RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781034|ref|YP_003065447.1| hypothetical protein CLIBASIA_04680 [Candidatus Liberibacter asiaticus str. psy62] (344 letters) >2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, tricarboxylic acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* (B:1-107) Length = 107 Score = 30.2 bits (68), Expect = 0.44 Identities = 11/80 (13%), Positives = 20/80 (25%), Gaps = 7/80 (8%) Query: 163 KMETLTANPLRNPNTQRMVSLLILKNALDK-------GEYSSLNTTMQENFSVLKPCTAT 215 +M+ T + + +L+ LK E + + N C Sbjct: 19 RMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITP 78 Query: 216 LMQFANIKIPTTIEILAKFP 235 + I L P Sbjct: 79 ISALNQPGKKIVIRPLPGLP 98 >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} (A:46-466) Length = 421 Score = 29.9 bits (65), Expect = 0.57 Identities = 4/25 (16%), Positives = 9/25 (36%), Gaps = 1/25 (4%) Query: 130 NFNIKPLLEEIASLKQLIS-DLSKN 153 + ++ + L L + S N Sbjct: 9 DRLGIKSIDGVEYLNNLTQINFSNN 33 >1epw_A Bontoxilysin B, botulinum neurotoxin type B; zinc, metalloprotease, transmembrane, hydrolase; 1.90A {Clostridium botulinum} (A:78-132,A:196-424) Length = 284 Score = 29.4 bits (66), Expect = 0.75 Identities = 14/56 (25%), Positives = 25/56 (44%), Gaps = 5/56 (8%) Query: 144 KQLISDLSKNYQDIVTRLTKMETLTANPLRNPNTQRMVSLLILKNALDK---GEYS 196 K + + +N++ IV RL K+ ++P N N + K + G+YS Sbjct: 145 KSIYDKVLQNFRGIVDRLNKVLVCISDP--NININIYKNKFKDKYKFVEDSEGKYS 198 >3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} (A:1-212,A:291-326) Length = 248 Score = 27.6 bits (60), Expect = 2.2 Identities = 10/26 (38%), Positives = 19/26 (73%) Query: 136 LLEEIASLKQLISDLSKNYQDIVTRL 161 L++EI +KQ+I D+ K +++ V +L Sbjct: 217 LIDEIKPVKQIIEDILKEFKETVEKL 242 >1de4_C Transferrin receptor, hemochromatosis protein; HFE, hereditary hemochromatosis, MHC class I; HET: NAG; 2.80A {Homo sapiens} (C:1-95,C:250-488) Length = 334 Score = 27.1 bits (59), Expect = 3.3 Identities = 9/69 (13%), Positives = 25/69 (36%), Gaps = 1/69 (1%) Query: 256 NYLLFQLTRLVKVR-PIGGNIEGDAITDVIARIENNLKTGDLVKAAAEWDKIPEKARQPS 314 L++ + V+ + ++ I ++ I+ ++ V A+ D A + Sbjct: 87 GRLVYLVENSKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSG 146 Query: 315 MFLRNALEA 323 + L+ Sbjct: 147 VGTALLLKL 155 >1zb7_A Neurotoxin; hexxh metalloprotease; HET: FLC; 2.35A {Clostridium botulinum} (A:79-133,A:197-412) Length = 271 Score = 27.1 bits (60), Expect = 3.5 Identities = 10/56 (17%), Positives = 21/56 (37%), Gaps = 6/56 (10%) Query: 144 KQLISDLSKNYQDIVTRLTKMETLTANPLRNPNTQRMVSLLILKNALDK---GEYS 196 + + +N+QDI RL + + + + + K + G+YS Sbjct: 145 MNIYNKALQNFQDIANRLNIVSSAQGS---GIDISLYKQIYKNKYDFVEDPNGKYS 197 >2a97_A BONT/F, botulinum neurotoxin type F, bontoxilysin F; clostridium botulinum neurotoxin serotype F, light chain, catalytic domain, X-RAY,; 1.80A {Clostridium botulinum} PDB: 2a8a_A 3fie_A 3fii_A (A:276-351) Length = 76 Score = 26.3 bits (58), Expect = 5.7 Identities = 15/56 (26%), Positives = 27/56 (48%), Gaps = 7/56 (12%) Query: 144 KQLISDLSKNYQDIVTRLTKMETLTANPLRNPNTQRMVSLLILKNALDK---GEYS 196 +++ ++L NY+ I TRL+++ +A P + K LDK G Y+ Sbjct: 9 EKIYNNLLANYEKIATRLSEV--NSAPP--EYDINEYKDYFQWKYGLDKNADGSYT 60 >1j36_A ANCE, angiotensin converting enzyme; hydrolase; HET: LPR; 2.40A {Drosophila melanogaster} (A:1-125) Length = 125 Score = 26.0 bits (57), Expect = 6.5 Identities = 10/48 (20%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Query: 170 NPLRNPNTQRMVSLL--ILKNALDKG---EYSSLNTTMQENFSVLKPC 212 ++ + +R L + AL + E + M+ NF+ +K C Sbjct: 73 RSYQSEDLKRQFKALTKLGYAALPEDDYAELLDTLSAMESNFAKVKVC 120 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.316 0.132 0.364 Gapped Lambda K H 0.267 0.0580 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 2,367,253 Number of extensions: 102109 Number of successful extensions: 317 Number of sequences better than 10.0: 1 Number of HSP's gapped: 317 Number of HSP's successfully gapped: 20 Length of query: 344 Length of database: 4,956,049 Length adjustment: 89 Effective length of query: 255 Effective length of database: 1,947,404 Effective search space: 496588020 Effective search space used: 496588020 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 55 (25.3 bits)