BLAST/PSIBLAST alignment of GI: 254781034 and GI: 190893755 at iteration 1
>gi|190893755|ref|YP_001980297.1| hypothetical protein RHECIAT_CH0004190 [Rhizobium etli CIAT 652] Length = 416
>gi|190699034|gb|ACE93119.1| hypothetical conserved protein [Rhizobium etli CIAT 652] Length = 416
 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 66/223 (29%), Positives = 114/223 (51%), Gaps = 13/223 (5%)

Query: 124 ELANTQNFNIKPLLEEIASLKQLISDLSK-------NYQDIVTRLTKMETLTANPLRNPN 176
           E AN +  N K + E    ++QL S L++       N  DI  RL + E     P ++  
Sbjct: 189 EPANVEALNQK-IAELSGQVEQLRSTLAQSSEQQTSNGADIAKRLDEAEKKLNEPRQDVA 247

Query: 177 TQRMVSLLILKNALDKGE--YSSLNTTMQENFSVLKPCTATLMQFANIKIPTTIEILAKF 234
             R ++   LK A+D+G    + L+T      +   P  A L  FA   IP+  E++ + 
Sbjct: 248 VARAIAAAALKAAIDRGGPFVAELDTFA--GVAPDDPAVADLRSFAETGIPSRAELVRQI 305

Query: 235 PKVSEEMVFASESLEKDSGFANYLLFQLTRLVKVRPIGGNIEGDAITDVIARIENNLKTG 294
           P V+  +V A    + +  +++ L+     LV +RP+G NIEG+++  + AR+E+ +K G
Sbjct: 306 PDVATAIVEAVNQPDPNQSWSDRLMASAKSLVTIRPVG-NIEGESVEAIAARMEDKVKNG 364

Query: 295 DLVKAAAEWDKIPEKARQPSMFLRNALEAHICSDAILKEEMAK 337
           DL  A+AEW+ +P   +Q S   + +LEA I  + ++   ++K
Sbjct: 365 DLPGASAEWNALPALGKQASAAFKQSLEARIRVEELVGGALSK 407