BLAST/PSIBLAST alignment of GI: 254781034 and GI: 327188881 at iteration 1
>gi|327188881|gb|EGE56073.1| hypothetical protein RHECNPAF_750032 [Rhizobium etli CNPAF512] Length = 421
 Score = 85.5 bits (210), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 114/223 (51%), Gaps = 13/223 (5%)

Query: 124 ELANTQNFNIKPLLEEIASLKQLISDLSK-------NYQDIVTRLTKMETLTANPLRNPN 176
           E AN +  N K + E    ++QL S L++       N  DI  RL + E     P ++  
Sbjct: 194 EPANVEALNQK-IAELSGQVEQLRSTLAQSSEQQTSNGADIAKRLDEAEKKLNEPRQDVA 252

Query: 177 TQRMVSLLILKNALDKGE--YSSLNTTMQENFSVLKPCTATLMQFANIKIPTTIEILAKF 234
             R ++   LK A+D+G    + L+T      +   P  A L  FA   IP+  E++ + 
Sbjct: 253 VARAIAAAALKAAIDRGGPFVAELDTFA--GVAPDDPAVADLRSFAETGIPSRAELVRQV 310

Query: 235 PKVSEEMVFASESLEKDSGFANYLLFQLTRLVKVRPIGGNIEGDAITDVIARIENNLKTG 294
           P V+  +V A    + +  +++ L+     LV VRP+G NIEG+++  + AR+E+ +K G
Sbjct: 311 PDVATAVVEAVNQPDPNQSWSDRLMASAKSLVTVRPVG-NIEGESVEAIAARMEDKVKNG 369

Query: 295 DLVKAAAEWDKIPEKARQPSMFLRNALEAHICSDAILKEEMAK 337
           DL  A+AEW+ +P   +Q S   + +LEA I  + ++   ++K
Sbjct: 370 DLPGASAEWNALPALGKQASAAFKQSLEARIRVEELVGGALSK 412