BLAST/PSIBLAST alignment of GI: 254781034 and GI: 209551273 at iteration 1
>gi|209551273|ref|YP_002283190.1| hypothetical protein Rleg2_3701 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 428
>gi|209537029|gb|ACI56964.1| conserved hypothetical protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 428
 Score = 85.9 bits (211), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 64/209 (30%), Positives = 107/209 (51%), Gaps = 13/209 (6%)

Query: 126 ANTQNFNIKPLLEEIASLKQLISDLSKNYQ-------DIVTRLTKMETLTANPLRNPNTQ 178
           AN +  N K + E    + QL + L+++ +       DI  RL + E     P  +    
Sbjct: 203 ANVEALNQK-IAELTGQVDQLRATLAQSSEQQTTSGADIAKRLDEAEKKLNEPREDVAVA 261

Query: 179 RMVSLLILKNALDKGE--YSSLNTTMQENFSVLKPCTATLMQFANIKIPTTIEILAKFPK 236
           R ++   LK A+D+G    + L+T      +   P  A L  FA   IP+  E++ + P 
Sbjct: 262 RAIAAAALKAAIDRGGPFLAELDTFA--GVAPDDPAVADLRAFAETGIPSRAELMRQVPD 319

Query: 237 VSEEMVFASESLEKDSGFANYLLFQLTRLVKVRPIGGNIEGDAITDVIARIENNLKTGDL 296
           V+  +V A    + +  +++ L+     LV VRP+G NIEGD++  + AR+E+ +K+GDL
Sbjct: 320 VATAIVEAVNQPDPNESWSDRLMSSAKSLVSVRPVG-NIEGDSVEAIAARMEDKVKSGDL 378

Query: 297 VKAAAEWDKIPEKARQPSMFLRNALEAHI 325
             A+AEW+ +P   +Q S   + +LEA I
Sbjct: 379 PGASAEWNNLPAPGKQASAAFKQSLEARI 407