BLAST/PSIBLAST alignment of GI: 254781034 and GI: 325294023 at iteration 1
>gi|325294023|ref|YP_004279887.1| hypothetical protein AGROH133_08879 [Agrobacterium sp. H13-3] Length = 480
>gi|325061876|gb|ADY65567.1| hypothetical protein AGROH133_08879 [Agrobacterium sp. H13-3] Length = 480
 Score = 85.9 bits (211), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 69/211 (32%), Positives = 105/211 (49%), Gaps = 15/211 (7%)

Query: 124 ELANTQNFNIKPLLEEIASLKQ-LISDLSKNYQ---DIVTRLTKMETLTANPLRNPNTQR 179
           E A  +   +  L E+I +L+  L S+ S       ++  RLT  ET    P  +    R
Sbjct: 255 EGAKGEAPQVDALSEKITALESALTSERSAQASATAELTRRLTDAETKINEPRDDIEVAR 314

Query: 180 MVSLLILKNALDKG-----EYSSLNTTMQENFSVLKPCTATLMQFANIKIPTTIEILAKF 234
            ++   LK A+D+G     E  +L+    ++     P  A+L  FA   +P+  E++ KF
Sbjct: 315 AIASAALKAAIDRGGPFLTELDTLSKVTPDD-----PAIASLQSFAATGVPSRSELMQKF 369

Query: 235 PKVSEEMVFASESLEKDSGFANYLLFQLTRLVKVRPIGGNIEGDAITDVIARIENNLKTG 294
           P V   M+ A    + + G    L      LVKVRP+G NIEG+    +IAR+EN L+ G
Sbjct: 370 PDVVNAMLSAINRPDPNQGIMERLTESAFSLVKVRPVG-NIEGETPDAMIARMENKLRNG 428

Query: 295 DLVKAAAEWDKIPEKARQPSMFLRNALEAHI 325
           DL  AA EW+ +PE A+  S   + +L+A I
Sbjct: 429 DLQGAALEWNGLPEAAKTASADYKKSLDARI 459