGHYSQAEKLM--LKGASNSDTPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKL-EMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATK 179
           L YL   + A A        + L +   + P        +        G  ++A      
Sbjct: 119 LNYLSAAKAAQARGDDVRRDQYLQKAQEENPKAELALTLTQTQLQIEQGQYDTALAMLES 178

Query: 180 ALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAK-EWNRNRAILLIARSLENAD 238
              ++P  P V + + Q ++  ++W+  I  +    K  K    +   +L  A +     
Sbjct: 179 VYALNPRHPMVLDQLRQVHLAREDWAAIIDLIPVLHKVGKLTPKQEEDLLHRAWTGRLKA 238

Query: 239 KGDMIASYHDAIES----LKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPE 294
             D + +     +     L+   + + A       L       +A  +     +    P+
Sbjct: 239 ASDALETLRPVWQGLPRKLRQDPDLLAA---YGDRLRELGADSEAAELWLDALRKQVSPQ 295

Query: 295 IANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKI 354
           +      L  E+    L    +++    +       ++++ L  G +DQA       +  
Sbjct: 296 LLARLPKLKLESYQPVLTLLQKIQ----DQPGVEAALAQVYLLAGQLDQAQRLLEQEVAK 351

Query: 355 APRKEIF 361
            P   ++
Sbjct: 352 TPSAAMY 358


>gi|54295576|ref|YP_127991.1| protoporphyrinogen IX and coproporphyrinogen III oxidase HemY
           [Legionella pneumophila str. Lens]
 gi|53755408|emb|CAH16904.1| protoporphyrinogen IX and coproporphyrinogen III oxidase HemY
           [Legionella pneumophila str. Lens]
          Length = 395

 Score = 87.3 bits (215), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 65/387 (16%), Positives = 125/387 (32%), Gaps = 59/387 (15%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++  F ++ L +   I ++  P  V I   N    T+ +V +  L+F  F    L  
Sbjct: 1   MIRVLFAFIILLLSVFLGIQLNKDPGYVLIAINNWTIETTLWVSVFGLFFLFFLIYGLVQ 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +       P M+     +R   K       GL+  +      A+  +  +          
Sbjct: 61  LCNKITRMPGMVNKWHSRRLAQKAQATTRKGLIEYSEGYWQKAK--NHLIQALPNTDTPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKL--EMMLQIPATREFAVYSLYFESCRIGDLNSAQRYA- 177
           L YL   + A       +  +    E    +P  +             +    +  + A 
Sbjct: 119 LNYLTAARAAQKMGDSKL-RDHYLREAQQSMPEAK-----------IAVELTQAQLQLAN 166

Query: 178 ---TKALD-------ISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAI 227
               +AL        ++P  P+V + ++  Y   K+W + I  L   KKN          
Sbjct: 167 HQWEQALATLKHLQDLAPRHPYVLKLLMNLYEEIKDWQQLIALLPDLKKN---------H 217

Query: 228 LLIARSLENADKGDMIASYHDAIESL------KLCDNS-------IMASICAAKSLISQN 274
           ++  ++ E   K   + +  D  +        KL              +   A+ LI   
Sbjct: 218 IISDQAFEQLQKNTYLQAMIDLAKHNQSDGITKLYQTLPKTLVNDTAITAEYARFLIRNR 277

Query: 275 KKRKAE----VILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVI 330
              +AE      L K         +  +Y+ L  E     L  A  L + N  S    + 
Sbjct: 278 DYDQAEYHLRRCLRKELDNR----LIELYSLLPCEENQ--LLFAESLLKKNPHSAGLHLC 331

Query: 331 VSKIALEMGSIDQAHAKAMLAMKIAPR 357
           + ++ L      +A      ++++ P 
Sbjct: 332 LGRMCLSRHLWGKAKHYLEQSIELNPT 358


>gi|148358522|ref|YP_001249729.1| protoporphyrinogen IX and coproporphyrinogen III oxidase HemY
           [Legionella pneumophila str. Corby]
 gi|296108390|ref|YP_003620091.1| HemY protein [Legionella pneumophila 2300/99 Alcoy]
 gi|148280295|gb|ABQ54383.1| protoporphyrinogen IX and coproporphyrinogen III oxidase HemY
           [Legionella pneumophila str. Corby]
 gi|295650292|gb|ADG26139.1| HemY protein [Legionella pneumophila 2300/99 Alcoy]
          Length = 395

 Score = 86.9 bits (214), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 65/387 (16%), Positives = 125/387 (32%), Gaps = 59/387 (15%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++  F ++ L +   I ++  P  V I   N    T+ +V +  L+F  F    L  
Sbjct: 1   MIRVLFAFIILLLSVFLGIQLNKDPGYVLIAINNWTIETTLWVSVFGLFFLFFLIYGLVQ 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +       P M+     +R   K       GL+  +      A+  +  +          
Sbjct: 61  LCNKITRMPGMVNKWHSRRLAQKAQATTRKGLIEYSEGYWQKAK--NHLIQALPNTDTPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKL--EMMLQIPATREFAVYSLYFESCRIGDLNSAQRYA- 177
           L YL   + A       +  +    E    +P  +             +    +  + A 
Sbjct: 119 LNYLTAARAAQKMGDSKL-RDHYLREAQQSMPEAK-----------IAVELTQAQLQLAN 166

Query: 178 ---TKALD-------ISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAI 227
               +AL        ++P  P+V + ++  Y   K+W + I  L   KKN          
Sbjct: 167 HQWEQALATLKHLQDLAPRHPYVLKLLMNLYEEIKDWQQLIALLPDLKKN---------H 217

Query: 228 LLIARSLENADKGDMIASYHDAIESL------KLCDNS-------IMASICAAKSLISQN 274
           ++  ++ E   K   + +  D  +        KL              +   A+ LI   
Sbjct: 218 IISDQAFEQLQKNTYLQAMIDLAKHNQSDGITKLYQTLPKTLVNDTAITAEYARFLIRNR 277

Query: 275 KKRKAE----VILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVI 330
              +AE      L K         +  +Y+ L  E     L  A  L + N  S    + 
Sbjct: 278 DYDQAEYHLRRCLRKELDNR----LIELYSLLPCEENQ--LLFAESLLKKNPHSAALYLC 331

Query: 331 VSKIALEMGSIDQAHAKAMLAMKIAPR 357
           + ++ L      +A      ++++ P 
Sbjct: 332 LGRMCLSRHLWGKAKHYLEQSIELNPT 358


>gi|167855155|ref|ZP_02477926.1| HemY-like protein [Haemophilus parasuis 29755]
 gi|167853700|gb|EDS24943.1| HemY-like protein [Haemophilus parasuis 29755]
          Length = 416

 Score = 86.9 bits (214), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 52/397 (13%), Positives = 124/397 (31%), Gaps = 30/397 (7%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M R++    ++   +     +S +   V I    ++   S  +++      +     +  
Sbjct: 1   MFRVLFLMLIVLAGLILGPYISGHQGYVRIETAGKVIEMSLVMLVVFFAVAMAVVYAIEW 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R F       +     R   K  +    GLM +   +   A ++ +  ++        
Sbjct: 61  IVRRFFGLSRGAYQWFGDRKRKKAQQQTLEGLMKMTEGDYSKAERLIAKNAKHAA--EPV 118

Query: 121 LVYLLEVQIALAERQYNIAHEKL----------EMMLQIPATREFAVYSLYFESCRIGDL 170
           L ++   + A        A++ L           + ++I  TR   +      +    D 
Sbjct: 119 LNFIKAAEAAQQRGDELNANKYLIEAAKIAGPNNVAVEIARTRILLLQGKLPAARSAVDS 178

Query: 171 NSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLN----QKKKNAKEWNRNRA 226
                     L+++P+        ++ Y  +K +      L     +   +A+E+ R   
Sbjct: 179 L---------LELAPNNVEALRLAIEIYQKSKAYKALDDVLEQIGQRSFLSAEEYERLEQ 229

Query: 227 ILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKI 286
            +      E  ++                   SI   +   K LI  +  + A+ I  + 
Sbjct: 230 QVNDGLLDEIMNEEGQEGLLKWWDNQPSRRRRSIYVRVGLIKRLIDTDDHQSAQEIALET 289

Query: 287 WKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESL-----VIVSKIALEMGSI 341
            K     ++A +Y  L       + K    L + N ++ E        ++  I    G  
Sbjct: 290 VKKYQDEQLALLYPELTRLQVDEEHKLFKVLLKRNSKAEERYSDDYARVLGYIHTRAGHF 349

Query: 342 DQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKI 378
           D+A    +  ++         ++A      +H+ +  
Sbjct: 350 DKAKPYFVQLLEHKECVAKDRIMALYVAEQTHDVELA 386


>gi|307611616|emb|CBX01300.1| protoporphyrinogen IX and coproporphyrinogen III oxidase HemY
           [Legionella pneumophila 130b]
          Length = 395

 Score = 86.9 bits (214), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 65/387 (16%), Positives = 127/387 (32%), Gaps = 59/387 (15%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++  F ++ L +   I ++  P  V I   N    T+ +V +  L+F  F    L  
Sbjct: 1   MIRVLFAFIILLLSVFLGIQLNKDPGYVLIAINNWTIETTLWVSVFGLFFLFFLIYGLVQ 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +       P M+     +R   K       GL+  +      A+  +  +          
Sbjct: 61  LCNKITRMPGMVNKWHSRRLAQKAQATTRKGLIEYSEGYWQKAK--NHLIQALPNTDTPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKL--EMMLQIPATREFAVYSLYFESCRIGDLNSAQRYA- 177
           L YL   + A       +  +    E    +P  +             +    +  + A 
Sbjct: 119 LNYLTAARAAQKMGDSKL-RDHYLREAQQSMPEAK-----------IAVELTQAQLQLAN 166

Query: 178 ---TKALD-------ISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAI 227
               +AL        ++P  P+V + ++  Y   K+W + IT L   KKN          
Sbjct: 167 HQWEQALATLKHLQDLAPRHPYVLKLLMNLYEEIKDWQQLITLLPDLKKN---------H 217

Query: 228 LLIARSLENADKGDMIASYHDAIESLK----------LCDNSIMASICAA---KSLISQN 274
           ++  ++ E   K   + +  D  +  +          L    +  +   A   + LI   
Sbjct: 218 IISDQAFEQLQKNTYLQAMIDLAKHNQSDGITKLYQTLPKTLVNDTAITAEYTRFLIRNR 277

Query: 275 KKRKAE----VILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVI 330
              +AE      L K         +  +Y+ L  E     L  A  L + N  S    + 
Sbjct: 278 DYDQAEYHLRRCLRKELDNR----LIELYSLLPCEENQ--LLFAESLLKKNPHSAALHLC 331

Query: 331 VSKIALEMGSIDQAHAKAMLAMKIAPR 357
           + ++ L      +A      ++++ P 
Sbjct: 332 LGRMCLSRHLWGKAKHYLEQSIELNPT 358


>gi|332995108|gb|AEF05163.1| heme biosynthesis protein [Alteromonas sp. SN2]
          Length = 390

 Score = 86.5 bits (213), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 73/383 (19%), Positives = 136/383 (35%), Gaps = 10/383 (2%)

Query: 2   LRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAV 61
           + L      I  +I   +I+      V I+ GN    TS      I+   + +W ++  +
Sbjct: 6   IALAVLAAFIVALIVGPMILGDK-GYVLISLGNTAIETSLIGFCIIIICAIISWYIISKL 64

Query: 62  SRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYL 121
             + LS               K  +A Y GL S+AA ++  A   H  +SQ      E +
Sbjct: 65  VLWTLSLVTGSHRWFGALGERKRKRAFYHGLQSLAAGDLKSA---HKALSQTTNGDFEGV 121

Query: 122 VYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKAL 181
            YL   Q+A ++     A   L    +  + +  A   +       G    A        
Sbjct: 122 NYLAAAQVAQSQNDPQKARYFLLQAAEYDSAKVAATIVMARIDVSEGKYTDALEKLDSLD 181

Query: 182 DISPDAPWVTEAVVQQYVLAKEWSRAITFLN--QKKKNAKEWNRNRAILLIARSLENADK 239
           +   + P V +          +W      L+  +K    +++      +   +  E A K
Sbjct: 182 EEEANNPQVIQLKASIMAEQGQWQTLQEKLSGWRKALPKEDYTAWSQRIAKGKLAEIASK 241

Query: 240 GDMIASYHDAIESLK--LCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIAN 297
                         +    D++  A+    + L+ Q    +A+ +L +  K  PHP +  
Sbjct: 242 NGAAELKTHWEGLPRKIKQDDAYRAAYI--QQLLEQGMHAEAQTLLVEWQKRGPHPALFP 299

Query: 298 IYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPR 357
            +T L   N    L+      + + E+VE    + ++A   G    A    + A+K+   
Sbjct: 300 YFTQLNIPNAAPSLRLLESWIKQDSENVELYSTLGRVAFNAGDDILAEKVLLKAVKMESN 359

Query: 358 KEIFLLLAQIEQANSHNTDKILY 380
           K+  LLL+ I +    +T  + Y
Sbjct: 360 KDDLLLLSAISERRHDSTTALQY 382


>gi|156935873|ref|YP_001439789.1| putative protoheme IX biogenesis protein [Cronobacter sakazakii
           ATCC BAA-894]
 gi|156534127|gb|ABU78953.1| hypothetical protein ESA_03756 [Cronobacter sakazakii ATCC BAA-894]
          Length = 398

 Score = 86.5 bits (213), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 55/365 (15%), Positives = 107/365 (29%), Gaps = 11/365 (3%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           V+ +   V I        TS   +  IL   L     +  + R      A        R 
Sbjct: 21  VAGHQGYVLIQTDTWNIETSVTGLAIILILSLVVLFAIEWLLRRLFRTGARTRGWFAGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ S  +         + YLL  + A        A+
Sbjct: 81  RSRARKQTKLALLKLAEGDYQQVEKLMSKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 138

Query: 141 EKLEM---MLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQ 197
           + LE    +                      + ++A+    + L+I+P  P V     Q 
Sbjct: 139 QHLERAAELADNDQIPVEITR--VRLQLARNENHAARHGVDRLLEITPRHPEVLRLAEQA 196

Query: 198 YVLAKEWSRAITFLNQKKKNA-KEWNRNRAILLIA--RSLENADKGDMIASYHDAIESLK 254
           Y+    WS  +  +   +K    +     A+   A    ++ A              +  
Sbjct: 197 YIRTGAWSSLLDIIPSMQKAGVGDDEHRDALTRQAWIGLMDQARADQGSDGLKAWWRNQS 256

Query: 255 LCDNSIMASICA-AKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKR 313
                  A   A A+ LI  +  + A+ I+    K      +  +   L + N     K 
Sbjct: 257 RKTRHQPALQVAMAEHLIECDDHQTAQEIILDGLKRQYDDRLVLLMPRLKAGNPEQLEKA 316

Query: 314 ALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSH 373
             +  +   +       + ++ +  G   +A      A+K  P    +  LA +      
Sbjct: 317 LRQQIKTYGDRPLLWSTLGQLLMSHGEWKEASLAFRAALKQRPDAFDYAWLADVLDRLHQ 376

Query: 374 NTDKI 378
             +  
Sbjct: 377 PEEAA 381


>gi|217975051|ref|YP_002359802.1| HemY domain-containing protein [Shewanella baltica OS223]
 gi|217500186|gb|ACK48379.1| HemY domain protein [Shewanella baltica OS223]
          Length = 388

 Score = 86.5 bits (213), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 57/403 (14%), Positives = 135/403 (33%), Gaps = 32/403 (7%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAW-ILLF 59
           M++++ +  ++ + +C    +      V I  G+    TS    +  L  F   + +L +
Sbjct: 1   MIKILIFLGIVLIGLCISPWLVGNTGYVYIAAGDYQIETSLVFGIIALIVFYAVFQVLEW 60

Query: 60  AVSRFFLS-CPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLA-RKMHSYVSQQHTFH 117
            V         +       +R   K +  +  G +++A  + P A R M           
Sbjct: 61  LVISAINLMLRSRFIPHHWRRRSAKKHTLM--GALALAEEDWPAAERAMIKGADNGELPA 118

Query: 118 NEYLVYLLEVQ----IALAER--QYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLN 171
              L      Q    IA  ++      A       +    TR          +    D  
Sbjct: 119 LNLLAAARAAQYQQKIAERDQYLDRAAAQPLAANAVATTRTRYLLKQGELTLARAELD-- 176

Query: 172 SAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFL---NQKKKNAKEWNRNRAIL 228
              + A  +   +P         ++ Y   ++W  A+  L    +K++   +   N   +
Sbjct: 177 ---KLAPTSKSKAPVLKLA----LELYRTQEDWD-ALKLLIPILKKRQILDDAQLNELNI 228

Query: 229 LIARSLENADKGDMIASYHDAIE----SLKLCDNSIMASICAAKSLISQNKKRKAEVILE 284
               +L  A       +     +    S +     +      A  L   N+K +A  ++ 
Sbjct: 229 ATNCALLKAAAIKGEEALEQCWQWLSRSERNQSEFL---AIYAMGLCRFNRKDQALKLIA 285

Query: 285 KIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQA 344
           K  + +P   + +    + +       K+ L+ E  ++ + +  + ++K+  +   + +A
Sbjct: 286 KKLRTSPESALLHAIPEIATAQDTEIRKQLLKHEVTHENNADYQMCLAKLYQQTRDMKEA 345

Query: 345 HAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALH 387
            +      ++ P K  +L LA+I++             + A++
Sbjct: 346 RSCLQNVCRLEPTKASWLALARIQE-QLGEQGNANQSYRQAVN 387


>gi|54298730|ref|YP_125099.1| protoporphyrinogen IX and coproporphyrinogen III oxidase HemY
           [Legionella pneumophila str. Paris]
 gi|53752515|emb|CAH13947.1| protoporphyrinogen IX and coproporphyrinogen III oxidase HemY
           [Legionella pneumophila str. Paris]
          Length = 395

 Score = 86.5 bits (213), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 63/378 (16%), Positives = 122/378 (32%), Gaps = 41/378 (10%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++  F ++ L +   I ++  P  V I   N    T+ +V    L+F  F    L  
Sbjct: 1   MIRVLFAFIILLLSVFLGIQLNKDPGYVLIAINNWTIETTLWVSAFGLFFLFFLIYGLVQ 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +       P M+     +R   K       GL+  +      A+  +  +          
Sbjct: 61  LCNKITRMPGMVNKWHSRRLAQKAQATTRKGLIEYSEGYWQKAK--NHLIQALPNTDTPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKL--EMMLQIPATREFAVYSLYFESCRIGDLNSAQRYA- 177
           L YL   + A       +  +    E    +P  +             +    +  + A 
Sbjct: 119 LNYLTAARAAQKMGDSKL-RDHYLREAQQSMPEAK-----------IAVELTQAQLQLAN 166

Query: 178 ---TKALD-------ISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNR 223
               +AL        ++P  P+V + ++  Y   K+W + I  L   KKN     + + +
Sbjct: 167 HQWEQALATLKHLQDLAPRHPYVLKLLMNLYEEIKDWQQLIALLPDLKKNHIISDQAFEQ 226

Query: 224 NRAILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAE--- 280
            +    +   ++ A                K   N    +   A+ LI      +AE   
Sbjct: 227 LQKNTYLQAMIDLAKHNQSDGITKLYQTLPKTMVNDTAITAEYARFLIRNQDYDQAEYHL 286

Query: 281 -VILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMG 339
              L K         +  +Y+ L  E     L  A  L + N  S    + + ++ L   
Sbjct: 287 RRCLRKELDNR----LIELYSLLPCEENQ--LLFAESLLKKNPHSAALYLCLGRMCLSRH 340

Query: 340 SIDQAHAKAMLAMKIAPR 357
              +A      ++++ P 
Sbjct: 341 LWGKAKHYLEQSIELNPT 358


>gi|325266581|ref|ZP_08133258.1| HemY family protein [Kingella denitrificans ATCC 33394]
 gi|324982024|gb|EGC17659.1| HemY family protein [Kingella denitrificans ATCC 33394]
          Length = 400

 Score = 86.5 bits (213), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 66/400 (16%), Positives = 140/400 (35%), Gaps = 19/400 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M +L+    + +L I   I    Y  +V +   + + R +  + +  L   + A  +L  
Sbjct: 1   MKQLLWIIILFALAIGVAIATRTYTGNVYLVIEHTMIRVNLHLFVLGLVASVVALYILVR 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           +    LS P  L      R   K  ++L    ++        A+     V       ++ 
Sbjct: 61  LIAGILSTPDKLSRFGVGRRNRKATQSLNAAGLAYFEGKFQEAQAQADKVLANKEAGDKR 120

Query: 121 LVYLLEVQIALAERQYNIAHEKL-EMMLQIPATREFAVYSLYFE-SCRIGDLNSAQRYAT 178
           ++ L+    A  +     A ++    + ++P   + + + L  E +    +   A+ +  
Sbjct: 121 ILALMLAAHAADQSGNAEARDQYLHDIEKLPEKTQLSRHLLLAESAINQQNDEEAENHLK 180

Query: 179 KALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQ--KKKNAKEWNRNRAILLIARSLEN 236
            A  I+P    +    ++  +       A+  L++  K + A   N N A  L  R+   
Sbjct: 181 AAAQINPRLTRLVRLQLRHALDKG---NALEILDKVDKLRRAGAMNDNEAEQLSERAYAQ 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASICAAKS---LISQNKKRKAEVILEKIWKVNPHP 293
                  A+   A   LK   +S+ A   +A             KA   + + +  N   
Sbjct: 238 LLSLAQDAAGLKAC--LKRIPDSLKAGALSAAIAQKYAELGLYDKAVAWVNQYYPQNHRA 295

Query: 294 EIANIYT----HLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAM 349
           ++ +++     +L        +  A      N    + L  +  +A       +A     
Sbjct: 296 DLLSVFVQSAQYLDEYGQQKAIDTADAWLRQNPNDPKLLAALGDLAYHRQLWGKAQGYLE 355

Query: 350 LAMKIAPRKEIFLLLAQI-EQANSHNTDKILYWTQSALHA 388
            ++++ P     L LA++ EQ+  HN  +     + AL A
Sbjct: 356 ASLRLEPTVHARLTLAKVFEQSQRHNDAQEQR--RLALSA 393


>gi|288550561|ref|ZP_05970917.2| HemY protein [Enterobacter cancerogenus ATCC 35316]
 gi|288314624|gb|EFC53562.1| HemY protein [Enterobacter cancerogenus ATCC 35316]
          Length = 401

 Score = 86.1 bits (212), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 57/381 (14%), Positives = 113/381 (29%), Gaps = 24/381 (6%)

Query: 11  ISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPA 70
           I+ ++   + ++ +   V I   N    TS   ++ IL   +     +  + R      A
Sbjct: 14  IAGIVLGPM-LAGHQGYVLIQTDNYNVETSVTGLVIILILGVVVLFAVEWILRRIFRTGA 72

Query: 71  MLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARK-MHSYVSQQHTFHNEYLVYLLEVQI 129
                   R   +  K     L+ +A  +     K M              + YLL  + 
Sbjct: 73  HTRGWFVGRKRRRARKQTEQALLKLAEGDYQQVEKLMSKNADH---AEQPVVNYLLAAEA 129

Query: 130 ALAERQYNIAHEKLEMMLQ--------IPATREFAVYSLYFESCRIGDLNSAQRYATKAL 181
           A        A++ LE   +        +  TR               + ++A+    + L
Sbjct: 130 AQQRGDEARANQHLERASELSPKDPIPVEITRV-------RLQLARNENHAARHGVDRLL 182

Query: 182 DISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN--AKEWNRNRAILLIARSLENADK 239
           +I+P  P V     Q Y+    W   +  +    K     + +R+    L    L +  +
Sbjct: 183 EITPRHPEVLRLAEQAYIRTGAWGSLLDIIPSMAKADVGDDEHRDELQRLAWIGLMDQAR 242

Query: 240 GD--MIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIAN 297
            D              +     I   +  A+ LI  +    A+ IL    K      +  
Sbjct: 243 ADLGSDGLKTWWKNQSRKTRQQIPLQVAMAEHLIECDDHDTAQEILLDGLKRQYDDRLVM 302

Query: 298 IYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPR 357
           +   L + N     K   +  +   +       + +  ++ G   +A      A+K  P 
Sbjct: 303 VIPRLRTNNPEQIEKVLRQQIKTVGDRPLLWSTLGQSLMKHGEWQEASLAFRAALKQRPD 362

Query: 358 KEIFLLLAQIEQANSHNTDKI 378
              +  LA          +  
Sbjct: 363 AFDYAWLADSLDKQHKPEEAA 383


>gi|254515496|ref|ZP_05127556.1| HemY domain protein [gamma proteobacterium NOR5-3]
 gi|219675218|gb|EED31584.1| HemY domain protein [gamma proteobacterium NOR5-3]
          Length = 414

 Score = 86.1 bits (212), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 55/390 (14%), Positives = 131/390 (33%), Gaps = 26/390 (6%)

Query: 6   RYFFVISLVICSFIIVS---HYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVS 62
            +   +  ++    IV+     P  + I +G     TS +V + ++   +          
Sbjct: 4   LFVIALLALVAGVGIVALIETEPGYLLIAYGGYTVETSFWVGILLIATVVLLLYASLRFL 63

Query: 63  RFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLV 122
              ++ PA + +   +R   +  +    GL++    N   +RK    +       +  L 
Sbjct: 64  HRLITSPANVLNWAGERRLRQSARLTSRGLINFVEGNWAQSRK--QLLRGARYSESPLLN 121

Query: 123 YLLEVQIA------LAERQY--NIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQ 174
           YL+  + +       A R++    A   +E ++ +  T+                   A 
Sbjct: 122 YLMSARASYRLQEPEAMRRHLVQAAESDIEAIIAVDLTQA-------ELQLNDRQYEKAL 174

Query: 175 RYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKN----AKEWNRNRAILLI 230
           +    A       P V   + + Y    +    +  L   +K+    A E ++  A +  
Sbjct: 175 KTLEGAKKTPGKHPQVLHLLCKAYDGLGDIEAMLALLPALRKHRVGGALELDKLEARIHH 234

Query: 231 ARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
               + A  GD         +  K   +     +    SL+  ++    E  +E+  K +
Sbjct: 235 DLLEQAAVTGDAALLMARWKKYPKRLVDDEAVQLHYLSSLLQCDETSTVEREIERRLKKH 294

Query: 291 PHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
             P + ++Y  +  ++   +L  A      + +  E L+ + ++A+      +A      
Sbjct: 295 WQPALVSLYGRIPRQSAQKQLATAEVWLRQHSDDPELLLCLGRLAMVERQWAKARDFLER 354

Query: 351 AMKIAPRKEIFLLLAQI--EQANSHNTDKI 378
           +    P +E  L L ++     +     ++
Sbjct: 355 SHAARPSEEACLELGRLLTAVGDHATAAEV 384


>gi|304412543|ref|ZP_07394149.1| HemY domain protein [Shewanella baltica OS183]
 gi|307307202|ref|ZP_07586940.1| HemY domain protein [Shewanella baltica BA175]
 gi|304349185|gb|EFM13597.1| HemY domain protein [Shewanella baltica OS183]
 gi|306910441|gb|EFN40872.1| HemY domain protein [Shewanella baltica BA175]
          Length = 388

 Score = 85.8 bits (211), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 57/403 (14%), Positives = 135/403 (33%), Gaps = 32/403 (7%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAW-ILLF 59
           M++++ +  ++ + +C    +      V I  G+    TS    +  L  F   + +L +
Sbjct: 1   MIKILIFLGIVLIGLCISPWLVGNTGYVYIAAGDYQIETSLVFGIIALIVFYAVFQVLEW 60

Query: 60  AVSRFFLS-CPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLA-RKMHSYVSQQHTFH 117
            V         +       +R   K +  +  G +++A  + P A R M           
Sbjct: 61  LVISAINLMLRSRFIPHHWRRRSAKKHTLM--GALALAEEDWPAAERAMVKGADNGELPA 118

Query: 118 NEYLVYLLEVQ----IALAER--QYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLN 171
              L      Q    IA  ++      A       +    TR          +    D  
Sbjct: 119 LNLLAAARAAQYQQKIAERDQYLDRAAAQPLAANAVATTRTRYLLKQGELALARTELD-- 176

Query: 172 SAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFL---NQKKKNAKEWNRNRAIL 228
              + A  +   +P         ++ Y   ++W  A+  L    +K++   +   N   +
Sbjct: 177 ---KLAPTSKSKAPVLKLA----LELYRTQEDWD-ALKLLIPILKKRQILDDAQLNELNI 228

Query: 229 LIARSLENADKGDMIASYHDAIE----SLKLCDNSIMASICAAKSLISQNKKRKAEVILE 284
               +L  A       +     +    S +     +      A  L   N+K +A  ++ 
Sbjct: 229 ATNCALLKAAAIKGEEALEQCWQWLSRSERNQSEFL---AIYAMGLCRFNRKDQALKLIA 285

Query: 285 KIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQA 344
           K  + +P   + +    + +       K+ L+ E  ++ + +  + ++K+  +   + +A
Sbjct: 286 KKLRTSPESALLHAIPEIATAQDTEIRKQLLKHEVTHENNADYQMCLAKLYQQTRDMKEA 345

Query: 345 HAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALH 387
            +      ++ P K  +L LA+I++             + A++
Sbjct: 346 RSCLQNVCRLEPTKNSWLALARIQE-QLGEQGHANQSYRQAVN 387


>gi|114321814|ref|YP_743497.1| HemY domain-containing protein [Alkalilimnicola ehrlichii MLHE-1]
 gi|114228208|gb|ABI58007.1| HemY domain protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 435

 Score = 85.8 bits (211), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 52/380 (13%), Positives = 129/380 (33%), Gaps = 25/380 (6%)

Query: 20  IVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKR 79
            +  +   + ++       TS    +  +   L    +L+ +    +  P +L H   +R
Sbjct: 20  WLQPHTGYLVLSVAGWRIETSLIFAVLAVAVVLVVLQVLWVLLDRTVGLPKVLSHWSTRR 79

Query: 80  NYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIA 139
             +K    +  GL+++A       R+    + +     +  L+  L   +    R     
Sbjct: 80  RKEKARGEMAKGLLALAEGRY---RRGEDLLLKHVERSDYPLINYLGAALCAQRRHATET 136

Query: 140 HEKLEMMLQIPATREFAVYSLYFESC---RIGDLNSAQRYATKALDISPDAPWVTEAVVQ 196
            +    + +    R         ++      G    A    T A + +P+     E +  
Sbjct: 137 RDSYLALAE-QTARGSGSAVNLLQAQLYMESGQWEQALASLTSAYERNPNHHRTLEMMRD 195

Query: 197 QYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADK------GDMIASYHDAI 250
             V  ++W R    L   +K     +          + +   +      GD+ +++    
Sbjct: 196 CCVALEDWERLGRLLKPLRKQGIIGSEEAEEYARYVARDKIRRAARIGLGDLESAWSRLP 255

Query: 251 ESLKLCDNSIMASICAAKSLISQNKKRKAEVILE----KIWKVNPHPEIANIYTHLLSEN 306
            + +  D+ +   +  A++L+  ++  +A V+L+    + W       +   +  L   +
Sbjct: 256 RAQRNDDDLV---LTHAEALLELDEIDRAAVVLKGRIDETWDER----LIMRFGALEQID 308

Query: 307 TVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQ 366
              +L++  R      ++   L +  ++AL +   D A      A+    R E+++ L  
Sbjct: 309 PEWQLQQLKRWLRQQPDNAALLYVAGRVALRLHDWDLAREYLEQALARRARPEVYMALGA 368

Query: 367 IEQANSHNTDKILYWTQSAL 386
           + +      D      + AL
Sbjct: 369 LLEFQERPDD-ARELYRKAL 387


>gi|56476044|ref|YP_157633.1| putative protein porphyrin biosynthesis [Aromatoleum aromaticum
           EbN1]
 gi|56312087|emb|CAI06732.1| putative protein porphyrin biosynthesis [Aromatoleum aromaticum
           EbN1]
          Length = 392

 Score = 85.8 bits (211), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 57/410 (13%), Positives = 126/410 (30%), Gaps = 59/410 (14%)

Query: 2   LRLIRYFFVISLVICSFIIVSH-YPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           +R + +   +  +     +++      V +       + S  +++  L    F   ++  
Sbjct: 1   MRTLLWLIALFALAAGVAMLASVNTGYVLVVLPPWRAQLSLNLLIVALLATFFIGYVVLR 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYV---------- 110
           +    ++ P  +     +R  DK  +AL  GL ++       A K+              
Sbjct: 61  LVGKTIALPGRVGVFRERRRKDKAGRALREGLRALFEGRFAQALKLSGKAFDAGESRSMA 120

Query: 111 -----SQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESC 165
                   H  H++    +   + A  E +  +A    E  L I   R          + 
Sbjct: 121 ALVAARAAHGMHDDTRYRIWIGRAAEQEEEVRVARLMTEAELAIEGRRFE------EAAE 174

Query: 166 RIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNR 225
           R+ +L  +      AL +S          ++       W   +    Q +K+        
Sbjct: 175 RLENLRLSGHRHIAALRLS----------LKVASALGHWEEVLRLARQLRKHKA------ 218

Query: 226 AILLIARSLENADKGDMIASYHDAIESLKLCD--NSIMASICAAKSLISQNKKRKAE--- 280
             L   ++     +  +      A +   L     SI A+    + ++ +     A    
Sbjct: 219 --LTDEQAQPVVRRAHVERIRELARDGEALAAYWRSIPAAELGDRHMVEEAVPYLAAAGQ 276

Query: 281 ---------VILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIV 331
                     +L+  W       +A +Y    + +  G L R       + +  + L  +
Sbjct: 277 GALVRKTVERMLDTEWDGG----LARLYAQCANGDAAGCLARGEGWLRKHPKDADLLYAL 332

Query: 332 SKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQI-EQANSHNTDKILY 380
            ++ L      +A +    ++ +AP  E  L LA + E+          Y
Sbjct: 333 GRLCLAAQLWGKAQSYLEASLNLAPTIETHLALAHLFERLERAEEAHTHY 382


>gi|262404854|ref|ZP_06081408.1| HemY-like protein [Vibrio sp. RC586]
 gi|262348938|gb|EEY98077.1| HemY-like protein [Vibrio sp. RC586]
          Length = 398

 Score = 85.8 bits (211), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 62/382 (16%), Positives = 118/382 (30%), Gaps = 18/382 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RLI  F V+ L +      +     V I+  NR    S   ++  +   L A   L  
Sbjct: 1   MIRLIFLFVVLGLGLFVGTQYAGQQGYVLISIANRTIEMSVTTLVIFIIAALAALFALEF 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  L      ++    R   +  +    G++ +   +   A K  +  +  H      
Sbjct: 61  LVKKILYTSFHTWNWFSVRKLRRSRRYTNEGIIKLLEGDWKQAEKKVTRWANHH--DMPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAV---YSLYFESCRIGDLNSAQRYA 177
           L YL+  + A          +    +         AV        +    GD  +A    
Sbjct: 119 LCYLVASEAANGMGDRAK-RDHYLALAAKQDNATLAVELTR--AKQQLSDGDNEAALSTL 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENA 237
           T+  +  P    V   + Q Y    +W   +  L +  K  +  N     L +       
Sbjct: 176 TQLQNSYPHNTVVLNLLKQCYQALGQWQPLLELLPKLVKAKRLTNEEAQQLELTAQRGIL 235

Query: 238 -----DKGDMIASYHDAIESLKLC--DNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
                 KG      H A  S KL      +M  I     LI +    +A  ++++  K  
Sbjct: 236 QSIASQKGSEGLVQHWAQMSRKLKAEPELLMCFIT---QLIQRKADYEAFSVIKESLKKQ 292

Query: 291 PHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           P  E+  +   L   +    +         +  + E+   + ++ L       A      
Sbjct: 293 PTAELYALLPELNITDRHPLIALLEEALRRDSHNAEAHSALGQLYLREKHWADAQKHLEK 352

Query: 351 AMKIAPRKEIFLLLAQIEQANS 372
           A+ +      +  LA   +  +
Sbjct: 353 ALSLRSSVSDYAYLADALEKQN 374


>gi|283834565|ref|ZP_06354306.1| HemY protein [Citrobacter youngae ATCC 29220]
 gi|291069695|gb|EFE07804.1| HemY protein [Citrobacter youngae ATCC 29220]
          Length = 400

 Score = 85.0 bits (209), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 52/365 (14%), Positives = 107/365 (29%), Gaps = 11/365 (3%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I   N    TS   ++ IL   +     +  + R      A        R 
Sbjct: 22  MAGHQGYVLIQTDNYNIETSVTGLVIILIVAMVILFAIEWLLRRIFRTGAHTRGWFVGRK 81

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ S  +         + YLL  + A        A+
Sbjct: 82  RRRARKQTEQALLKLAEGDYQQVEKLMSKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 139

Query: 141 EKLEM---MLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQ 197
           + LE    +                      + ++A+    K L+++P  P V     Q 
Sbjct: 140 QHLERAAELAGNDTIPVEIAR--VRLQLARNENHAARHSVDKLLEVTPRHPEVLRLAEQA 197

Query: 198 YVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIAS----YHDAIESL 253
           Y+    WS  +  +    K       +RA+L     +   D+                  
Sbjct: 198 YIRTGAWSSLLDIIPSMAKAHVGDEEHRAMLEQQAWVGLMDQVRADQGSEGLRAWWKNQN 257

Query: 254 KLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKR 313
           +   + +   +  A+ LI  +    A+ ++    K      +      L + N     K 
Sbjct: 258 RKTRHQVALQVAMAEHLIECDDHDTAQQVIIDGLKRQYDDRLVLPIPRLKTNNPEQIEKV 317

Query: 314 ALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSH 373
             +  +   +       + +  ++ G   +A      A+K  P    +  LA        
Sbjct: 318 LRQQIKAVGDRPLLWSTLGQSLMKHGEWQEATLAFRAALKQRPDAYDYAWLADALDRLHQ 377

Query: 374 NTDKI 378
             +  
Sbjct: 378 PEEAA 382


>gi|253690344|ref|YP_003019534.1| HemY protein [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251756922|gb|ACT14998.1| HemY protein [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 399

 Score = 85.0 bits (209), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 54/365 (14%), Positives = 119/365 (32%), Gaps = 9/365 (2%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           V+ +   V I   N   +TS   ++ +L  F  A++ +  V R      A        R 
Sbjct: 23  VAGHQGYVLIQTDNYDIQTSVTGLVIMLVLFFLAFLAVEWVLRRIFRTGARTRGWFLGRK 82

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A          
Sbjct: 83  RTRARKQTKAALLKLAEGDYLQVEKLLTRNADHA--EQPVVNYLLAAEAAQQRGDEFRTK 140

Query: 141 EKLEMMLQIPATREFAV-YSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYV 199
           + LE   ++  T +  V  +         + ++A+    K L+++P  P V     Q ++
Sbjct: 141 QYLERAAEVADTDQLPVDITRVRIQLARNEDHAARHGVDKLLEVAPRHPEVLRLAEQAFL 200

Query: 200 LAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSL-----ENADKGDMIASYHDAIESLK 254
               +S  +  L   +K    +   R + L  ++      +    G             +
Sbjct: 201 RTHAYSALLDILPAMRKINL-YPEARLLDLQQQAYIGLMNQAMADGGSEGLKSWWNNQSR 259

Query: 255 LCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRA 314
              + I   +  A+ LI  +    A+ I+    K      +  +   L + N     K  
Sbjct: 260 KVRHEIPLQVAMAEHLIECDDHDTAQKIILDGLKRQYDERLILLMPRLKAGNPEQLEKVL 319

Query: 315 LRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHN 374
            +  + +  +      + ++ ++ G   QA      A+++ P    +   A   +     
Sbjct: 320 HQYTKQHGTTPLLSSTLGQLLMKHGEWQQASDAFRAALELRPDAYDYAWRADALERLHLP 379

Query: 375 TDKIL 379
            +   
Sbjct: 380 DEAAQ 384


>gi|332284593|ref|YP_004416504.1| hypothetical protein PT7_1340 [Pusillimonas sp. T7-7]
 gi|330428546|gb|AEC19880.1| hypothetical protein PT7_1340 [Pusillimonas sp. T7-7]
          Length = 511

 Score = 85.0 bits (209), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 67/501 (13%), Positives = 146/501 (29%), Gaps = 83/501 (16%)

Query: 23  HYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRNYD 82
            +  +V I         S  + + ++         L  V  +    P        +R+  
Sbjct: 23  EHSGNVLIVAQPWRVELSLTLAVLLILASFVILYCLLRVLAWIGVRPERFRSWRSQRSQK 82

Query: 83  KGYKALYTGLMSIAAHNIPLARK-MHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHE 141
           + ++ L  G +++     P A K +   +++  +   + L  L   + +    +Y     
Sbjct: 83  REHELLENGWINVLEGRYPDAEKDLSKLLTRSKSKSRKVLAGLASARASQHMGEY----- 137

Query: 142 KLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWV----------- 190
                                     G  + A   A +    +P                
Sbjct: 138 --------------------------GRRDEALTLARQNAQDNPRLSEATAIVAAEMYLD 171

Query: 191 ----TEAVV---QQYVLAKEWSRAITFLNQKKKNAKEWNR---------NRAILLIARSL 234
                +A+V           +  A   L +  +  +  +R          R +L  + ++
Sbjct: 172 QNRPQDALVLLQPLQDATTRYFHATRLLLRAHRQLRNHDRVFELTRLLSRRGVLEKSEAV 231

Query: 235 ENADKGDMIASYHDAIESLK-----LCDN---SIMASICAAKSLISQNKKRKAEVILEKI 286
           +  +           +E  K     L  +       ++ AA    +Q    +A  ILE  
Sbjct: 232 QLIETSAAARLRAGGVEGFKSIWSDLKSDERALPDVALAAADIQTAQGNIDEASKILETG 291

Query: 287 WKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHA 346
                 P + N Y+    E+   +L +A    + + +    L  +  + L      Q   
Sbjct: 292 ISARLDPRLLNAYSQCPPEHVARRLSKAEDWLKTHPDDSALLAALGNLCLTGQLWGQGER 351

Query: 347 KAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWL 406
             + +MKI     I  LL  +        D + +W  ++  A          G      L
Sbjct: 352 YLLRSMKIRSDMRIHALLGNLYDRLGRPNDAMTHWRLASGVA----------GV-----L 396

Query: 407 PLSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKV 466
           P+ P S++L   + +      +          L          +       + + + + V
Sbjct: 397 PVLPSSRSLPAADTRGDPTLVDVERLPPEAQVLRDMQVPLAASAADFVNDDDFVSAGQPV 456

Query: 467 SSFED-STIHPLDPHIRQPDD 486
           +      ++ P  P ++QP D
Sbjct: 457 AGPAGADSVAPATPAVQQPID 477


>gi|311281519|ref|YP_003943750.1| HemY protein [Enterobacter cloacae SCF1]
 gi|308750714|gb|ADO50466.1| HemY protein [Enterobacter cloacae SCF1]
          Length = 398

 Score = 85.0 bits (209), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 56/370 (15%), Positives = 110/370 (29%), Gaps = 21/370 (5%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I        TS   +  ++   +     +  V R  L   A        R 
Sbjct: 21  IAGHQGYVLIQTDTYNIETSVTGLAIVMILAMAVLFAIEWVLRRLLRTGAHTRGWFVGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ S  +         + YLL  + A        A+
Sbjct: 81  RRRARKQTEQALLKLAEGDYQQVEKLMSKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 138

Query: 141 EKLEM--------MLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
           + LE         ++ +  TR               + ++A+    K L+I+P  P V  
Sbjct: 139 QHLERAAEIAGNDLIPVEITRV-------RLQLARNENHAARHGVDKLLEIAPRHPEVLR 191

Query: 193 AVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGD----MIASYHD 248
              Q Y     WS  I  +    K     +  RA L     +   D+           + 
Sbjct: 192 LAEQAYTRTGAWSSLIDIIPSMGKANVVDDAQRAALEQQAWIGLMDQAQANDGSEGLRNW 251

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
                +   + +   +  A+ LI  +    A+ I+    K +    +      L + N  
Sbjct: 252 WKNQSRKTRHDVALQVAMAEHLIECDDHDTAQQIVIDGLKRHYDDRLLAPIPRLKTNNPE 311

Query: 309 GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIE 368
              K   +  +   +       + +  ++ G   +A      A+K  P    +  LA   
Sbjct: 312 QLEKVLRQQLKTVGDRPLLWSTLGQSLMKHGEWQEATLAFRAALKQRPDAFDYAWLADAL 371

Query: 369 QANSHNTDKI 378
                  +  
Sbjct: 372 DRQHQPEEAA 381


>gi|261210175|ref|ZP_05924472.1| HemY-like protein [Vibrio sp. RC341]
 gi|260840715|gb|EEX67264.1| HemY-like protein [Vibrio sp. RC341]
          Length = 398

 Score = 84.6 bits (208), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 67/385 (17%), Positives = 120/385 (31%), Gaps = 24/385 (6%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RLI  F V+ L +      +     V I+  NR    S   ++  +   L A   L  
Sbjct: 1   MIRLIFLFVVLGLGLFVGTQYAGQQGYVLISIANRTIEMSVTTLVIFIIAALAALFALEF 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  L      ++    R   +  +    G++ +   +   A K  +  +  H      
Sbjct: 61  LVKKILYTSFHTWNWFSVRKLRRSRRYTNEGIIKLLEGDWKQAEKKVTRWANHH--DMPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAV---YSLYFESCRIGDLNSAQRYA 177
           L YL+  + A          +    +         AV        +    GD  +A    
Sbjct: 119 LCYLVASEAANGMGDRAK-RDHYLALAAQQDNATLAVELTR--AKQQLSDGDNTAALTTL 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENA 237
           T+  +  P    V   + Q Y    EW   +  L +  K  +  N     L +       
Sbjct: 176 TQLQNSHPHNTVVLSLLNQCYQALGEWQPLLDLLPKLVKAKRLSNEEAQQLELTAQRGML 235

Query: 238 -----DKGDMIASYHDAIESLKLC--DNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
                 KG      H A  S KL      +M  I     LI +    +A  ++++  K  
Sbjct: 236 QSIASQKGSEGLVQHWAQMSRKLKAEPELLMCFI---NQLIERKADYEAFSVIKESLKKQ 292

Query: 291 PHPEIANIYTHLLSENTVGKLKRALRLE---EINKESVESLVIVSKIALEMGSIDQAHAK 347
           P    A +Y  L   N   +      LE     +  + E+   + ++ L       A   
Sbjct: 293 PT---AELYALLPELNIPDRHPLIAVLEDALRRDSNNAEAHSALGQLYLREKHWADAQKH 349

Query: 348 AMLAMKIAPRKEIFLLLAQIEQANS 372
              A+ +      +  LA   +  +
Sbjct: 350 LEKALSLRSSVSDYAYLADALEKQN 374


>gi|284923905|emb|CBG37004.1| Porphyrin biosynthetic protein [Escherichia coli 042]
          Length = 398

 Score = 84.6 bits (208), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 53/370 (14%), Positives = 109/370 (29%), Gaps = 21/370 (5%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I   N    TS   +  IL   +     +  + R               R 
Sbjct: 21  IAGHQGYVLIQTDNYNIETSVTGLAIILILAMVVLFAIEWLLRRIFRTGTHTRGWFVGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A        A+
Sbjct: 81  RRRARKQTEQALLKLAEGDYQQVEKLMAKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 138

Query: 141 EKLEMMLQ--------IPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
           + LE   +        +  TR               + ++A+    K L+++P  P V  
Sbjct: 139 QHLERAAELAGNDTIPVEITRV-------RLQLARNENHAARHGVDKLLEVTPRHPEVLR 191

Query: 193 AVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIAS----YHD 248
              Q Y+    WS  +  +    K       +RA+L     +   D+           + 
Sbjct: 192 LAEQAYIRTGAWSSLLDIIPSMAKAHVGDEEHRAMLEQQAWIGLMDQARADNGSEGLRNW 251

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
                +   + +   +  A+ LI  +    A+ I+    K      +      L + N  
Sbjct: 252 WKNQSRKTRHQVALQVAMAEHLIECDDHDTAQQIIIDGLKRQYDDRLLLPIPRLKTNNPE 311

Query: 309 GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIE 368
              K   +  +   +       + +  ++ G   +A      A+K  P    +  LA   
Sbjct: 312 QLEKVLRQQIKNVGDRPLLWSTLGQSLMKHGEWQEASLAFRAALKQRPDAYDYAWLADAL 371

Query: 369 QANSHNTDKI 378
                  +  
Sbjct: 372 DRLHKPEEAA 381


>gi|262172876|ref|ZP_06040554.1| HemY-like protein [Vibrio mimicus MB-451]
 gi|261893952|gb|EEY39938.1| HemY-like protein [Vibrio mimicus MB-451]
          Length = 398

 Score = 84.6 bits (208), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 63/382 (16%), Positives = 118/382 (30%), Gaps = 18/382 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RLI  F V+ L +      +     V I+  NR    S   ++  +   L A   L  
Sbjct: 1   MIRLIFLFVVLGLGLFVGTQYAGQQGYVLISIANRTIEMSVTTLVIFIIAALAALFALEF 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V +  L      ++    R   +  +    G++ +   +   A K  +  +  H      
Sbjct: 61  VIKKILYTSFHTWNWFSVRKLRRSRRYTNEGIIKLLEGDWKQAEKKVTRWANHH--DMPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAV---YSLYFESCRIGDLNSAQRYA 177
           L YL+  + A          +    +         AV        +    GD  +A    
Sbjct: 119 LCYLVASEAANGMGDLAK-RDHYLALAAKQDNATLAVELTR--AKQQLSDGDNEAALNTL 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENA 237
           T+  +  P    V   + Q Y    +W   +  L +  K  +  N     L +       
Sbjct: 176 TQLQNSHPHNTVVLNLLKQCYQALSQWQPLLELLPKLVKAKRLTNEEAQQLELTAQRGIL 235

Query: 238 -----DKGDMIASYHDAIESLKLC--DNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
                 KG      H A  S KL      +M  I     LI +    +A  ++++  K  
Sbjct: 236 QSIASQKGSEGLVQHWAQMSRKLKAEPELLMCFIT---QLIQRKADYEAFSVIKESLKKQ 292

Query: 291 PHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           P  E+  +   L   +    +         +  + E+   + ++ L       A      
Sbjct: 293 PTAELYALLPELNITDRHPLIALLEDALRRDSNNAEAHSALGQLYLREKHWADAQKHLEK 352

Query: 351 AMKIAPRKEIFLLLAQIEQANS 372
           A+ +      +  LA   +  +
Sbjct: 353 ALSLRSSVSDYAYLADALEKQN 374


>gi|254039013|ref|ZP_04873064.1| HemY protein [Escherichia sp. 1_1_43]
 gi|226838704|gb|EEH70732.1| HemY protein [Escherichia sp. 1_1_43]
          Length = 398

 Score = 84.6 bits (208), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 54/370 (14%), Positives = 110/370 (29%), Gaps = 21/370 (5%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I   N    TS   +  IL   +     +  + R      A        R 
Sbjct: 21  IAGHQGYVLIQTDNYNIETSVTGLAIILILAMVVLFAIEWLLRRIFRTGAHTRGWFVGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A        A+
Sbjct: 81  RRRARKQTEQALLKLAEGDYQQVEKLMAKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 138

Query: 141 EKLEMMLQ--------IPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
           + LE   +        +  TR               + ++A+    K L+++P  P V  
Sbjct: 139 QYLERAAELAGNDTIPVEITRV-------RLQLARNENHAARHGVDKLLEVTPRHPEVLR 191

Query: 193 AVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIAS----YHD 248
              Q Y+    WS  +  +    K       +RA+L     +   D+           + 
Sbjct: 192 LAEQAYIRTGAWSSLLDIIPSMAKAHVGDEEHRAMLEQQAWIGLMDQARADNGSEGLRNW 251

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
                +   + +   +  A+ LI  +    A+ I+    K      +      L + N  
Sbjct: 252 WKNQSRKTRHQVALQVAMAEHLIECDDHDTAQQIIIDGLKRQYDDRLLLPIPRLKTNNPE 311

Query: 309 GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIE 368
              K   +  +   +       + +  ++ G   +A      A+K  P    +  LA   
Sbjct: 312 QLEKVLRQQIKNVGDRPLLWSTLGQSLMKHGEWQEASLAFRAALKQRPDAYDYAWLADAL 371

Query: 369 QANSHNTDKI 378
                  +  
Sbjct: 372 DRLHKPEEAA 381


>gi|293393885|ref|ZP_06638192.1| porphoryin biosynthesis protein HemY [Serratia odorifera DSM 4582]
 gi|291423712|gb|EFE96934.1| porphoryin biosynthesis protein HemY [Serratia odorifera DSM 4582]
          Length = 397

 Score = 84.6 bits (208), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 48/364 (13%), Positives = 112/364 (30%), Gaps = 7/364 (1%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I   N    TS   +  +        +++  + R      A        R 
Sbjct: 21  LAGHQGYVLIQTDNYNIETSVTGLAIMGILLFVVLLVIEWILRRIFRTGARTRGWFLGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A         +
Sbjct: 81  RSRARKQTKAALIKLAEGDYKQVEKLLTRNADHA--EQPVVNYLLAAEAAQQRGDDFRTN 138

Query: 141 EKLEMMLQIPATREFAV-YSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYV 199
           + LE   +   T +  V  +        G+ ++A+    + L+ +P  P V     Q Y+
Sbjct: 139 QYLERAAEAADTDQLPVDITRVRIQLAQGEAHAARHGVDRLLNQAPRHPEVLRLAEQAYL 198

Query: 200 LAKEWSRAITFL----NQKKKNAKEWNRNRAILLIARSLENADKGDMIASYHDAIESLKL 255
               ++  +  L         + ++    +    I    +               +  + 
Sbjct: 199 RTGGYASLLEILPSMSKINLHSEEQLQALQQQAYIGLMNQAMADEGSEGLKRWWKDQSRK 258

Query: 256 CDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRAL 315
             + +   I   + LI  N    A+ I+    K      +  +   + S N     K   
Sbjct: 259 TRHEVPLQIAMVEHLIECNDHDMAQEIVIDSLKRQYDERLVLLIPRIKSGNAQQLEKALR 318

Query: 316 RLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNT 375
           +  + +  +      + ++ ++ G   QA      A+K  P    +  LA + +    + 
Sbjct: 319 QQIKQHGATPLLNSTLGQLLIKHGEWQQASDAFREALKQRPDAYDYAWLADVLEKLHRSE 378

Query: 376 DKIL 379
           +   
Sbjct: 379 EAAQ 382


>gi|319779682|ref|YP_004130595.1| HemY-like protein [Taylorella equigenitalis MCE9]
 gi|317109706|gb|ADU92452.1| HemY-like protein [Taylorella equigenitalis MCE9]
          Length = 444

 Score = 84.6 bits (208), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 56/395 (14%), Positives = 130/395 (32%), Gaps = 14/395 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           +++LI +F +   ++  F       + V +  GN     S    +  L        LLF 
Sbjct: 4   LIKLIIFFGLAIGLVLIFK---DNNDVVMLVTGNERRTVSLLTAVVFLLVAFLTLYLLFR 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQ-HTFHNE 119
           +  + LS P  +     +R++ K    L  G + +       A K    ++    +   +
Sbjct: 61  ILSWILSRPKAVADWSEERHHKKDIILLERGWVDLLEGRHYDAEKNFLKLTHHTKSTDRQ 120

Query: 120 YLVYLLEVQIALAERQYNIAHEKLE--MMLQIPATRE----FAVYS-LYFESCRIGDLNS 172
            L  +   +   A   Y    + L+   +L     +      AV + L  E    G  ++
Sbjct: 121 ILANIGAARAVHAIGDYARRDDLLKDARLLSKNNPKLDAAVVAVQADLLIE---QGQAHN 177

Query: 173 AQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIAR 232
           A  Y   A  +      +   +++ Y    + ++ +       +           LL   
Sbjct: 178 ALMYLEYADSVDGRQLHIKHQLLRAYEQTDQETKLLDTARFLFRKKSISKEEYMDLLDEF 237

Query: 233 SLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPH 292
             +   +     + +      K        ++  ++      +  K+   LE        
Sbjct: 238 GPKFISRSKYDGAVNFYNSLSKEEKQLENIALAISRRFDQLEEYSKSSQALETSLNAKLS 297

Query: 293 PEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAM 352
           P +   Y          +L +A +    +  + + L+ + ++ L      QA      ++
Sbjct: 298 PSVLAYYARAHESVANERLHKAQKWLNADANNPDLLLAIGQLCLANSLWGQAEKYLNQSL 357

Query: 353 KIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALH 387
           KI   ++I  LL  +      ++  + +W +++L 
Sbjct: 358 KIKDNEKIHALLGVLYDKQGEHSKALSHWRKASLS 392


>gi|126176190|ref|YP_001052339.1| HemY domain-containing protein [Shewanella baltica OS155]
 gi|125999395|gb|ABN63470.1| HemY domain protein [Shewanella baltica OS155]
          Length = 388

 Score = 84.2 bits (207), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 55/396 (13%), Positives = 130/396 (32%), Gaps = 32/396 (8%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAW-ILLF 59
           M++++ +  ++ + +C    +      V I  G+    TS    +  L  F   + +L +
Sbjct: 1   MIKILIFLGIVLIGLCISPWLVGNTGYVYIAAGDYQIETSLVFGIIALIVFYAVFQVLEW 60

Query: 60  AVSRFFLS-CPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLA-RKMHSYVSQQHTFH 117
            V         +       +R   K +  +  G +++A  + P A R M           
Sbjct: 61  LVISAINLMLRSRFIPHHWRRRSAKKHTLM--GALALAEEDWPAAERAMIKGADNGELPA 118

Query: 118 NEYLVYLLEVQ----IALAER--QYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLN 171
              L      Q    IA  ++      A       +    TR          +    D  
Sbjct: 119 LNLLAAARAAQYQQKIAERDQYLDRAAAQPLAANAVATTRTRYLLKQGKLALARAELD-- 176

Query: 172 SAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFL---NQKKKNAKEWNRNRAIL 228
              + A  +   +P         ++ Y   ++W  A+  L    +K++   +   N   +
Sbjct: 177 ---KLAPTSKSKAPLLKLA----LELYRTQEDWD-ALKLLIPILKKRQILDDAQLNELNI 228

Query: 229 LIARSLENADKGDMIASYHDAIE----SLKLCDNSIMASICAAKSLISQNKKRKAEVILE 284
               +L          +     +    S +     +      A  L   N+K +A  ++ 
Sbjct: 229 ATNCALLKGAAIKGEEALEQCWQWLSRSERNQSEFL---AIYAMGLCRFNRKDQALKLIA 285

Query: 285 KIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQA 344
           K  + +P   + +    + +       K+ L+ E  ++ + +  + ++K+  +   + +A
Sbjct: 286 KKLRTSPESALLHAIPEIATAQDTEIRKQLLKHEVTHENNADYQMCLAKLYQQTRDMKEA 345

Query: 345 HAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILY 380
            +      ++ P K  +L LA+I++           
Sbjct: 346 RSCLQNVCRLEPTKNSWLALARIQE-QLGEQGHANQ 380


>gi|153002484|ref|YP_001368165.1| HemY domain-containing protein [Shewanella baltica OS185]
 gi|151367102|gb|ABS10102.1| HemY domain protein [Shewanella baltica OS185]
          Length = 388

 Score = 84.2 bits (207), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 57/403 (14%), Positives = 134/403 (33%), Gaps = 32/403 (7%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAW-ILLF 59
           M++++ +  ++ + +C    +      V I  G+    TS    +  L  F   + +L +
Sbjct: 1   MIKILIFLGIVLIGLCISPWLVGNTGYVYIAAGDYQIETSLVFGIIALIVFYAVFQVLEW 60

Query: 60  AVSRFFLS-CPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLA-RKMHSYVSQQHTFH 117
            V         +       +R   K +  +  G +++A  + P A R M           
Sbjct: 61  LVISAINLMLRSRFIPHHWRRRSAKKHTLM--GALALAEEDWPAAERAMIKGADNGELPA 118

Query: 118 NEYLVYLLEVQ----IALAER--QYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLN 171
              L      Q    IA  ++      A       +    TR          +    D  
Sbjct: 119 LNLLAAARAAQYQQKIAERDQYLDRAAAQPLAANAVATTRTRYLLKQGELALARTELD-- 176

Query: 172 SAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFL---NQKKKNAKEWNRNRAIL 228
              + A  +   +P         ++ Y   ++W  A+  L    +K++   +   N   +
Sbjct: 177 ---KLAPTSKSKAPVLKLA----LELYRTQEDWD-ALKLLIPILKKRQILDDAQLNELNI 228

Query: 229 LIARSLENADKGDMIASYHDAIE----SLKLCDNSIMASICAAKSLISQNKKRKAEVILE 284
               +L  A       +     +    S +     +      A  L   N+K +A  ++ 
Sbjct: 229 ATNCALLKAAAIKGEEALEQCWQWLSRSERNQSEFL---AIYAMGLCRFNRKDQALKLIA 285

Query: 285 KIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQA 344
           K  +  P   + +    + +       K+ L+ E  ++ + +  + ++K+  +   + +A
Sbjct: 286 KKLRTAPESALLHAIPEIATAQDTEIRKQLLKHEVTHENNADYQMCLAKLYQQTRDMKEA 345

Query: 345 HAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALH 387
            +      ++ P K  +L LA+I++             + A++
Sbjct: 346 RSCLQNVCRLEPTKASWLALARIQE-QLGEQANANQSYRQAVN 387


>gi|237727918|ref|ZP_04558399.1| HemY [Citrobacter sp. 30_2]
 gi|226910367|gb|EEH96285.1| HemY [Citrobacter sp. 30_2]
          Length = 399

 Score = 83.8 bits (206), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 52/365 (14%), Positives = 108/365 (29%), Gaps = 11/365 (3%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I   N    TS   ++ IL   +     +  + R      A        R 
Sbjct: 21  IAGHQGYVLIQTDNYNIETSVTGLVIILIVAMVVLFAIEWLLRRIFRTGAHTRGWFVGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ S  +         + YLL  + A        A+
Sbjct: 81  RRRARKQTEQALLKLAEGDYQQVEKLMSKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 138

Query: 141 EKLEM---MLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQ 197
           + LE    +                      + ++A+    K L+++P  P V     Q 
Sbjct: 139 QHLERAAELAGNDTIPVEIAR--VRLQLARNENHAARHSVDKLLEVTPRHPEVLRLAEQA 196

Query: 198 YVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIAS----YHDAIESL 253
           Y+    WS  +  +    K     + +RA+L     +   D+                  
Sbjct: 197 YIRTGAWSSLLDIIPSMAKARVGDDEHRAMLEQQAWVGLMDQVRADQGSEGLRAWWKNQS 256

Query: 254 KLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKR 313
           +   + +   +  A+ LI  +    A+ ++    K      +      L + N     K 
Sbjct: 257 RKTRHQVALQVAMAEHLIECDDHDTAQQVIIDGLKRQYDDRLVLPIPRLKTNNPEQIEKV 316

Query: 314 ALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSH 373
             +  +   +       + +  ++ G   +A      A+K  P    +  LA        
Sbjct: 317 LRQQIKAVGDRPLLWSTLGQSLMKHGEWQEATLAFRAALKQRPDAYDYAWLADALDRLHQ 376

Query: 374 NTDKI 378
             +  
Sbjct: 377 PEEAA 381


>gi|170022175|ref|YP_001727129.1| putative protoheme IX biogenesis protein [Escherichia coli ATCC
           8739]
 gi|188492123|ref|ZP_02999393.1| HemY protein [Escherichia coli 53638]
 gi|194434057|ref|ZP_03066327.1| HemY protein [Shigella dysenteriae 1012]
 gi|312971916|ref|ZP_07786090.1| tetratricopeptide repeat family protein [Escherichia coli 1827-70]
 gi|169757103|gb|ACA79802.1| HemY protein [Escherichia coli ATCC 8739]
 gi|188487322|gb|EDU62425.1| HemY protein [Escherichia coli 53638]
 gi|194417715|gb|EDX33814.1| HemY protein [Shigella dysenteriae 1012]
 gi|309704237|emb|CBJ03585.1| Porphyrin biosynthetic protein [Escherichia coli ETEC H10407]
 gi|310334293|gb|EFQ00498.1| tetratricopeptide repeat family protein [Escherichia coli 1827-70]
 gi|320178093|gb|EFW53073.1| putative protoheme IX biogenesis protein [Shigella boydii ATCC
           9905]
 gi|323934190|gb|EGB30621.1| hemY protein [Escherichia coli E1520]
 gi|332084958|gb|EGI90140.1| tetratricopeptide repeat family protein [Shigella dysenteriae
           155-74]
 gi|332345780|gb|AEE59114.1| conserved hypothetical protein [Escherichia coli UMNK88]
          Length = 398

 Score = 83.8 bits (206), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 54/370 (14%), Positives = 110/370 (29%), Gaps = 21/370 (5%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I   N    TS   +  IL   +     +  + R      A        R 
Sbjct: 21  IAGHQGYVLIQTDNYNIETSVTGLAIILILAMVVLFAIEWLLRRIFRTGAHTRGWFVGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A        A+
Sbjct: 81  RRRARKQTEQALLKLAEGDYQQVEKLMAKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 138

Query: 141 EKLEMMLQ--------IPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
           + LE   +        +  TR               + ++A+    K L+++P  P V  
Sbjct: 139 QHLERAAELAGNDTIPVEITRV-------RLQLARNENHAARHGVDKLLEVTPRHPEVLR 191

Query: 193 AVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIAS----YHD 248
              Q Y+    WS  +  +    K       +RA+L     +   D+           + 
Sbjct: 192 LAEQAYIRTGAWSSLLDIIPSMAKAHVGDEEHRAMLEQQAWIGLMDQARADNGSEGLRNW 251

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
                +   + +   +  A+ LI  +    A+ I+    K      +      L + N  
Sbjct: 252 WKNQSRKTRHQVALQVAMAEHLIECDDHDTAQQIIIDGLKRQYDDRLLLPIPRLKTNNPE 311

Query: 309 GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIE 368
              K   +  +   +       + +  ++ G   +A      A+K  P    +  LA   
Sbjct: 312 QLEKVLRQQIKNVGDRPLLWSTLGQSLMKHGEWQEASLAFRAALKQRPDAYDYAWLADAL 371

Query: 369 QANSHNTDKI 378
                  +  
Sbjct: 372 DRLHKPEEAA 381


>gi|22124293|ref|NP_667716.1| putative protoheme IX biogenesis protein [Yersinia pestis KIM 10]
 gi|45442946|ref|NP_994485.1| putative protoheme IX biogenesis protein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108806167|ref|YP_650083.1| putative protoheme IX biogenesis protein [Yersinia pestis Antiqua]
 gi|108810277|ref|YP_646044.1| putative protoheme IX biogenesis protein [Yersinia pestis Nepal516]
 gi|145600720|ref|YP_001164796.1| putative protoheme IX biogenesis protein [Yersinia pestis Pestoides
           F]
 gi|153997092|ref|ZP_02022225.1| putative protoheme IX biogenesis protein [Yersinia pestis
           CA88-4125]
 gi|162421056|ref|YP_001605126.1| putative protoheme IX biogenesis protein [Yersinia pestis Angola]
 gi|165926307|ref|ZP_02222139.1| hemY protein [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165939155|ref|ZP_02227706.1| hemY protein [Yersinia pestis biovar Orientalis str. IP275]
 gi|166011693|ref|ZP_02232591.1| hemY protein [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166213543|ref|ZP_02239578.1| hemY protein [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167401885|ref|ZP_02307373.1| hemY protein [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167421107|ref|ZP_02312860.1| hemY protein [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167426282|ref|ZP_02318035.1| hemY protein [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|218930855|ref|YP_002348730.1| putative protoheme IX biogenesis protein [Yersinia pestis CO92]
 gi|229837185|ref|ZP_04457350.1| predicted protoheme IX synthesis protein [Yersinia pestis Pestoides
           A]
 gi|229839545|ref|ZP_04459704.1| predicted protoheme IX synthesis protein [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229900108|ref|ZP_04515245.1| predicted protoheme IX synthesis protein [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229900446|ref|ZP_04515575.1| predicted protoheme IX synthesis protein [Yersinia pestis Nepal516]
 gi|270488801|ref|ZP_06205875.1| HemY protein [Yersinia pestis KIM D27]
 gi|294505515|ref|YP_003569577.1| putative protoheme IX biogenesis protein [Yersinia pestis Z176003]
 gi|21957064|gb|AAM83967.1|AE013638_5 hemY protein [Yersinia pestis KIM 10]
 gi|45437813|gb|AAS63362.1| putative protoheme IX biogenesis protein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108773925|gb|ABG16444.1| protoheme IX biogenesis protein [Yersinia pestis Nepal516]
 gi|108778080|gb|ABG12138.1| putative protoheme IX biogenesis protein [Yersinia pestis Antiqua]
 gi|115349466|emb|CAL22439.1| putative protoheme IX biogenesis protein [Yersinia pestis CO92]
 gi|145212416|gb|ABP41823.1| protoheme IX biogenesis protein [Yersinia pestis Pestoides F]
 gi|149289398|gb|EDM39476.1| putative protoheme IX biogenesis protein [Yersinia pestis
           CA88-4125]
 gi|162353871|gb|ABX87819.1| hemY protein [Yersinia pestis Angola]
 gi|165912928|gb|EDR31554.1| hemY protein [Yersinia pestis biovar Orientalis str. IP275]
 gi|165921831|gb|EDR39028.1| hemY protein [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165989462|gb|EDR41763.1| hemY protein [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166205216|gb|EDR49696.1| hemY protein [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166961236|gb|EDR57257.1| hemY protein [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167048778|gb|EDR60186.1| hemY protein [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167054801|gb|EDR64605.1| hemY protein [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|229682465|gb|EEO78552.1| predicted protoheme IX synthesis protein [Yersinia pestis Nepal516]
 gi|229686888|gb|EEO78967.1| predicted protoheme IX synthesis protein [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229695911|gb|EEO85958.1| predicted protoheme IX synthesis protein [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229706128|gb|EEO92137.1| predicted protoheme IX synthesis protein [Yersinia pestis Pestoides
           A]
 gi|262363581|gb|ACY60302.1| putative protoheme IX biogenesis protein [Yersinia pestis D106004]
 gi|262367509|gb|ACY64066.1| putative protoheme IX biogenesis protein [Yersinia pestis D182038]
 gi|270337305|gb|EFA48082.1| HemY protein [Yersinia pestis KIM D27]
 gi|294355974|gb|ADE66315.1| putative protoheme IX biogenesis protein [Yersinia pestis Z176003]
 gi|320013547|gb|ADV97118.1| putative protoheme IX synthesis protein [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 406

 Score = 83.8 bits (206), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 55/365 (15%), Positives = 114/365 (31%), Gaps = 7/365 (1%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I   N    TS   +  +L   L A+ ++  V R      A        R 
Sbjct: 21  LAGHQGYVLIQTDNYNVTTSVTGLAIMLVLLLVAFFIVEWVLRRIFRTGARTRGWFLGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +    +   L+ +A  +     K+ +  +         + YLL  + A         +
Sbjct: 81  RTRARNQMKAALIKLAEGDFLQVEKLLTRNADHA--EQPMVNYLLAAEAAQQRGDEFRTN 138

Query: 141 EKLEMMLQIPATREFAV-YSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYV 199
           + LE   ++    +  V  +        G +++A+    + LD +P  P V     Q Y+
Sbjct: 139 QYLERAAEVADGDQLPVNITRVRIQLAQGHIHAARHGVDRLLDQAPRHPEVLRLAEQAYL 198

Query: 200 LAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIAS----YHDAIESLKL 255
            +  +   +  L    K         A L     +   ++               +  + 
Sbjct: 199 RSGAYRSLLDILPAMSKTQIHTPEEVAALEQQAYIGIMNQCMADEGSEGLKRWWKDQSRK 258

Query: 256 CDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRAL 315
             N I   +  A+ LI  +    A+ I+    K      +A +   L + N     K   
Sbjct: 259 VRNEIPLQVALAEHLIECDDHDVAQKIILDSLKHQYDERLALLIPRLKAGNPEPLEKSLR 318

Query: 316 RLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNT 375
           +  + +  +      + ++ L+ G  ++A      A+   P    +  LA          
Sbjct: 319 QQIKQHGATPLLNSTLGQLMLKHGEWEKASEAFKAALAQRPDGYDYAWLADALDKLHRPE 378

Query: 376 DKILY 380
           D    
Sbjct: 379 DAAQA 383


>gi|269961543|ref|ZP_06175906.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269833772|gb|EEZ87868.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 393

 Score = 83.8 bits (206), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 58/383 (15%), Positives = 122/383 (31%), Gaps = 20/383 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RLI  F V+   +      S     V I+  N     S   ++  +   L A   L  
Sbjct: 1   MVRLIFLFVVLGAGLFVGTQFSGQQGYVLISIANTTIEMSVTTLVIFVIAALAALFFLEY 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +   +  ++    R   +  +    G++ +   +   A K  +  +  H      
Sbjct: 61  LVKKLVYASSSTWNYFSVRKMRRSRRYTNEGIIKLLEGDWKGAEKKVTRWANHH--DMPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAV---YSLYFESCRIGDLNSAQRYA 177
           L YL+  + A  +       ++   +         AV        +  R  +  SA    
Sbjct: 119 LCYLVASEAAQGQGDKAK-RDQYLELASQQENAHLAVELTR--AKQFIRDNEFESAFDTL 175

Query: 178 TKALDISPDAPWVTEAVVQ-QYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLEN 236
             AL        +   +++  Y+  K W   I  + Q  K        +A L+       
Sbjct: 176 Q-ALKDQYANNSIVLNLLKTTYMQLKLWQPLIDLMPQLSKAKLVTEEEQAELIQKAQCGL 234

Query: 237 ADKGDMIASYHDAI-------ESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
             +          I         +K   + I    C A  LIS+     A  ++++  K 
Sbjct: 235 LHEVAQQQGSEGLISHWNGLPRKVKQDAHLI---GCFAHELISRKADNDAFTVIKEALKK 291

Query: 290 NPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAM 349
           +P PE+  +   L   ++   +     + +   E+  +   ++          +A     
Sbjct: 292 SPTPELYQLLPELNLPDSHPVIVFLEGVLKREPENAAAQSALAHFFFRQEKWQEAQEHFE 351

Query: 350 LAMKIAPRKEIFLLLAQIEQANS 372
           +A+K+      +  LA   +  +
Sbjct: 352 VALKLRSDVSDYAYLADTLEKQN 374


>gi|170682558|ref|YP_001746118.1| putative protoheme IX biogenesis protein [Escherichia coli SMS-3-5]
 gi|300939980|ref|ZP_07154608.1| HemY protein [Escherichia coli MS 21-1]
 gi|170520276|gb|ACB18454.1| HemY protein [Escherichia coli SMS-3-5]
 gi|300455184|gb|EFK18677.1| HemY protein [Escherichia coli MS 21-1]
          Length = 398

 Score = 83.8 bits (206), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 54/370 (14%), Positives = 110/370 (29%), Gaps = 21/370 (5%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I   N    TS   +  IL   +     +  + R      A        R 
Sbjct: 21  IAGHQGYVLIQTDNYNIETSVTGLAIILILAMVVLFAIEWLLRRIFRTGAHTRGWFVGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A        A+
Sbjct: 81  RRRARKQTEQALLKLAEGDYQQVEKLMAKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 138

Query: 141 EKLEMMLQ--------IPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
           + LE   +        +  TR               + ++A+    K L+++P  P V  
Sbjct: 139 QHLERAAELAGNDTIPVEITRV-------RLQLARNENHAARHGVDKLLEVTPRHPEVLR 191

Query: 193 AVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIAS----YHD 248
              Q Y+    WS  +  +    K       +RA+L     +   D+           + 
Sbjct: 192 LAEQAYIRTGAWSSLLDIIPSMAKAHVGDEEHRAMLEQQAWIGLMDQARADNGSEGLRNW 251

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
                +   + +   +  A+ LI  +    A+ I+    K      +      L + N  
Sbjct: 252 WKNQSRKTRHQVALQVAMAEHLIECDDHDTAQQIIIDGLKRQYDDRLLLPIPRLKTNNPE 311

Query: 309 GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIE 368
              K   +  +   +       + +  ++ G   +A      A+K  P    +  LA   
Sbjct: 312 QLEKVLRQQIKNVGDRPLLWSTLGQSLMKHGEWQEASLAFRAALKQRPDAYDYAWLADAL 371

Query: 369 QANSHNTDKI 378
                  +  
Sbjct: 372 DRLHKPEEAA 381


>gi|156972665|ref|YP_001443572.1| heme biosynthesis protein [Vibrio harveyi ATCC BAA-1116]
 gi|156524259|gb|ABU69345.1| hypothetical protein VIBHAR_00317 [Vibrio harveyi ATCC BAA-1116]
          Length = 393

 Score = 83.8 bits (206), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 59/383 (15%), Positives = 124/383 (32%), Gaps = 20/383 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RLI  F V+   +      S     V I+  N+    S   ++  +   L A   L  
Sbjct: 1   MVRLIFLFVVLGAGLFVGTQFSGQQGYVLISIANKTIEMSVTTLVIFVIATLAALFFLEY 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V +  +   +  ++    R   +  +    G++ +   +   A K  +  +  H      
Sbjct: 61  VVKKVVYASSSTWNYFSVRKMRRSRRYTNEGIIKLLEGDWKGAEKKVTRWANHH--DMPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAV---YSLYFESCRIGDLNSAQRYA 177
           L YL+  + A  +       ++   +         AV        +  R  +  SA    
Sbjct: 119 LCYLVASEAAQGQGDKAK-RDQYLELASQQENAHLAVELTR--AKQFIRDNEFESAFDTL 175

Query: 178 TKALDISPDAPWVTEAVVQ-QYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLEN 236
             AL        +   +++  Y+  K W   I  + Q  K        +A L+       
Sbjct: 176 Q-ALKGQYANNSIVLNLLKTTYMQLKLWQPLIDLMPQLSKAKLVTEEEQAELIQKAQCGL 234

Query: 237 ADKGDMIASYHDAI-------ESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
             +          I         +K   + I    C A  LIS+    +A  ++++  K 
Sbjct: 235 LHEVAQQQGSEGLISHWSGLPRKVKQDAHLI---GCFAHELISRKADNEAFTVIKEALKK 291

Query: 290 NPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAM 349
           +P PE+  +   L   ++   +     + +   E+  +   ++          +A     
Sbjct: 292 SPTPELYQLLPELNLPDSHPVIVFLEGVLKREPENAAAQSALAHFFFRQEKWQEAQEHFE 351

Query: 350 LAMKIAPRKEIFLLLAQIEQANS 372
           +A+K+      +  LA   +  +
Sbjct: 352 VALKLRSDVSDYAYLADTLEKQN 374


>gi|331665447|ref|ZP_08366346.1| HemY protein [Escherichia coli TA143]
 gi|331057345|gb|EGI29334.1| HemY protein [Escherichia coli TA143]
          Length = 398

 Score = 83.8 bits (206), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 54/370 (14%), Positives = 110/370 (29%), Gaps = 21/370 (5%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I   N    TS   +  IL   +     +  + R      A        R 
Sbjct: 21  IAGHQGYVLIQTDNYNIETSVTGLAIILILAMVVLFAIEWLLRRIFRTGAHTRGWFVGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A        A+
Sbjct: 81  RRRARKQTEQALLKLAEGDYQQVEKLMAKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 138

Query: 141 EKLEMMLQ--------IPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
           + LE   +        +  TR               + ++A+    K L+++P  P V  
Sbjct: 139 QHLERAAELAGNDTIPVEITRV-------RLQLARNENHAARHGVDKLLEVTPRHPEVLR 191

Query: 193 AVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIAS----YHD 248
              Q Y+    WS  +  +    K       +RA+L     +   D+           + 
Sbjct: 192 LAEQAYIRTGAWSSLLDIIPSMAKTHVGDEEHRAMLEQQAWIGLMDQARADNGSEGLRNW 251

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
                +   + +   +  A+ LI  +    A+ I+    K      +      L + N  
Sbjct: 252 WKNQSRKTRHQVALQVAMAEHLIECDDHDTAQQIIIDGLKRQYDDRLLLPIPRLKTNNPE 311

Query: 309 GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIE 368
              K   +  +   +       + +  ++ G   +A      A+K  P    +  LA   
Sbjct: 312 QLEKVLRQQIKNVGDRPLLWSTLGQSLMKHGEWQEASLAFRAALKQRPDAYDYAWLADAL 371

Query: 369 QANSHNTDKI 378
                  +  
Sbjct: 372 DRLHKPEEAA 381


>gi|227114733|ref|ZP_03828389.1| putative protoheme IX biogenesis protein [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 399

 Score = 83.8 bits (206), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 53/365 (14%), Positives = 118/365 (32%), Gaps = 9/365 (2%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           V+ +   V I   N   +TS   ++ +L  F  A++ +  V R      +        R 
Sbjct: 23  VAGHQGYVLIQTDNYDIQTSVTGLVIMLILFFLAFLAVEWVLRRIFRTGSRTRGWFLGRK 82

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A          
Sbjct: 83  RTRARKQTKAALLKLAEGDYLQVEKLLTRNADHA--EQPVVNYLLAAEAAQQRGDEFRTK 140

Query: 141 EKLEMMLQIPATREFAV-YSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYV 199
           + LE   ++  T +  V  +         + ++A+    K L+++P  P V     Q ++
Sbjct: 141 QYLERAAEVADTDQLPVDITRVRIQLARNEDHAARHGVDKLLEVAPRHPEVLRLAEQAFL 200

Query: 200 LAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSL-----ENADKGDMIASYHDAIESLK 254
               +S  +  L   +K    +   R + L  ++      +    G             +
Sbjct: 201 RTHAYSALLDILPAMRKINL-YPEQRLLDLQQQAYIGLMNQAMADGGSEGLKSWWNNQSR 259

Query: 255 LCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRA 314
              + I   +  A+ LI  +    A+ I+    K      +  +   L + N     K  
Sbjct: 260 KVRHEIPLQVAMAEHLIECDDHDTAQKIILDGLKRQYDERLILLMPRLKAGNPEQLEKVL 319

Query: 315 LRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHN 374
            +  + +  +      + ++ ++ G   QA      A+++ P    +   A         
Sbjct: 320 HQYIKQHGATPLLSSTLGQLLMKHGEWQQASDAFRTALELRPDAYDYAWRADALDRLRLP 379

Query: 375 TDKIL 379
            +   
Sbjct: 380 DEAAQ 384


>gi|218550976|ref|YP_002384767.1| protoheme IX biogenesis protein [Escherichia fergusonii ATCC 35469]
 gi|218358517|emb|CAQ91164.1| putative protoheme IX synthesis protein [Escherichia fergusonii
           ATCC 35469]
          Length = 398

 Score = 83.8 bits (206), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 54/370 (14%), Positives = 108/370 (29%), Gaps = 21/370 (5%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I        TS   +  IL   +     +  + R      A        R 
Sbjct: 21  IAGHQGYVLIQTDTYNIETSVTGLAIILILAMVVLFAIEWLLRRIFRTGAHTRGWFVGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A        A+
Sbjct: 81  RRRARKQTEQALLKLAEGDYQQVEKLMAKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 138

Query: 141 EKLEMMLQ--------IPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
           + LE   +        +  TR               + ++A+    K L+I+P  P V  
Sbjct: 139 QHLERAAELAGNDTIPVEITRV-------RLQLARNENHAARHGVDKLLEITPRHPEVLR 191

Query: 193 AVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIAS----YHD 248
              Q Y+    WS  +  +    K       +RA+L     +   D+           + 
Sbjct: 192 LAEQAYIRTGAWSSLLDIIPSMAKAHVGDEEHRAMLEQQAWIGLMDQARADDGSEGLRNW 251

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
                +     +   +  A+ LI  +    A+ I+    K      +      L + N  
Sbjct: 252 WKNQSRKTRQQVALQVAMAEHLIECDDHDTAQQIIIDGLKRQYDDRLLLPIPRLKTNNPE 311

Query: 309 GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIE 368
              K   +  +   +       + +  ++ G   +A      A+K  P    +  LA   
Sbjct: 312 QLEKVLRQQIKNVGDRPLLWSTLGQSLMKHGEWQEASLAFRAALKQRPDAYDYAWLADAL 371

Query: 369 QANSHNTDKI 378
                  +  
Sbjct: 372 DRLHKPEEAA 381


>gi|15804390|ref|NP_290430.1| putative protoheme IX biogenesis protein [Escherichia coli O157:H7
           EDL933]
 gi|15833986|ref|NP_312759.1| protoheme IX biogenesis protein [Escherichia coli O157:H7 str.
           Sakai]
 gi|16131654|ref|NP_418246.1| predicted protoheme IX synthesis protein [Escherichia coli str.
           K-12 substr. MG1655]
 gi|24115094|ref|NP_709604.1| putative protoheme IX biogenesis protein [Shigella flexneri 2a str.
           301]
 gi|26250540|ref|NP_756580.1| putative protoheme IX biogenesis protein [Escherichia coli CFT073]
 gi|30064905|ref|NP_839076.1| putative protoheme IX biogenesis protein [Shigella flexneri 2a str.
           2457T]
 gi|74314313|ref|YP_312732.1| putative protoheme IX biogenesis protein [Shigella sonnei Ss046]
 gi|82546153|ref|YP_410100.1| protoheme IX biogenesis protein [Shigella boydii Sb227]
 gi|89110218|ref|AP_003998.1| predicted protoheme IX synthesis protein [Escherichia coli str.
           K-12 substr. W3110]
 gi|91213323|ref|YP_543309.1| putative protoheme IX biogenesis protein [Escherichia coli UTI89]
 gi|110644125|ref|YP_671855.1| putative protoheme IX biogenesis protein [Escherichia coli 536]
 gi|110807510|ref|YP_691030.1| putative protoheme IX biogenesis protein [Shigella flexneri 5 str.
           8401]
 gi|117626059|ref|YP_859382.1| putative protoheme IX biogenesis protein [Escherichia coli APEC O1]
 gi|157157643|ref|YP_001465283.1| putative protoheme IX biogenesis protein [Escherichia coli E24377A]
 gi|157163275|ref|YP_001460593.1| putative protoheme IX biogenesis protein [Escherichia coli HS]
 gi|168750389|ref|ZP_02775411.1| HemY protein [Escherichia coli O157:H7 str. EC4113]
 gi|168753696|ref|ZP_02778703.1| HemY protein [Escherichia coli O157:H7 str. EC4401]
 gi|168764120|ref|ZP_02789127.1| HemY protein [Escherichia coli O157:H7 str. EC4501]
 gi|168768080|ref|ZP_02793087.1| HemY protein [Escherichia coli O157:H7 str. EC4486]
 gi|168775650|ref|ZP_02800657.1| HemY protein [Escherichia coli O157:H7 str. EC4196]
 gi|168780698|ref|ZP_02805705.1| HemY protein [Escherichia coli O157:H7 str. EC4076]
 gi|168786637|ref|ZP_02811644.1| HemY protein [Escherichia coli O157:H7 str. EC869]
 gi|168801137|ref|ZP_02826144.1| HemY protein [Escherichia coli O157:H7 str. EC508]
 gi|170083286|ref|YP_001732606.1| protoheme IX synthesis protein [Escherichia coli str. K-12 substr.
           DH10B]
 gi|187730910|ref|YP_001882495.1| putative protoheme IX biogenesis protein [Shigella boydii CDC
           3083-94]
 gi|191166115|ref|ZP_03027950.1| HemY protein [Escherichia coli B7A]
 gi|191174262|ref|ZP_03035771.1| HemY protein [Escherichia coli F11]
 gi|193065682|ref|ZP_03046747.1| HemY protein [Escherichia coli E22]
 gi|193068034|ref|ZP_03048999.1| HemY protein [Escherichia coli E110019]
 gi|194429198|ref|ZP_03061726.1| HemY protein [Escherichia coli B171]
 gi|194438665|ref|ZP_03070753.1| HemY protein [Escherichia coli 101-1]
 gi|195938088|ref|ZP_03083470.1| putative protoheme IX biogenesis protein [Escherichia coli O157:H7
           str. EC4024]
 gi|208806268|ref|ZP_03248605.1| HemY protein [Escherichia coli O157:H7 str. EC4206]
 gi|208812847|ref|ZP_03254176.1| HemY protein [Escherichia coli O157:H7 str. EC4045]
 gi|208820041|ref|ZP_03260361.1| HemY protein [Escherichia coli O157:H7 str. EC4042]
 gi|209395966|ref|YP_002273318.1| HemY protein [Escherichia coli O157:H7 str. EC4115]
 gi|209921274|ref|YP_002295358.1| putative protoheme IX biogenesis protein [Escherichia coli SE11]
 gi|217324425|ref|ZP_03440509.1| HemY protein [Escherichia coli O157:H7 str. TW14588]
 gi|218556361|ref|YP_002389275.1| putative protoheme IX biogenesis protein [Escherichia coli IAI1]
 gi|218560865|ref|YP_002393778.1| protoheme IX biogenesis protein [Escherichia coli S88]
 gi|218692078|ref|YP_002400290.1| putative protoheme IX biogenesis protein [Escherichia coli ED1a]
 gi|227888616|ref|ZP_04006421.1| possible porphoryin biosynthesis protein HemY [Escherichia coli
           83972]
 gi|237702809|ref|ZP_04533290.1| HemY protein [Escherichia sp. 3_2_53FAA]
 gi|238902879|ref|YP_002928675.1| putative protoheme IX synthesis protein [Escherichia coli BW2952]
 gi|253775575|ref|YP_003038406.1| protoheme IX biogenesis protein [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254163743|ref|YP_003046851.1| putative protoheme IX biogenesis protein [Escherichia coli B str.
           REL606]
 gi|254795798|ref|YP_003080635.1| putative protoheme IX biogenesis protein [Escherichia coli O157:H7
           str. TW14359]
 gi|256021458|ref|ZP_05435323.1| putative protoheme IX biogenesis protein [Shigella sp. D9]
 gi|256026148|ref|ZP_05440013.1| putative protoheme IX biogenesis protein [Escherichia sp. 4_1_40B]
 gi|260846425|ref|YP_003224203.1| putative protoheme IX synthesis protein HemY [Escherichia coli
           O103:H2 str. 12009]
 gi|260857795|ref|YP_003231686.1| putative protoheme IX synthesis protein HemY [Escherichia coli
           O26:H11 str. 11368]
 gi|260870524|ref|YP_003236926.1| putative protoheme IX synthesis protein HemY [Escherichia coli
           O111:H- str. 11128]
 gi|261225574|ref|ZP_05939855.1| predicted protoheme IX synthesis protein [Escherichia coli O157:H7
           str. FRIK2000]
 gi|261255620|ref|ZP_05948153.1| putative protoheme IX synthesis protein HemY [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291285215|ref|YP_003502033.1| putative protoheme IX biogenesis protein [Escherichia coli O55:H7
           str. CB9615]
 gi|293417265|ref|ZP_06659890.1| hemY protein [Escherichia coli B185]
 gi|293468116|ref|ZP_06664528.1| hemY protein [Escherichia coli B088]
 gi|300818729|ref|ZP_07098936.1| HemY protein [Escherichia coli MS 107-1]
 gi|300823333|ref|ZP_07103464.1| HemY protein [Escherichia coli MS 119-7]
 gi|300904055|ref|ZP_07121935.1| HemY protein [Escherichia coli MS 84-1]
 gi|300923301|ref|ZP_07139349.1| HemY protein [Escherichia coli MS 182-1]
 gi|300930034|ref|ZP_07145466.1| HemY protein [Escherichia coli MS 187-1]
 gi|300950435|ref|ZP_07164357.1| HemY protein [Escherichia coli MS 116-1]
 gi|300955194|ref|ZP_07167591.1| HemY protein [Escherichia coli MS 175-1]
 gi|300979361|ref|ZP_07174519.1| HemY protein [Escherichia coli MS 200-1]
 gi|300985717|ref|ZP_07177572.1| HemY protein [Escherichia coli MS 45-1]
 gi|301029017|ref|ZP_07192171.1| HemY protein [Escherichia coli MS 196-1]
 gi|301047319|ref|ZP_07194405.1| HemY protein [Escherichia coli MS 185-1]
 gi|301303696|ref|ZP_07209817.1| HemY protein [Escherichia coli MS 124-1]
 gi|301328441|ref|ZP_07221522.1| HemY protein [Escherichia coli MS 78-1]
 gi|301646132|ref|ZP_07246032.1| HemY protein [Escherichia coli MS 146-1]
 gi|306815162|ref|ZP_07449315.1| putative protoheme IX biogenesis protein [Escherichia coli NC101]
 gi|307140500|ref|ZP_07499856.1| putative protoheme IX biogenesis protein [Escherichia coli H736]
 gi|307313624|ref|ZP_07593244.1| HemY protein [Escherichia coli W]
 gi|309796259|ref|ZP_07690669.1| HemY protein [Escherichia coli MS 145-7]
 gi|331644535|ref|ZP_08345655.1| HemY protein [Escherichia coli H736]
 gi|331649626|ref|ZP_08350708.1| HemY protein [Escherichia coli M605]
 gi|331655484|ref|ZP_08356477.1| HemY protein [Escherichia coli M718]
 gi|331660145|ref|ZP_08361081.1| HemY protein [Escherichia coli TA206]
 gi|331670645|ref|ZP_08371482.1| HemY protein [Escherichia coli TA271]
 gi|331679909|ref|ZP_08380572.1| HemY protein [Escherichia coli H591]
 gi|331685519|ref|ZP_08386103.1| HemY protein [Escherichia coli H299]
 gi|332282693|ref|ZP_08395106.1| hemY [Shigella sp. D9]
 gi|81170791|sp|P0ACB9|HEMY_ECO57 RecName: Full=Protein hemY
 gi|81170792|sp|P0ACB8|HEMY_ECOL6 RecName: Full=Protein hemY
 gi|81170793|sp|P0ACB7|HEMY_ECOLI RecName: Full=Protein hemY
 gi|81170794|sp|P0ACC0|HEMY_SHIFL RecName: Full=Protein hemY
 gi|12518666|gb|AAG58994.1|AE005611_4 a late step of protoheme IX synthesis [Escherichia coli O157:H7
           str. EDL933]
 gi|26110970|gb|AAN83154.1|AE016769_269 HemY protein [Escherichia coli CFT073]
 gi|41669|emb|CAA31135.1| unnamed protein product [Escherichia coli]
 gi|148201|gb|AAA67598.1| HemY [Escherichia coli str. K-12 substr. MG1655]
 gi|1790234|gb|AAC76805.1| predicted protoheme IX synthesis protein [Escherichia coli str.
           K-12 substr. MG1655]
 gi|13364208|dbj|BAB38155.1| HemY protein [Escherichia coli O157:H7 str. Sakai]
 gi|24054361|gb|AAN45311.1| HemY protein [Shigella flexneri 2a str. 301]
 gi|30043165|gb|AAP18887.1| HemY protein [Shigella flexneri 2a str. 2457T]
 gi|73857790|gb|AAZ90497.1| HemY [Shigella sonnei Ss046]
 gi|81247564|gb|ABB68272.1| HemY [Shigella boydii Sb227]
 gi|85676249|dbj|BAE77499.1| predicted protoheme IX synthesis protein [Escherichia coli str. K12
           substr. W3110]
 gi|91074897|gb|ABE09778.1| protoheme IX synthesis late stage protein [Escherichia coli UTI89]
 gi|110345717|gb|ABG71954.1| HemY protein [Escherichia coli 536]
 gi|110617058|gb|ABF05725.1| a late step of protoheme IX synthesis [Shigella flexneri 5 str.
           8401]
 gi|115515183|gb|ABJ03258.1| putative protoheme IX synthesis protein [Escherichia coli APEC O1]
 gi|157068955|gb|ABV08210.1| HemY protein [Escherichia coli HS]
 gi|157079673|gb|ABV19381.1| HemY protein [Escherichia coli E24377A]
 gi|169891121|gb|ACB04828.1| predicted protoheme IX synthesis protein [Escherichia coli str.
           K-12 substr. DH10B]
 gi|187427902|gb|ACD07176.1| HemY protein [Shigella boydii CDC 3083-94]
 gi|187768897|gb|EDU32741.1| HemY protein [Escherichia coli O157:H7 str. EC4196]
 gi|188015423|gb|EDU53545.1| HemY protein [Escherichia coli O157:H7 str. EC4113]
 gi|189001497|gb|EDU70483.1| HemY protein [Escherichia coli O157:H7 str. EC4076]
 gi|189359244|gb|EDU77663.1| HemY protein [Escherichia coli O157:H7 str. EC4401]
 gi|189362676|gb|EDU81095.1| HemY protein [Escherichia coli O157:H7 str. EC4486]
 gi|189365804|gb|EDU84220.1| HemY protein [Escherichia coli O157:H7 str. EC4501]
 gi|189373465|gb|EDU91881.1| HemY protein [Escherichia coli O157:H7 str. EC869]
 gi|189376694|gb|EDU95110.1| HemY protein [Escherichia coli O157:H7 str. EC508]
 gi|190903891|gb|EDV63605.1| HemY protein [Escherichia coli B7A]
 gi|190905445|gb|EDV65075.1| HemY protein [Escherichia coli F11]
 gi|192926649|gb|EDV81278.1| HemY protein [Escherichia coli E22]
 gi|192958654|gb|EDV89092.1| HemY protein [Escherichia coli E110019]
 gi|194412710|gb|EDX29004.1| HemY protein [Escherichia coli B171]
 gi|194422469|gb|EDX38468.1| HemY protein [Escherichia coli 101-1]
 gi|208726069|gb|EDZ75670.1| HemY protein [Escherichia coli O157:H7 str. EC4206]
 gi|208734124|gb|EDZ82811.1| HemY protein [Escherichia coli O157:H7 str. EC4045]
 gi|208740164|gb|EDZ87846.1| HemY protein [Escherichia coli O157:H7 str. EC4042]
 gi|209157366|gb|ACI34799.1| HemY protein [Escherichia coli O157:H7 str. EC4115]
 gi|209753328|gb|ACI74971.1| uroporphyrinogen III methylase [Escherichia coli]
 gi|209753330|gb|ACI74972.1| uroporphyrinogen III methylase [Escherichia coli]
 gi|209753332|gb|ACI74973.1| uroporphyrinogen III methylase [Escherichia coli]
 gi|209753334|gb|ACI74974.1| uroporphyrinogen III methylase [Escherichia coli]
 gi|209753336|gb|ACI74975.1| uroporphyrinogen III methylase [Escherichia coli]
 gi|209914533|dbj|BAG79607.1| porphyrin biosynthetic protein [Escherichia coli SE11]
 gi|217320646|gb|EEC29070.1| HemY protein [Escherichia coli O157:H7 str. TW14588]
 gi|218363130|emb|CAR00771.1| putative protoheme IX synthesis protein [Escherichia coli IAI1]
 gi|218367634|emb|CAR05417.1| putative protoheme IX synthesis protein [Escherichia coli S88]
 gi|218429642|emb|CAR10605.2| putative protoheme IX synthesis protein [Escherichia coli ED1a]
 gi|222035500|emb|CAP78245.1| Protein hemY [Escherichia coli LF82]
 gi|226902980|gb|EEH89239.1| HemY protein [Escherichia sp. 3_2_53FAA]
 gi|227834455|gb|EEJ44921.1| possible porphoryin biosynthesis protein HemY [Escherichia coli
           83972]
 gi|238863057|gb|ACR65055.1| predicted protoheme IX synthesis protein [Escherichia coli BW2952]
 gi|242379332|emb|CAQ34143.1| predicted protoheme IX synthesis protein [Escherichia coli
           BL21(DE3)]
 gi|253326619|gb|ACT31221.1| HemY protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253975644|gb|ACT41315.1| predicted protoheme IX synthesis protein [Escherichia coli B str.
           REL606]
 gi|253979800|gb|ACT45470.1| predicted protoheme IX synthesis protein [Escherichia coli
           BL21(DE3)]
 gi|254595198|gb|ACT74559.1| predicted protoheme IX synthesis protein [Escherichia coli O157:H7
           str. TW14359]
 gi|257756444|dbj|BAI27946.1| predicted protoheme IX synthesis protein HemY [Escherichia coli
           O26:H11 str. 11368]
 gi|257761572|dbj|BAI33069.1| predicted protoheme IX synthesis protein HemY [Escherichia coli
           O103:H2 str. 12009]
 gi|257766880|dbj|BAI38375.1| predicted protoheme IX synthesis protein HemY [Escherichia coli
           O111:H- str. 11128]
 gi|260451355|gb|ACX41777.1| HemY protein [Escherichia coli DH1]
 gi|281180850|dbj|BAI57180.1| porphyrin biosynthetic protein [Escherichia coli SE15]
 gi|281603191|gb|ADA76175.1| A late step of protoheme IX synthesis [Shigella flexneri 2002017]
 gi|290765088|gb|ADD59049.1| putative protoheme IX biogenesis protein [Escherichia coli O55:H7
           str. CB9615]
 gi|291321494|gb|EFE60932.1| hemY protein [Escherichia coli B088]
 gi|291431033|gb|EFF04028.1| hemY protein [Escherichia coli B185]
 gi|294492014|gb|ADE90770.1| HemY protein [Escherichia coli IHE3034]
 gi|299878011|gb|EFI86222.1| HemY protein [Escherichia coli MS 196-1]
 gi|300300838|gb|EFJ57223.1| HemY protein [Escherichia coli MS 185-1]
 gi|300308033|gb|EFJ62553.1| HemY protein [Escherichia coli MS 200-1]
 gi|300317911|gb|EFJ67695.1| HemY protein [Escherichia coli MS 175-1]
 gi|300403935|gb|EFJ87473.1| HemY protein [Escherichia coli MS 84-1]
 gi|300407991|gb|EFJ91529.1| HemY protein [Escherichia coli MS 45-1]
 gi|300420387|gb|EFK03698.1| HemY protein [Escherichia coli MS 182-1]
 gi|300450242|gb|EFK13862.1| HemY protein [Escherichia coli MS 116-1]
 gi|300462067|gb|EFK25560.1| HemY protein [Escherichia coli MS 187-1]
 gi|300524119|gb|EFK45188.1| HemY protein [Escherichia coli MS 119-7]
 gi|300528695|gb|EFK49757.1| HemY protein [Escherichia coli MS 107-1]
 gi|300840996|gb|EFK68756.1| HemY protein [Escherichia coli MS 124-1]
 gi|300845151|gb|EFK72911.1| HemY protein [Escherichia coli MS 78-1]
 gi|301075658|gb|EFK90464.1| HemY protein [Escherichia coli MS 146-1]
 gi|305851531|gb|EFM51985.1| putative protoheme IX biogenesis protein [Escherichia coli NC101]
 gi|306906605|gb|EFN37117.1| HemY protein [Escherichia coli W]
 gi|307555926|gb|ADN48701.1| HemY protein [Escherichia coli ABU 83972]
 gi|307628863|gb|ADN73167.1| putative protoheme IX biogenesis protein [Escherichia coli UM146]
 gi|308120141|gb|EFO57403.1| HemY protein [Escherichia coli MS 145-7]
 gi|312948355|gb|ADR29182.1| putative protoheme IX biogenesis protein [Escherichia coli O83:H1
           str. NRG 857C]
 gi|313647160|gb|EFS11615.1| tetratricopeptide repeat family protein [Shigella flexneri 2a str.
           2457T]
 gi|315063094|gb|ADT77421.1| predicted protoheme IX synthesis protein [Escherichia coli W]
 gi|315138378|dbj|BAJ45537.1| putative protoheme IX biogenesis protein [Escherichia coli DH1]
 gi|315254165|gb|EFU34133.1| HemY protein [Escherichia coli MS 85-1]
 gi|315284726|gb|EFU44171.1| HemY protein [Escherichia coli MS 110-3]
 gi|315293158|gb|EFU52510.1| HemY protein [Escherichia coli MS 153-1]
 gi|315296780|gb|EFU56072.1| HemY protein [Escherichia coli MS 16-3]
 gi|315618501|gb|EFU99087.1| tetratricopeptide repeat family protein [Escherichia coli 3431]
 gi|320176043|gb|EFW51112.1| putative protoheme IX biogenesis protein [Shigella dysenteriae CDC
           74-1112]
 gi|320185462|gb|EFW60231.1| putative protoheme IX biogenesis protein [Shigella flexneri CDC
           796-83]
 gi|320191106|gb|EFW65756.1| putative protoheme IX biogenesis protein [Escherichia coli O157:H7
           str. EC1212]
 gi|320639284|gb|EFX08906.1| putative protoheme IX biogenesis protein [Escherichia coli O157:H7
           str. G5101]
 gi|320644669|gb|EFX13719.1| putative protoheme IX biogenesis protein [Escherichia coli O157:H-
           str. 493-89]
 gi|320649994|gb|EFX18497.1| putative protoheme IX biogenesis protein [Escherichia coli O157:H-
           str. H 2687]
 gi|320655340|gb|EFX23282.1| putative protoheme IX biogenesis protein [Escherichia coli O55:H7
           str. 3256-97 TW 07815]
 gi|320660966|gb|EFX28409.1| putative protoheme IX biogenesis protein [Escherichia coli O55:H7
           str. USDA 5905]
 gi|320666089|gb|EFX33103.1| putative protoheme IX biogenesis protein [Escherichia coli O157:H7
           str. LSU-61]
 gi|323155203|gb|EFZ41387.1| tetratricopeptide repeat family protein [Escherichia coli EPECa14]
 gi|323161137|gb|EFZ47055.1| tetratricopeptide repeat family protein [Escherichia coli E128010]
 gi|323167549|gb|EFZ53255.1| tetratricopeptide repeat family protein [Shigella sonnei 53G]
 gi|323173416|gb|EFZ59045.1| tetratricopeptide repeat family protein [Escherichia coli LT-68]
 gi|323177811|gb|EFZ63395.1| tetratricopeptide repeat family protein [Escherichia coli 1180]
 gi|323182573|gb|EFZ67977.1| tetratricopeptide repeat family protein [Escherichia coli 1357]
 gi|323189478|gb|EFZ74758.1| tetratricopeptide repeat family protein [Escherichia coli RN587/1]
 gi|323380842|gb|ADX53110.1| HemY protein [Escherichia coli KO11]
 gi|323938938|gb|EGB35157.1| hemY protein [Escherichia coli E482]
 gi|323943799|gb|EGB39894.1| hemY protein [Escherichia coli H120]
 gi|323949317|gb|EGB45207.1| hemY protein [Escherichia coli H252]
 gi|323954006|gb|EGB49804.1| hemY protein [Escherichia coli H263]
 gi|323959056|gb|EGB54725.1| hemY protein [Escherichia coli H489]
 gi|323969358|gb|EGB64657.1| hemY protein [Escherichia coli TA007]
 gi|324014705|gb|EGB83924.1| HemY protein [Escherichia coli MS 60-1]
 gi|324016229|gb|EGB85448.1| HemY protein [Escherichia coli MS 117-3]
 gi|324115738|gb|EGC09673.1| hemY protein [Escherichia coli E1167]
 gi|326344257|gb|EGD68017.1| putative protoheme IX biogenesis protein [Escherichia coli O157:H7
           str. 1125]
 gi|326347915|gb|EGD71629.1| putative protoheme IX biogenesis protein [Escherichia coli O157:H7
           str. 1044]
 gi|330908101|gb|EGH36620.1| hypothetical protein ECAA86_04133 [Escherichia coli AA86]
 gi|331036207|gb|EGI08442.1| HemY protein [Escherichia coli H736]
 gi|331041496|gb|EGI13644.1| HemY protein [Escherichia coli M605]
 gi|331046805|gb|EGI18889.1| HemY protein [Escherichia coli M718]
 gi|331052713|gb|EGI24748.1| HemY protein [Escherichia coli TA206]
 gi|331062118|gb|EGI34040.1| HemY protein [Escherichia coli TA271]
 gi|331072456|gb|EGI43788.1| HemY protein [Escherichia coli H591]
 gi|331077220|gb|EGI48434.1| HemY protein [Escherichia coli H299]
 gi|332089027|gb|EGI94138.1| tetratricopeptide repeat family protein [Shigella boydii 3594-74]
 gi|332105045|gb|EGJ08391.1| hemY [Shigella sp. D9]
 gi|332750975|gb|EGJ81380.1| tetratricopeptide repeat family protein [Shigella flexneri 4343-70]
 gi|332751062|gb|EGJ81466.1| tetratricopeptide repeat family protein [Shigella flexneri K-671]
 gi|332751923|gb|EGJ82318.1| tetratricopeptide repeat family protein [Shigella flexneri 2747-71]
 gi|332764358|gb|EGJ94593.1| tetratricopeptide repeat family protein [Shigella flexneri 2930-71]
 gi|332996998|gb|EGK16616.1| tetratricopeptide repeat family protein [Shigella flexneri VA-6]
 gi|332997941|gb|EGK17548.1| tetratricopeptide repeat family protein [Shigella flexneri K-218]
 gi|332998257|gb|EGK17859.1| tetratricopeptide repeat family protein [Shigella flexneri K-272]
 gi|333013797|gb|EGK33160.1| tetratricopeptide repeat family protein [Shigella flexneri K-227]
 gi|333019508|gb|EGK38789.1| tetratricopeptide repeat family protein [Shigella flexneri K-304]
          Length = 398

 Score = 83.8 bits (206), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 54/370 (14%), Positives = 110/370 (29%), Gaps = 21/370 (5%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I   N    TS   +  IL   +     +  + R      A        R 
Sbjct: 21  IAGHQGYVLIQTDNYNIETSVTGLAIILILAMVVLFAIEWLLRRIFRTGAHTRGWFVGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A        A+
Sbjct: 81  RRRARKQTEQALLKLAEGDYQQVEKLMAKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 138

Query: 141 EKLEMMLQ--------IPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
           + LE   +        +  TR               + ++A+    K L+++P  P V  
Sbjct: 139 QHLERAAELAGNDTIPVEITRV-------RLQLARNENHAARHGVDKLLEVTPRHPEVLR 191

Query: 193 AVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIAS----YHD 248
              Q Y+    WS  +  +    K       +RA+L     +   D+           + 
Sbjct: 192 LAEQAYIRTGAWSSLLDIIPSMAKAHVGDEEHRAMLEQQAWIGLMDQARADNGSEGLRNW 251

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
                +   + +   +  A+ LI  +    A+ I+    K      +      L + N  
Sbjct: 252 WKNQSRKTRHQVALQVAMAEHLIECDDHDTAQQIIIDGLKRQYDDRLLLPIPRLKTNNPE 311

Query: 309 GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIE 368
              K   +  +   +       + +  ++ G   +A      A+K  P    +  LA   
Sbjct: 312 QLEKVLRQQIKNVGDRPLLWSTLGQSLMKHGEWQEASLAFRAALKQRPDAYDYAWLADAL 371

Query: 369 QANSHNTDKI 378
                  +  
Sbjct: 372 DRLHKPEEAA 381


>gi|300921489|ref|ZP_07137837.1| HemY protein [Escherichia coli MS 115-1]
 gi|300411606|gb|EFJ94916.1| HemY protein [Escherichia coli MS 115-1]
          Length = 398

 Score = 83.4 bits (205), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 54/370 (14%), Positives = 110/370 (29%), Gaps = 21/370 (5%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I   N    TS   +  IL   +     +  + R      A        R 
Sbjct: 21  IAGHQGYVLIQTDNYNIETSVTGLAIILILAMVVLFAIEWLLRRIFRTGAHTRGWFVGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A        A+
Sbjct: 81  RRRARKQTEQALLKLAEGDYQQVEKLMAKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 138

Query: 141 EKLEMMLQ--------IPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
           + LE   +        +  TR               + ++A+    K L+++P  P V  
Sbjct: 139 QHLERAAELAGNDTIPVEITRV-------RLQLARNENHAARHGVDKLLEVTPRHPEVLR 191

Query: 193 AVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIAS----YHD 248
              Q Y+    WS  +  +    K       +RA+L     +   D+           + 
Sbjct: 192 LAEQAYIRTGAWSSLLDIVPSMAKAHVGDEEHRAMLEQQAWIGLMDQARADNGSEGLRNW 251

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
                +   + +   +  A+ LI  +    A+ I+    K      +      L + N  
Sbjct: 252 WKNQSRKTRHQVALQVAMAEHLIECDDHDTAQQIIIDGLKRQYDDRLLLPIPRLKTNNPE 311

Query: 309 GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIE 368
              K   +  +   +       + +  ++ G   +A      A+K  P    +  LA   
Sbjct: 312 QLEKVLRQQIKNVGDRPLLWSTLGQSLMKHGEWQEASLAFRAALKQRPDAYDYAWLADAL 371

Query: 369 QANSHNTDKI 378
                  +  
Sbjct: 372 DRLHKPEEAA 381


>gi|301025755|ref|ZP_07189270.1| HemY protein [Escherichia coli MS 69-1]
 gi|331675270|ref|ZP_08376021.1| HemY protein [Escherichia coli TA280]
 gi|300395878|gb|EFJ79416.1| HemY protein [Escherichia coli MS 69-1]
 gi|331067556|gb|EGI38960.1| HemY protein [Escherichia coli TA280]
          Length = 398

 Score = 83.4 bits (205), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 54/370 (14%), Positives = 110/370 (29%), Gaps = 21/370 (5%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I   N    TS   +  IL   +     +  + R      A        R 
Sbjct: 21  IAGHQGYVLIQTDNYNIETSVTGLAIILILAMVVLFAIEWLLRRIFRTGAHTRGWFVGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A        A+
Sbjct: 81  RRRARKQTEQALLKLAEGDYQQVEKLMAKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 138

Query: 141 EKLEMMLQ--------IPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
           + LE   +        +  TR               + ++A+    K L+++P  P V  
Sbjct: 139 QHLERAAELAGNDTIPVEITRV-------RLQLARNENHAARHGVDKLLEVTPRHPEVLR 191

Query: 193 AVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIAS----YHD 248
              Q Y+    WS  +  +    K       +RA+L     +   D+           + 
Sbjct: 192 LAEQAYIRTGAWSSLLDIIPSMAKAHVGDEEHRAMLEQQAWIGLMDQARADDGSEGLRNW 251

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
                +   + +   +  A+ LI  +    A+ I+    K      +      L + N  
Sbjct: 252 WKNQSRKTRHQVALQVAMAEHLIECDDHDTAQQIIIDGLKRQYDDRLLLPIPRLKTNNPE 311

Query: 309 GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIE 368
              K   +  +   +       + +  ++ G   +A      A+K  P    +  LA   
Sbjct: 312 QLEKVLRQQIKNVGDRPLLWSTLGQSLMKHGEWQEASLAFRAALKQRPDAYDYAWLADAL 371

Query: 369 QANSHNTDKI 378
                  +  
Sbjct: 372 DRLHKPEEAA 381


>gi|255065154|ref|ZP_05317009.1| HemY family protein [Neisseria sicca ATCC 29256]
 gi|255050575|gb|EET46039.1| HemY family protein [Neisseria sicca ATCC 29256]
          Length = 407

 Score = 83.4 bits (205), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 60/410 (14%), Positives = 142/410 (34%), Gaps = 34/410 (8%)

Query: 2   LRLIRYFFVISLVICSFIIVSH-YPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ++ + +  V+       ++ S  Y  +V I  G  + R +    +  L  F+     L  
Sbjct: 1   MKAVVWIVVLFATAVGIVLTSGIYTGNVYIVVGQVMMRVNLHAFILGLVLFVVTLYFLIK 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYK---ALYTGLMSIAAHNIPLARKMHSYVSQQH-TF 116
                ++ PA +      R   KG +   AL +  ++        A +  + V +     
Sbjct: 61  FIVGLMNIPARMQRFGTAR---KGRQAAVALNSAGLAFFEGRFEKAEQEAAKVLENKEAG 117

Query: 117 HNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFE-SCRIGDLNSAQR 175
            N  L  +L    A     + +    L+ + ++P  ++ + Y L  E +    D  +A  
Sbjct: 118 DNRNLALMLGAHAADQMENFELRDHYLKDIEKLPNKQQLSRYLLLAESALGRRDYPTALE 177

Query: 176 YATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKK----------NAKEWNRNR 225
               A  I P+   +    ++      +   A   L + +K           A+++    
Sbjct: 178 NLNAAARIHPNLSRLARLQLRYAFDHGD---AEDVLAKSEKLMKVGAINDFEAEQYQSWA 234

Query: 226 AILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEK 285
              L+A + +       +    +A+++ +LC       +  A+         +A   + +
Sbjct: 235 YRRLLAEASDATGLKTCLKRIPEALKADELC-------VAIAEKYERLGLYTEAVKWVRQ 287

Query: 286 IWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEI----NKESVESLVIVSKIALEMGSI 341
            +  N  PE+   +   +        ++A+ L +       +    L+ + ++A      
Sbjct: 288 YYPQNRRPELLEAFVESVRFFNERGQQKAIDLADSWLKDKPDDAPLLMYLGQLAYGRSLW 347

Query: 342 DQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPD 391
            +A +    ++ + P     L+LA++    +    K     +  L A+ D
Sbjct: 348 GKAQSYLEASIALQPSIAARLMLARVLD-ETGQPQKAQEQRKLVLEAVSD 396


>gi|270264248|ref|ZP_06192515.1| hypothetical protein SOD_g01850 [Serratia odorifera 4Rx13]
 gi|270041897|gb|EFA14994.1| hypothetical protein SOD_g01850 [Serratia odorifera 4Rx13]
          Length = 397

 Score = 83.4 bits (205), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 50/364 (13%), Positives = 109/364 (29%), Gaps = 7/364 (1%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I   N    TS   ++ +        + +  + R      A        R 
Sbjct: 21  LAGHQGYVLIQTDNYNVETSVTGLVIMAVLLFVVLLAIEWILRRIFRTGARTRGWFLGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A         +
Sbjct: 81  RSRARKQTKAALIKLAEGDYKQVEKLLTRNADHA--EQPVVNYLLAAEAAQQRGDDFRTN 138

Query: 141 EKLEMMLQIPATREFAV-YSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYV 199
           + LE   +   T +  V  +        G+ ++A+    + L+ +P  P V     Q Y+
Sbjct: 139 QYLERAAEAADTDQLPVDITRVRIQLAQGENHAARHGVDRLLNQAPRHPEVLRLAEQAYL 198

Query: 200 LAKEWSRAITFL----NQKKKNAKEWNRNRAILLIARSLENADKGDMIASYHDAIESLKL 255
               ++  +  L            E    +    I    +               +  + 
Sbjct: 199 RTGAFASLLEILPSMGKINLHTEAELQALQQQAYIGLMNQAMADEGSDGLKRWWKDQSRK 258

Query: 256 CDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRAL 315
             + +   I   + LI  N    A+ I+    K      +  +   L S N     K   
Sbjct: 259 TRHEVPLQIAMVEHLIECNDHEMAQEIVLDSLKRQYDERLVLLIPRLKSGNPEQLEKALR 318

Query: 316 RLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNT 375
           +  + +  +      + ++ ++ G   QA      A+K  P    +  LA +      + 
Sbjct: 319 QQVKQHGATPLLNSTLGQLLMKHGEWQQAADAFREALKQRPDAYDYAWLADVLDKLHRSD 378

Query: 376 DKIL 379
           +   
Sbjct: 379 EAAQ 382


>gi|218697516|ref|YP_002405183.1| putative protoheme IX biogenesis protein [Escherichia coli 55989]
 gi|218354248|emb|CAV00918.1| putative protoheme IX synthesis protein [Escherichia coli 55989]
          Length = 398

 Score = 83.4 bits (205), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 54/370 (14%), Positives = 110/370 (29%), Gaps = 21/370 (5%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I   N    TS   +  IL   +     +  + R      A        R 
Sbjct: 21  IAGHQGYVLIQTDNYNIETSVTGLAIILILAMVVLFAIEWLLRRIFRTGAHTRGWFVGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A        A+
Sbjct: 81  RRRARKQTEQALLKLAEGDYQQVEKLMAKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 138

Query: 141 EKLEMMLQ--------IPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
           + LE   +        +  TR               + ++A+    K L+++P  P V  
Sbjct: 139 QHLERAAELAGNDTIPVEITRV-------RLQLARNENHAARHGVDKLLEVTPRHPEVLR 191

Query: 193 AVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIAS----YHD 248
              Q Y+    WS  +  +    K       +RA+L     +   D+           + 
Sbjct: 192 LAEQAYIRTGAWSSLLDIIPSMAKAHVGDEEHRAMLEQQAWIGLMDQARADNGSEGLRNW 251

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
                +   + +   +  A+ LI  +    A+ I+    K      +      L + N  
Sbjct: 252 WKNQSRKTRHQVALQVAMAEHLIECDDHDTAQQIIIDGLKRQYDDRLLLPIPRLKTNNPE 311

Query: 309 GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIE 368
              K   +  +   +       + +  ++ G   +A      A+K  P    +  LA   
Sbjct: 312 QLEKVLRQQIKNVGDRPLLWSTLGQSLMKHGEWQEASLAFRAALKQRPDAYDYAWLADAL 371

Query: 369 QANSHNTDKI 378
                  +  
Sbjct: 372 DRLHKPEEAA 381


>gi|218707436|ref|YP_002414955.1| putative protoheme IX biogenesis protein [Escherichia coli UMN026]
 gi|293407429|ref|ZP_06651349.1| protoheme IX biogenesis protein [Escherichia coli FVEC1412]
 gi|298383169|ref|ZP_06992763.1| protoheme IX biogenesis protein [Escherichia coli FVEC1302]
 gi|300900650|ref|ZP_07118808.1| HemY protein [Escherichia coli MS 198-1]
 gi|218434533|emb|CAR15459.1| putative protoheme IX synthesis protein [Escherichia coli UMN026]
 gi|291425540|gb|EFE98578.1| protoheme IX biogenesis protein [Escherichia coli FVEC1412]
 gi|298276405|gb|EFI17924.1| protoheme IX biogenesis protein [Escherichia coli FVEC1302]
 gi|300355866|gb|EFJ71736.1| HemY protein [Escherichia coli MS 198-1]
          Length = 398

 Score = 83.4 bits (205), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 54/370 (14%), Positives = 109/370 (29%), Gaps = 21/370 (5%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I   N    TS   +  IL   +     +  + R      A        R 
Sbjct: 21  IAGHQGYVLIQTDNYNIETSVTGLAIILILAMVVLFAIEWLLRRIFRTGAHTRGWFVGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A        A+
Sbjct: 81  RRRARKQTEQALLKLAEGDYQQVEKLMAKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 138

Query: 141 EKLEMMLQ--------IPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
           + LE   +        +  TR               + ++A+    K L ++P  P V  
Sbjct: 139 QHLERAAELAGNDTIPVEITRV-------RLQLARNENHAARHGVDKLLKVTPRHPEVLR 191

Query: 193 AVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIAS----YHD 248
              Q Y+    WS  +  +    K       +RA+L     +   D+           + 
Sbjct: 192 LAEQAYIRTGAWSSLLDIIPSMAKAHVGDEEHRAMLEQQAWIGLMDQARADNGSEGLRNW 251

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
                +   + +   +  A+ LI  +    A+ I+    K      +      L + N  
Sbjct: 252 WKNQSRKTRHQVALQVAMAEHLIECDDHDTAQQIIIDGLKRQYDDRLLLPIPRLKTNNPE 311

Query: 309 GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIE 368
              K   +  +   +       + +  ++ G   +A      A+K  P    +  LA   
Sbjct: 312 QLEKVLRQQIKNVGDRPLLWSTLGQSLMKHGEWQEASLAFRAALKQRPDAYDYAWLADAL 371

Query: 369 QANSHNTDKI 378
                  +  
Sbjct: 372 DRLHKPEEAA 381


>gi|218701287|ref|YP_002408916.1| putative protoheme IX biogenesis protein [Escherichia coli IAI39]
 gi|218371273|emb|CAR19107.1| putative protoheme IX synthesis protein [Escherichia coli IAI39]
          Length = 398

 Score = 83.4 bits (205), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 54/370 (14%), Positives = 110/370 (29%), Gaps = 21/370 (5%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I   N    TS   +  IL   +     +  + R      A        R 
Sbjct: 21  IAGHQGYVLIQTDNYNIETSVTGLAIILILAMVVLFAIEWLLRRIFRTGAHTRGWFVGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A        A+
Sbjct: 81  RRRARKQTEQALLKLAEGDYQQVEKLMAKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 138

Query: 141 EKLEMMLQ--------IPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
           + LE   +        +  TR               + ++A+    K L+++P  P V  
Sbjct: 139 QHLERAAELAGNDTIPVEITRV-------RLQLARNENHAARHGVDKLLEVTPRHPEVLR 191

Query: 193 AVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIAS----YHD 248
              Q Y+    WS  +  +    K       +RA+L     +   D+           + 
Sbjct: 192 LAEQAYIRTGAWSSLLDIIPSMAKAYVGDEEHRAMLEQQAWIGLMDQARADNGSEGLRNW 251

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
                +   + +   +  A+ LI  +    A+ I+    K      +      L + N  
Sbjct: 252 WKNQSRKTRHQVALQVAMAEHLIECDDHDTAQQIIIDGLKRQYDDRLLLPIPRLKTNNPE 311

Query: 309 GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIE 368
              K   +  +   +       + +  ++ G   +A      A+K  P    +  LA   
Sbjct: 312 QLEKVLRQQIKNVGDRPLLWSTLGQSLMKHGEWQEASLAFRAALKQRPDAYDYAWLADAL 371

Query: 369 QANSHNTDKI 378
                  +  
Sbjct: 372 DRLHKPEEAA 381


>gi|90023304|ref|YP_529131.1| metal dependent phosphohydrolase [Saccharophagus degradans 2-40]
 gi|89952904|gb|ABD82919.1| metal dependent phosphohydrolase [Saccharophagus degradans 2-40]
          Length = 403

 Score = 83.4 bits (205), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 60/405 (14%), Positives = 127/405 (31%), Gaps = 65/405 (16%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHY-PEDVSITWGNRLYRTSPFVILSILYFFLFAWILLF 59
           M+R + Y  ++  +  S   +  +    + I++G+       +     ++ F    +LL+
Sbjct: 1   MMRALIYCLILLCLGASLTYLVQHDTGYILISYGDTSVEMRFWF---GVFTFSIGLLLLW 57

Query: 60  AVSRFFLSCPAML---FHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTF 116
                                +    +  +    GL++    N   A+K     ++    
Sbjct: 58  WCFGLIRRGLTAFGVSRSWWSESKQKRAERHTQRGLINFVEGNWRAAKKDLVGAAK---L 114

Query: 117 HNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCR---IGDLNSA 173
            ++ LV+ L             A    E + +   TR      L  ++ +     DL  A
Sbjct: 115 SDKPLVHYLAA-----------ARSAYE-LGEKEETRF-----LIQQAEKHAPENDLAVA 157

Query: 174 QRYAT----------------KALDISPDAPWVTEAVVQQYVLA----KEWSRAITFLNQ 213
              A                 +A     + P     V++         ++W+  +  L  
Sbjct: 158 ISQARILLMEKQLEQCLAVLTRARANHGEHP----VVLELLCRTTIQLRDWTSLVELLPL 213

Query: 214 KKKNA---KEWNRNRAILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICA---- 266
             K      E      +      L++          H  I  L    ++    + A    
Sbjct: 214 LAKYKVYDAEELAQLKLNAYLSRLQHLAATAKKEGDHVLIRDLHAFWDAAPKELKANEKL 273

Query: 267 ----AKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINK 322
               A  LI      +AE IL    K + HPE+ N+Y    +  +  +L  A    + + 
Sbjct: 274 LFCYAHELIKAKLYDEAESILRVKLKKSWHPELVNLYGRSRTVKSKDQLTHAESWLKTHP 333

Query: 323 ESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQI 367
           E     + + +IA+      +A      ++K+    + +  LA++
Sbjct: 334 EDAVLHLALGRIAIRNKLWGKARGYLEQSIKLRETPQAYAELAEV 378


>gi|88813068|ref|ZP_01128310.1| hemY protein [Nitrococcus mobilis Nb-231]
 gi|88789701|gb|EAR20826.1| hemY protein [Nitrococcus mobilis Nb-231]
          Length = 420

 Score = 83.1 bits (204), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 68/391 (17%), Positives = 123/391 (31%), Gaps = 9/391 (2%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M RL    FV+   + + +    Y      T G    + S FV         FA   L++
Sbjct: 1   MKRLFLILFVLLFSVVAALWFDEYKGYALFTAGPWTVQMSLFVFAGGFLALWFALNALWS 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + R     PA +      R   K  K L  GLM +A      + K  + +          
Sbjct: 61  LLRQLWFMPAGVRLWAGNRRRVKARKKLVGGLMLLAEGRNEESEK--AVLQGADVVDLPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATK- 179
           L YL+    A  +  ++   ++   +  I   R     +L     ++      Q  A   
Sbjct: 119 LSYLVAAFAAQRQGAWDS-RDQYLELAAIGDKRAQIGLALLQAQLQMQARQWVQAMAKLD 177

Query: 180 -ALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA--KEWNRNRAILLIARSLEN 236
              + +P+       + +     ++W R    L   +KN               A++  +
Sbjct: 178 WVRERAPNNHHALRLLAESAEARQDWERLAKLLPDLRKNGVLAAAELEDVETRTAQARLH 237

Query: 237 ADKGDMIASYHDAIESLKLCDNSIMASI-CAAKSLISQNKKRKAEVILEKIWKVNPHPEI 295
                           L      +   +   A+SLI   +  +AE +L    + +  P +
Sbjct: 238 VAVEQGSEQIEAVWRGLTRDQKRLPGVVALYAQSLIRVGQSEQAEHLLRGGLEKDWDPRL 297

Query: 296 ANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIA 355
            N+Y  L         +   R  +   E  + L      AL    +  A +    A +  
Sbjct: 298 VNVYAELDLNPATRTSEVLERWLKDRPEDPDLLFAAGCQALRSEQLGSARSYLEAASRQV 357

Query: 356 PRKEIFLLLAQIEQANSHNTDKILYWTQSAL 386
            R  I  LL  + +     ++K     + AL
Sbjct: 358 ERPMILCLLGDVYER-LGESNKARDSYRRAL 387


>gi|260596026|ref|YP_003208597.1| putative protoheme IX biogenesis protein [Cronobacter turicensis
           z3032]
 gi|260215203|emb|CBA27051.1| Protein hemY [Cronobacter turicensis z3032]
          Length = 387

 Score = 83.1 bits (204), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 55/370 (14%), Positives = 109/370 (29%), Gaps = 21/370 (5%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           V+ +   V I        TS   +  +    L     +  + R      A        R 
Sbjct: 10  VAGHQGYVLIQTDTWNIETSVTGLAIMAILSLVVLFAIEWLLRRLFHTGARTRGWFAGRK 69

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ S  +         + YLL  + A        A+
Sbjct: 70  RSRARKQTKLALLKLAEGDYQQVEKLMSKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 127

Query: 141 EKLEMMLQ--------IPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
           + LE   +        +  TR               + ++A+    + L+I+P  P V  
Sbjct: 128 QHLERAAELADNDQIPVEITRV-------RLQLARNENHAARHGVDRLLEITPRHPEVLR 180

Query: 193 AVVQQYVLAKEWSRAITFLNQKKKNA-KEWNRNRAILLIA--RSLENADKGDMIASYHDA 249
              Q Y+    WS  +  +   +K    +     A+   A    ++ A            
Sbjct: 181 LAEQAYIRTGAWSSLLDIIPSMQKAGVGDDEHRDALTRQAWIGLMDQARADQGSDGLKTW 240

Query: 250 IESLKLCDNSIMASICA-AKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
             +         A   A A+ LI  +  + A+ I+    K      +  +   L + N  
Sbjct: 241 WRNQSRKTRHQPALQVAMAEHLIECDDHQTAQEIILDGLKRQYDDRLVLLMPRLKAGNPE 300

Query: 309 GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIE 368
              K   +  +   +       + ++ +  G   +A      A+K  P    +  LA + 
Sbjct: 301 QLEKALRQQIKTYGDRPLLWSTLGQLLMSHGEWKEASLAFRAALKQRPDAFDYAWLADVL 360

Query: 369 QANSHNTDKI 378
                  +  
Sbjct: 361 DRLHQPEEAA 370


>gi|290477120|ref|YP_003470033.1| protoheme IX synthesis protein [Xenorhabdus bovienii SS-2004]
 gi|289176466|emb|CBJ83275.1| protein in late step of protoheme IX synthesis with TPR-like domain
           [Xenorhabdus bovienii SS-2004]
          Length = 401

 Score = 83.1 bits (204), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 59/392 (15%), Positives = 121/392 (30%), Gaps = 22/392 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           ML+++  F ++ + +    ++S +   V I   N    TS   ++ +     F  IL+  
Sbjct: 1   MLKVLLLFIILIVGVVLGPVLSGHQGYVLIQTDNHNITTSVTAMVIMFVLLQFLLILIGW 60

Query: 61  VSRFFLSCPAMLFHM-LHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNE 119
             R                    +        L+ +A  +    +  H          + 
Sbjct: 61  CYRRLKRTSTFTHSWLFGGYKRSRARLQTKQALLKLAEGDFK--QVEHLMTRNADHAESP 118

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQ--------IPATREFAVYSLYFESCRIGDLN 171
            + YLL  + A     Y+   + +E   +        +  TR              G+++
Sbjct: 119 VVNYLLAAEAAQQRGDYHRTIQYIERAAEVADKDQLPVDITRV-------RIQLAQGEVH 171

Query: 172 SAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNA----KEWNRNRAI 227
           +A+    K L+ +P  P V     Q Y  +  +   I  L    K      +  ++ R  
Sbjct: 172 AARNGVDKLLNHAPRHPEVLRLAEQAYTQSGAYQSLIDILPSLIKVGLCDEEHIHQLRQQ 231

Query: 228 LLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIW 287
             I    +   +           +  +   N I+  +  A+ LI  N    A+ I+    
Sbjct: 232 AYIGLMNQIMAEKGSTGLKAWWKDQNRKLRNDIVLQVAMAEHLIECNDHDTAQQIVLNGL 291

Query: 288 KVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAK 347
           K      +  +  HL ++ T    K    L + +  +      + ++AL      +A   
Sbjct: 292 KQQYDERLLLLIPHLKADETEALQKSLAYLLKRHGATPLLNSTLGQVALHHSQWAEAETA 351

Query: 348 AMLAMKIAPRKEIFLLLAQIEQANSHNTDKIL 379
              A+   P    +  LA          +   
Sbjct: 352 FKAALVQRPDAHDYAWLADALDKQHKREEAAQ 383


>gi|324111025|gb|EGC05012.1| hemY protein [Escherichia fergusonii B253]
 gi|325499230|gb|EGC97089.1| protoheme IX biogenesis protein [Escherichia fergusonii ECD227]
          Length = 398

 Score = 82.7 bits (203), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 53/370 (14%), Positives = 108/370 (29%), Gaps = 21/370 (5%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I        TS   +  IL   +     +  + R      A        R 
Sbjct: 21  IAGHQGYVLIQTDTYNIETSVTGLAIILILAMVVLFAIEWLLRRIFRTGAHTRGWFVGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A        A+
Sbjct: 81  RRRARKQTEQALLKLAEGDYQQVEKLMAKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 138

Query: 141 EKLEMMLQ--------IPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
           + LE   +        +  TR               + ++A+    K L+++P  P V  
Sbjct: 139 QHLERAAELAGNDTIPVEITRV-------RLQLARNENHAARHGVDKLLEVTPRHPEVLR 191

Query: 193 AVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIAS----YHD 248
              Q Y+    WS  +  +    K       +RA+L     +   D+           + 
Sbjct: 192 LAEQAYIRTGAWSSLLDIIPSMAKAHVGDEEHRAMLEQQAWIGLMDQARADDGSEGLRNW 251

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
                +     +   +  A+ LI  +    A+ I+    K      +      L + N  
Sbjct: 252 WKNQSRKTRQQVALQVAMAEHLIECDDHDTAQQIIIDGLKRQYDDRLLLPIPRLKTNNPE 311

Query: 309 GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIE 368
              K   +  +   +       + +  ++ G   +A      A+K  P    +  LA   
Sbjct: 312 QLEKVLRQQIKNVGDRPLLWSTLGQSLMKHGEWQEASLAFRAALKQRPDAYDYAWLADAL 371

Query: 369 QANSHNTDKI 378
                  +  
Sbjct: 372 DRLHKPEEAA 381


>gi|153835504|ref|ZP_01988171.1| HemY protein [Vibrio harveyi HY01]
 gi|148867930|gb|EDL67140.1| HemY protein [Vibrio harveyi HY01]
          Length = 393

 Score = 82.7 bits (203), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 58/383 (15%), Positives = 124/383 (32%), Gaps = 20/383 (5%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RLI  F V+   +      S     V I+  N+    S   ++  +   L A   L  
Sbjct: 1   MVRLIFLFVVLGAGLFVGTQFSGQQGYVLISIANKTIEMSVTTLVIFVIAALAALFFLEY 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V +  +   +  ++    R   +  +    G++ +   +   A K  +  +  H      
Sbjct: 61  VVKKVVYASSSTWNYFSVRKMRRSRRYTNEGIIKLLEGDWKGAEKKVTRWANHH--DMPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAV---YSLYFESCRIGDLNSAQRYA 177
           L YL+  + A  +       ++   +         AV        +  R  +  SA    
Sbjct: 119 LCYLVASEAAQGQGDKAK-RDQYLELASQQENAHLAVELTR--AKQFIRDNEFESAFDTL 175

Query: 178 TKALDISPDAPWVTEAVVQ-QYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLEN 236
             AL        +   +++  Y+  K W   I  + Q  K        +A ++       
Sbjct: 176 Q-ALKGQYANNSIVLNLLKTTYMQLKLWQPLIDLMPQLSKAKLVTEEEQAEMIQKAQCGL 234

Query: 237 ADKGDMIASYHDAI-------ESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKV 289
             +          I         +K   + I    C A  LIS+    +A  ++++  K 
Sbjct: 235 LHEVAQQQGSEGLISHWNGLPRKVKQDAHLI---GCFAHELISRKADNEAFTVIKEALKK 291

Query: 290 NPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAM 349
           +P PE+  +   L   ++   +     + +   E+  +   ++          +A     
Sbjct: 292 SPTPELYQLLPELNLPDSHPVIVFLEGVLKREPENAAAQSALAHFFFRQEKWQEAQEHFE 351

Query: 350 LAMKIAPRKEIFLLLAQIEQANS 372
           +A+K+      +  LA   +  +
Sbjct: 352 VALKLRSDVSDYAYLADTLEKQN 374


>gi|320198492|gb|EFW73093.1| putative protoheme IX biogenesis protein [Escherichia coli EC4100B]
          Length = 398

 Score = 82.7 bits (203), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 53/370 (14%), Positives = 110/370 (29%), Gaps = 21/370 (5%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V +   N    TS   +  IL   +     +  + R      A        R 
Sbjct: 21  IAGHQGYVLLQTDNYNIETSVTGLAIILILAMVVLFAIEWLLRRIFRTGAHTRGWFVGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A        A+
Sbjct: 81  RRRARKQTEQALLKLAEGDYQQVEKLMAKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 138

Query: 141 EKLEMMLQ--------IPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
           + LE   +        +  TR               + ++A+    K L+++P  P V  
Sbjct: 139 QHLERAAELAGNDTIPVEITRV-------RLQLARNENHAARHGVDKLLEVTPRHPEVLR 191

Query: 193 AVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIAS----YHD 248
              Q Y+    WS  +  +    K       +RA+L     +   D+           + 
Sbjct: 192 LAEQAYIRTGAWSSLLDIIPSMAKAHVGDEEHRAMLEQQAWIGLMDQARADNGSEGLRNW 251

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
                +   + +   +  A+ LI  +    A+ I+    K      +      L + N  
Sbjct: 252 WKNQSRKTRHQVALQVAMAEHLIECDDHDTAQQIIIDGLKRQYDDRLLLPIPRLKTNNPE 311

Query: 309 GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIE 368
              K   +  +   +       + +  ++ G   +A      A+K  P    +  LA   
Sbjct: 312 QLEKVLRQQIKNVGDRPLLWSTLGQSLMKHGEWQEASLAFRAALKQRPDAYDYAWLADAL 371

Query: 369 QANSHNTDKI 378
                  +  
Sbjct: 372 DRLHKPEEAA 381


>gi|163803634|ref|ZP_02197499.1| HemY protein [Vibrio sp. AND4]
 gi|159172582|gb|EDP57442.1| HemY protein [Vibrio sp. AND4]
          Length = 393

 Score = 82.7 bits (203), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 56/376 (14%), Positives = 117/376 (31%), Gaps = 18/376 (4%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+RLI  F V+   +      S     V I+  N+    S   ++ ++   L A  LL  
Sbjct: 1   MVRLIFLFVVLGAGLFVGTQFSGQQGYVLISIANKTIEMSVTTLVLLVIAVLTALFLLEY 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           V +  +   +  ++    R      +    G++ +   +   A K  +  +  H      
Sbjct: 61  VIKKVVYASSSTWNYFSVRKMRHSRRFTNEGIIKLLEGDWKGAEKKVTRWANHH--DMPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAV---YSLYFESCRIGDLNSAQRYA 177
           L YL+  + A  +       ++   +         AV        +  R  +  +A    
Sbjct: 119 LCYLVASEAAQGQGDKAK-RDQYLELASQQENAHLAVELTR--AKQFIRENEFEAAFDTL 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENA 237
                       V   +   Y+  K W   +  + Q  K        +A L+        
Sbjct: 176 QTLKSQYTSNAIVLNLLKTTYIQLKLWQPLLDLMPQLSKAKLVTEEEQAELIQKSQFGLL 235

Query: 238 DKGDMIASYHDAI-------ESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVN 290
            +          I         ++   + I    C A  LIS+    +A  ++++  K N
Sbjct: 236 HEVAQQQGSEGLISHWNSLPRKVRQDSHLI---GCFAHELISRKADAEAFTVIKEALKKN 292

Query: 291 PHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAML 350
           P PE+  +   L   +    +       +   ++  +   ++          +A     +
Sbjct: 293 PSPELYRLLPELNLADIHPVVIFLEGTLKREPDNAAAQSALAHFYFRQERWQEAQQHFEI 352

Query: 351 AMKIAPRKEIFLLLAQ 366
           A+K+      +  LA 
Sbjct: 353 ALKLRSDVSDYAFLAD 368


>gi|261378809|ref|ZP_05983382.1| HemY family protein [Neisseria cinerea ATCC 14685]
 gi|269144789|gb|EEZ71207.1| HemY family protein [Neisseria cinerea ATCC 14685]
          Length = 405

 Score = 82.7 bits (203), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 56/396 (14%), Positives = 121/396 (30%), Gaps = 26/396 (6%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M  ++    + +  +   +    Y  DV I  G  + R +    +      +  W  LF 
Sbjct: 1   MKTVVWIVILFAAAVGLALASGIYTGDVFIVLGQTMLRINLHAFVLGSLIAVVVWYFLFK 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQH-TFHNE 119
                 + P  +      R   K    L    ++        A    S V        N 
Sbjct: 61  FIIGVFNIPEKMQRFSLARKGRKAALYLNKAGLAYFEGRFEKAELEASRVLGNKEAGDNR 120

Query: 120 YLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFE-SCRIGDLNSAQRYAT 178
            L  +L    A       +    L  + ++P  ++ + Y L  E +    D  + +    
Sbjct: 121 TLALMLGAHAAGQMGNTELRDRYLAEIAKLPEKQQLSRYLLLAESALNRRDYETVEANLH 180

Query: 179 KALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENAD 238
            A  ++     +    ++      +   A+  L + +K +K      A  L     E   
Sbjct: 181 AAAKMNAGLTRLVRLQLRYAFERGD---ALEVLAKTEKLSK------AGALGESETEQYQ 231

Query: 239 KGDMIASYHDAIES--LKLCDNSIM-------ASICAAKSLISQNKKRKAEVILEKIWKV 289
                    DA ++  LK+C   I         S+  A+         +A   +++ +  
Sbjct: 232 NWAYRRLLADADDAVSLKVCLKRIPDSLKNGELSVSVAEKYERLGLYAEAVRWVKQHYPQ 291

Query: 290 NPHPEIANIYTH----LLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAH 345
           +  PE+   +      L   +    +  A        ++   L+ + ++A       +A 
Sbjct: 292 SRRPELLEAFVESVRFLGERDQQKAIDLADAWLRDQPDNALLLMYLGQLAYGRKLWGKAK 351

Query: 346 AKAMLAMKIAPRKEIFLLLAQI--EQANSHNTDKIL 379
                ++ + P     L+LA++  E   +   +   
Sbjct: 352 GYLEASIALKPSISARLVLAKVFDEIGETQKAEAQR 387


>gi|82779020|ref|YP_405369.1| putative protoheme IX biogenesis protein [Shigella dysenteriae
           Sd197]
 gi|309784518|ref|ZP_07679156.1| tetratricopeptide repeat family protein [Shigella dysenteriae 1617]
 gi|81243168|gb|ABB63878.1| a late step of protoheme IX synthesis [Shigella dysenteriae Sd197]
 gi|308927624|gb|EFP73093.1| tetratricopeptide repeat family protein [Shigella dysenteriae 1617]
          Length = 398

 Score = 82.3 bits (202), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 54/370 (14%), Positives = 110/370 (29%), Gaps = 21/370 (5%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I   N    TS   +  IL   +     +  + R      A        R 
Sbjct: 21  IAGHQGYVLIQTDNYNIETSVTGLAIILILAMVVLFAIEWLLRRIFRTGAHTRGWFVGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A        A+
Sbjct: 81  RRRARKQTEQALLKLAEGDYQQVEKLMAKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 138

Query: 141 EKLEMMLQ--------IPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
           + LE   +        +  TR               + ++A+    K L+++P  P V  
Sbjct: 139 QHLERAAELAGNDTIPVEITRV-------RLQLARNENHAARHGVDKLLEVTPLHPEVLR 191

Query: 193 AVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIAS----YHD 248
              Q Y+    WS  +  +    K       +RA+L     +   D+           + 
Sbjct: 192 LAEQAYIRTGAWSSLLDIIPSMAKAHVGDEEHRAMLEQQAWIGLMDQARADNGSEGLRNW 251

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
                +   + +   +  A+ LI  +    A+ I+    K      +      L + N  
Sbjct: 252 WKNQSRKTRHQVALQVAMAEHLIECDDHDTAQQIIIDGLKRQYDDRLLLPIPRLKTNNPE 311

Query: 309 GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIE 368
              K   +  +   +       + +  ++ G   +A      A+K  P    +  LA   
Sbjct: 312 QLEKVLRQQIKNVGDRPLLWSTLGQSLMKHGEWQEASLAFRAALKQRPDAYDYAWLADAL 371

Query: 369 QANSHNTDKI 378
                  +  
Sbjct: 372 DRLHKPEEAA 381


>gi|332084684|gb|EGI89872.1| tetratricopeptide repeat family protein [Shigella boydii 5216-82]
          Length = 398

 Score = 82.3 bits (202), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 54/370 (14%), Positives = 109/370 (29%), Gaps = 21/370 (5%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I   N    TS   +  IL   +     +  + R      A        R 
Sbjct: 21  IAGHQGYVLIQTDNYNIETSVTGLAIILILAMVVLFAIEWLLRRIFRTGAHTRGWFVGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A        A+
Sbjct: 81  RRRARKQTEQALLKLAEGDYQQVEKLMAKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 138

Query: 141 EKLEMMLQ--------IPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
           + LE   +        +  TR               + ++A+    K L ++P  P V  
Sbjct: 139 QHLERAAELAGNDTIPVEITRV-------RLQLARNENHAARHGVDKLLVVTPRHPEVLR 191

Query: 193 AVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIAS----YHD 248
              Q Y+    WS  +  +    K       +RA+L     +   D+           + 
Sbjct: 192 LAEQAYIRTGAWSSLLDIIPSMAKAHVGDEEHRAMLEQQAWIGLMDQARADNGSEGLRNW 251

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
                +   + +   +  A+ LI  +    A+ I+    K      +      L + N  
Sbjct: 252 WKNQSRKTRHQVALQVAMAEHLIECDDHDTAQQIIIDGLKRQYDDRLLLPIPRLKTNNPE 311

Query: 309 GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIE 368
              K   +  +   +       + +  ++ G   +A      A+K  P    +  LA   
Sbjct: 312 QLEKVLRQQIKNVGDRPLLWSTLGQSLMKHGEWQEASLAFRAALKQRPDAYDYAWLADAL 371

Query: 369 QANSHNTDKI 378
                  +  
Sbjct: 372 DRLHKPEEAA 381


>gi|324007479|gb|EGB76698.1| HemY protein [Escherichia coli MS 57-2]
          Length = 398

 Score = 82.3 bits (202), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 54/370 (14%), Positives = 110/370 (29%), Gaps = 21/370 (5%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I   N    TS   +  IL   +     +  + R      A        R 
Sbjct: 21  IAGHQGYVLIQTDNYNIETSVTGLAIILILAMVVLFAIEWLLRRIFRTGAHTRGWFVGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A        A+
Sbjct: 81  RRRARKQTEQALLKLAEGDYQQVEKLMAKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 138

Query: 141 EKLEMMLQ--------IPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
           + LE   +        +  TR               + ++A+    K L+++P  P V  
Sbjct: 139 QHLERAAELAGNDTIPVEITRV-------RLQLARNENHAARHGVDKLLEVTPRHPEVLR 191

Query: 193 AVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIAS----YHD 248
              Q Y+    WS  +  +    K       +RA+L     +   D+           + 
Sbjct: 192 LAEQAYIRTSAWSSLLDIIPSMAKAHVGDEEHRAMLEQQAWIGLMDQARADNGCEGLRNW 251

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
                +   + +   +  A+ LI  +    A+ I+    K      +      L + N  
Sbjct: 252 WKNQSRKTRHQVALQVAMAEHLIECDDHDTAQQIIIDGLKRQYDDRLLLPIPRLKTNNPE 311

Query: 309 GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIE 368
              K   +  +   +       + +  ++ G   +A      A+K  P    +  LA   
Sbjct: 312 QLEKVLRQQIKNVGDRPLLWSTLGQSLMKHGEWQEASLAFRAALKQRPDAYDYAWLADAL 371

Query: 369 QANSHNTDKI 378
                  +  
Sbjct: 372 DRLHKPEEAA 381


>gi|323974383|gb|EGB69511.1| hemY protein [Escherichia coli TW10509]
          Length = 398

 Score = 82.3 bits (202), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 53/370 (14%), Positives = 109/370 (29%), Gaps = 21/370 (5%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I        TS   +  IL   +     +  + R      A        R 
Sbjct: 21  IAGHQGYVLIQTDTYNIETSVTGLAIILILAMVVLFAIEWLLRRIFRTGAHTRGWFVGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A        A+
Sbjct: 81  RRRARKQTEQALLKLAEGDYQQVEKLMAKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 138

Query: 141 EKLEMMLQ--------IPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
           + LE   +        +  TR               + ++A+    K L+++P  P V  
Sbjct: 139 QHLERAAELAGNDTIPVEITRV-------RLQLARNENHAARHGVDKLLEVTPRHPEVLR 191

Query: 193 AVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIAS----YHD 248
              Q Y+    WS  +  +    K       +RA+L     +   D+           + 
Sbjct: 192 LAEQAYIRTGAWSSLLDIIPSMAKAHVGDEEHRAMLEQQAWIGLMDQARADNGSEGLRNW 251

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
                +   + +   +  A+ LI  +    A+ I+    K      +      L + N  
Sbjct: 252 WKNQSRKTRHQVALQVAMAEHLIECDDHDTAQQIIIDGLKRQYDDRLLLPIPRLKTNNPE 311

Query: 309 GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIE 368
              K   +  +   +       + +  ++ G   +A      A+K  P    +  LA   
Sbjct: 312 QLEKVLRQQIKNVGDRPLLWSTLGQSLMKHGEWQEASLAFRAALKQRPDAYDYAWLADAL 371

Query: 369 QANSHNTDKI 378
                  +  
Sbjct: 372 DRLHKPEEAA 381


>gi|283787521|ref|YP_003367386.1| Porphyrin biosynthetic protein [Citrobacter rodentium ICC168]
 gi|282950975|emb|CBG90652.1| Porphyrin biosynthetic protein [Citrobacter rodentium ICC168]
          Length = 399

 Score = 82.3 bits (202), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 51/370 (13%), Positives = 107/370 (28%), Gaps = 21/370 (5%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I        TS   ++ IL   +     +  + R      A        R 
Sbjct: 22  IAGHQGYVLIQTDTYNIETSVTGLVIILILAMVVLFAIEWLLRRIFRTGAHTRGWFVGRK 81

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A        A+
Sbjct: 82  RRRARKQTEQALLKLAEGDYQQVEKLMAKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 139

Query: 141 EKLEMMLQ--------IPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
           + LE   +        +  TR               + ++A+    + L+++P  P V  
Sbjct: 140 QHLERAAELADNDTIPVEITRV-------RLQLARNENHAARHGIDRLLEVTPRHPEVLR 192

Query: 193 AVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIAS----YHD 248
              Q Y+    WS  +  +    K       +R  L     +   D+             
Sbjct: 193 LAEQAYIRTGAWSSLLDIIPSMAKANVGDEEHRDALEQQAWIGLMDQARADRGNEGLREW 252

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
                +   + +   +  A+ LI  +    A+ I+    K      +      L + N  
Sbjct: 253 WKNQSRKTRHQVALQVAMAEHLIECDDHDMAQQIIIDGLKRQYDDRLLLPIPRLKTNNPQ 312

Query: 309 GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIE 368
              K   +  +   +       + +  ++ G   +A      A+K  P    +  LA   
Sbjct: 313 QLEKVLRQQIKSVGDRPLLWSTLGQSLMKHGEWQEATIAFRAALKQRPDAYDYAWLADAL 372

Query: 369 QANSHNTDKI 378
                  +  
Sbjct: 373 DRLHQPEEAA 382


>gi|238760187|ref|ZP_04621334.1| hypothetical protein yaldo0001_1030 [Yersinia aldovae ATCC 35236]
 gi|238701623|gb|EEP94193.1| hypothetical protein yaldo0001_1030 [Yersinia aldovae ATCC 35236]
          Length = 399

 Score = 82.3 bits (202), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 54/365 (14%), Positives = 116/365 (31%), Gaps = 7/365 (1%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   + I   N    TS   ++ +L  FL  ++++  + R               R 
Sbjct: 21  LAGHQGYMLIQTDNYNVETSVTGLVIMLVLFLVTFLIIEWILRRIFRTGTRTRGWFMGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A         +
Sbjct: 81  RSRARKQTKAALIKLAEGDFKQVEKLLTRNADHA--EQPMVNYLLAAEAAQQRGDEFRTN 138

Query: 141 EKLEMMLQIPATREFAV-YSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYV 199
           + LE   ++  T +  V  +        G +++A+    + LD +P  P V       Y+
Sbjct: 139 QYLERAAEVADTDQLPVDITRVRIQLAQGHIHAARHGVDRLLDQAPRHPEVLRLAELAYL 198

Query: 200 LAKEWSRAITFLNQ----KKKNAKEWNRNRAILLIARSLENADKGDMIASYHDAIESLKL 255
            +  +S  +  L      +   A+E         I    +   +           +  + 
Sbjct: 199 RSGAYSSLLEVLPAMGKVQLHTAEELAALEQQAYIGMMNQCMAEEGSDGLKRWWKDQSRK 258

Query: 256 CDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRAL 315
             N I   +  A+ LI  +    A+ I+    K      +  +   L S N     K   
Sbjct: 259 VRNEIPLQVALAEHLIECDDHDVAQQIILDSLKRQYDERLILLIPRLKSGNPEPLEKSLR 318

Query: 316 RLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNT 375
           +  + +  +      + ++ L+ G  ++A      A+   P    +  LA          
Sbjct: 319 QHIKQHGATPLLNSTLGQLMLKHGEWEKASEAFKAALAQRPDGYDYAWLADACDKLHRPE 378

Query: 376 DKILY 380
           D    
Sbjct: 379 DAAQA 383


>gi|296162269|ref|ZP_06845064.1| HemY domain protein [Burkholderia sp. Ch1-1]
 gi|295887536|gb|EFG67359.1| HemY domain protein [Burkholderia sp. Ch1-1]
          Length = 396

 Score = 81.9 bits (201), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 51/410 (12%), Positives = 123/410 (30%), Gaps = 46/410 (11%)

Query: 2   LRLIRYFFVISLVICSFIIVSH-YPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           +R + +  ++ ++     +V       V + +       S  + +  L         L  
Sbjct: 3   IRGLLWLALLFVIAVVLAVVGRFDMGQVLLIYPPYRVDMSLNLFVVGLVVLFILLYALLR 62

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQ-------- 112
           + R     P  +     +    K + AL   + ++ A     A K               
Sbjct: 63  IFRNIWRMPQRVAAYRARSRVAKAHAALRDAIGNLYAGRFSRAEKAAKDALANGDNKGAA 122

Query: 113 -------QHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESC 165
                   H  H          QI  A   +  A      ++     R            
Sbjct: 123 GLIAATAAHRMHEYARRDEWLAQINEA--DWQDAR-----LMATADMRADGR-------- 167

Query: 166 RIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFL----NQKKKNAKEW 221
              D + A    T+            +  ++     K W   +  +     ++  +    
Sbjct: 168 ---DADGALTALTEMQSQGARRIHAQQITLRAQQQLKNWGEVLKLVKTLEKREAIHPAVA 224

Query: 222 NRNRAILLIARSLENADKGDMIASYHDAIESL-KLCDNSIMASICAAKSLISQNKKRKAE 280
            R R I       +     D +    +++ +  +        +  AA+ L++ N+ ++A 
Sbjct: 225 VRLRQIAAENLLRDRRHNADALLELWNSLSATERHSPRL---ADLAAELLVALNRPQEAR 281

Query: 281 VILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGS 340
            I+E+    N    +   Y      + +  +++A   ++   E  + +  + ++ L    
Sbjct: 282 KIVEEALAQNWDARLLRRYPDTAGGDALPLIQKAEAWQKDRPEDADLMFALGRLCLHQQL 341

Query: 341 IDQAHAKAMLAMKIAPRK----EIFLLLAQIEQANSHNTDKILYWTQSAL 386
             +A +    A+K+A  +         LA++ +          ++ +SAL
Sbjct: 342 WGKAQSFLERALKLADNETLKIRSHRALARLHEQLGDTEKASQHYRESAL 391


>gi|323964046|gb|EGB59536.1| hemY protein [Escherichia coli M863]
 gi|327250651|gb|EGE62357.1| tetratricopeptide repeat family protein [Escherichia coli STEC_7v]
          Length = 398

 Score = 81.9 bits (201), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 53/370 (14%), Positives = 109/370 (29%), Gaps = 21/370 (5%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I        TS   +  IL   +     +  + R      A        R 
Sbjct: 21  IAGHQGYVLIQTDTYNIETSVTGLAIILILAMVVLFAIEWLLRRIFRTGAHTRGWFIGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A        A+
Sbjct: 81  RRRARKQTEQALLKLAEGDYQQVEKLMAKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 138

Query: 141 EKLEMMLQ--------IPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
           + LE   +        +  TR               + ++A+    K L+++P  P V  
Sbjct: 139 QHLERAAELAGNDTIPVEITRV-------RLQLARNENHAARHGVDKLLEVTPRHPEVLR 191

Query: 193 AVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIAS----YHD 248
              Q Y+    WS  +  +    K       +RA+L     +   D+           + 
Sbjct: 192 LAEQAYIRTGAWSSLLDIIPSMAKAHVGDEEHRAMLEQQAWIGLMDQARADNGSEGLRNW 251

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
                +   + +   +  A+ LI  +    A+ I+    K      +      L + N  
Sbjct: 252 WKNQSRKTRHQVALQVAMAEHLIECDDHDTAQQIIIDGLKRQYDDRLLLPIPRLKTNNPE 311

Query: 309 GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIE 368
              K   +  +   +       + +  ++ G   +A      A+K  P    +  LA   
Sbjct: 312 QLEKVLRQQIKNVGDRPLLWSTLGQSLMKHGEWQEASLAFRAALKQRPDAYDYAWLADAL 371

Query: 369 QANSHNTDKI 378
                  +  
Sbjct: 372 DRLHKPEEAA 381


>gi|320197611|gb|EFW72223.1| putative protoheme IX biogenesis protein [Escherichia coli
           WV_060327]
          Length = 398

 Score = 81.9 bits (201), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 54/370 (14%), Positives = 110/370 (29%), Gaps = 21/370 (5%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I   N    TS   +  IL   +     +  + R      A        R 
Sbjct: 21  IAGHQGYVLIQTDNYNIETSVTGLAIILILAMVVLFAIEWLLRRIFRTGAHTRGWFVGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +  K     L+ +A  +     K+ +  +         + YLL  + A        A+
Sbjct: 81  RRRARKQTEQALLKLAEGDYQQVEKLMAKNADHA--EQPVVNYLLAAEAAQQRGDEARAN 138

Query: 141 EKLEMMLQ--------IPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTE 192
           + LE   +        +  TR               + ++A+    K L+++P  P V  
Sbjct: 139 QHLERAAELAGNDTIPVEITRV-------RLQLARNENHAARHGVDKLLEVTPRHPEVLR 191

Query: 193 AVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIAS----YHD 248
              Q Y+    WS  +  +    K       +RA+L     +   D+           + 
Sbjct: 192 LAEQAYIRTGAWSSLLDIIPSMAKAHVGDEEHRAMLEQQAWIGLMDQARADNGSEGLRNW 251

Query: 249 AIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTV 308
                +   + +   +  A+ LI  +    A+ I+    K      +      L + N  
Sbjct: 252 WKNQSRKTRHQVALQVAMAEHLIECDDHDTAQQIIIDGLKRQYDDRLLLPIPRLKTNNPE 311

Query: 309 GKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIE 368
              K   +  +   +       + +  ++ G   +A      A+K  P    +  LA   
Sbjct: 312 LLEKVLRQQIKNVGDRPLLWSTLGQSLMKHGEWQEASLAFRAALKQRPDAYDYAWLADAL 371

Query: 369 QANSHNTDKI 378
                  +  
Sbjct: 372 DRLHKPEEAA 381


>gi|260767545|ref|ZP_05876481.1| HemY-like protein [Vibrio furnissii CIP 102972]
 gi|260617445|gb|EEX42628.1| HemY-like protein [Vibrio furnissii CIP 102972]
          Length = 393

 Score = 81.9 bits (201), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 51/379 (13%), Positives = 114/379 (30%), Gaps = 12/379 (3%)

Query: 1   MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           M+R++  F V+ L + +    +     V I+  +     S   ++  +   L     L  
Sbjct: 1   MVRVLFLFVVLGLGLFAGTQYAGQQGYVLISVASHTIEMSVTTLVIFIIGALAGLFALEY 60

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY 120
           + +  +   +  ++    R   +  +     ++ +   +   A K  +  +  H      
Sbjct: 61  LLKKLMYASSNTWNWFSVRKLRRSRRYTNEAIIKLLEGDWKQAEKKVTRWANHH--DMPL 118

Query: 121 LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAV---YSLYFESCRIGDLNSAQRYA 177
           L YL+  + A          ++   +         AV        +    G+L +A    
Sbjct: 119 LCYLVASEAANGMGDRAK-RDRYLALAAQQENATLAVELTR--AKQQLSDGELQAALSTL 175

Query: 178 TKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENA 237
           +      P+   V   + Q Y   K+W   +  L +  K  +        L +       
Sbjct: 176 SALQADHPNNTIVLNLLKQTYTQLKQWQPLLDLLPKLVKAKRMTQDEADQLALVAHQGVM 235

Query: 238 DKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAE----VILEKIWKVNPHP 293
           D           I         + A      +LI Q   RKA+     ++++  K  P P
Sbjct: 236 DTIASQKGSEGLIAHWNSLPRKLKAESQLELNLIRQLIVRKADYEAFTLIKESLKKRPSP 295

Query: 294 EIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMK 353
            +  +   L   +    +         +  + E+   + ++ L       A      A+ 
Sbjct: 296 ALYALLPELNISDRHPAIVLLKDALNRDGNNAEAHSALGQLYLREQQWADAQQHLEKALS 355

Query: 354 IAPRKEIFLLLAQIEQANS 372
           +      +  LA   +   
Sbjct: 356 LRSSVSDYAYLADALEKQH 374


>gi|91782422|ref|YP_557628.1| hypothetical protein Bxe_A3409 [Burkholderia xenovorans LB400]
 gi|91686376|gb|ABE29576.1| Conserved hypothetical protein [Burkholderia xenovorans LB400]
          Length = 396

 Score = 81.9 bits (201), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 51/410 (12%), Positives = 123/410 (30%), Gaps = 46/410 (11%)

Query: 2   LRLIRYFFVISLVICSFIIVSH-YPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA 60
           +R + +  ++ ++     +V       V + +       S  + +  L         L  
Sbjct: 3   IRGLLWLALLFVIAVVLAVVGRFDMGQVLLIYPPYRVDMSLNLFVVGLVVLFILLYALLR 62

Query: 61  VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQ-------- 112
           + R     P  +     +    K + AL   + ++ A     A K               
Sbjct: 63  IFRNIWRMPQRVAAYRARSRVAKAHAALRDAIGNLYAGRFSRAEKAAKDALANGDNKGAA 122

Query: 113 -------QHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESC 165
                   H  H          QI  A   +  A      ++     R            
Sbjct: 123 GLIAATAAHRMHEYARRDEWLAQIKEA--DWQDAR-----LMATADMRADGR-------- 167

Query: 166 RIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFL----NQKKKNAKEW 221
              D + A    T+            +  ++     K W   +  +     ++  +    
Sbjct: 168 ---DADGALAALTEMQSQGARRIHAQQITLRAQQQLKNWGEVLKLVKTLEKREAIHPAVA 224

Query: 222 NRNRAILLIARSLENADKGDMIASYHDAIESL-KLCDNSIMASICAAKSLISQNKKRKAE 280
            R R I       +     D +    +++ +  +        +  AA+ L++ N+ ++A 
Sbjct: 225 VRLRQIAAENLLRDRRHNADALLELWNSLSATERHSPRL---ADLAAELLVALNRPQEAR 281

Query: 281 VILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGS 340
            I+E+    N    +   Y      + +  +++A   ++   E  + +  + ++ L    
Sbjct: 282 KIVEEALAQNWDARLLRRYPDTAGGDALPLIQKAEAWQKDRPEDADLMFALGRLCLHQQL 341

Query: 341 IDQAHAKAMLAMKIAPRK----EIFLLLAQIEQANSHNTDKILYWTQSAL 386
             +A +    A+K+A  +         LA++ +          ++ +SAL
Sbjct: 342 WGKAQSFLERALKLADNETLKIRSHRALARLHEQLGDTEKASQHYRESAL 391


>gi|153949571|ref|YP_001399192.1| protoheme IX biogenesis protein [Yersinia pseudotuberculosis IP
           31758]
 gi|152961066|gb|ABS48527.1| hemY protein [Yersinia pseudotuberculosis IP 31758]
          Length = 406

 Score = 81.5 bits (200), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 54/365 (14%), Positives = 113/365 (30%), Gaps = 7/365 (1%)

Query: 21  VSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRN 80
           ++ +   V I   N    TS   +  +L   L A+ ++  V R      A        R 
Sbjct: 21  LAGHQGYVLIQTDNYNVTTSVTGLAIMLVLLLVAFFIVEWVLRRIFRTGARTRGWFLGRK 80

Query: 81  YDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAH 140
             +    +   L+ +A  +     K+ +  +         + YLL  + A         +