BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781036|ref|YP_003065449.1| hypothetical protein CLIBASIA_04690 [Candidatus Liberibacter asiaticus str. psy62] (65 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781036|ref|YP_003065449.1| hypothetical protein CLIBASIA_04690 [Candidatus Liberibacter asiaticus str. psy62] Length = 65 Score = 133 bits (335), Expect = 5e-34, Method: Compositional matrix adjust. Identities = 65/65 (100%), Positives = 65/65 (100%) Query: 1 MWIAPFGSLGVAVLSRYVKSGVFNLDSLLVDFSVSLKEHFFDTYSIPWHSIFYFVSENSK 60 MWIAPFGSLGVAVLSRYVKSGVFNLDSLLVDFSVSLKEHFFDTYSIPWHSIFYFVSENSK Sbjct: 1 MWIAPFGSLGVAVLSRYVKSGVFNLDSLLVDFSVSLKEHFFDTYSIPWHSIFYFVSENSK 60 Query: 61 EYCKK 65 EYCKK Sbjct: 61 EYCKK 65 >gi|254781051|ref|YP_003065464.1| alpha-ketoglutarate decarboxylase [Candidatus Liberibacter asiaticus str. psy62] Length = 957 Score = 23.5 bits (49), Expect = 0.72, Method: Compositional matrix adjust. Identities = 8/15 (53%), Positives = 12/15 (80%) Query: 48 WHSIFYFVSENSKEY 62 W+ +F F+ ENS+EY Sbjct: 41 WYPLFSFLDENSEEY 55 >gi|254781095|ref|YP_003065508.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 318 Score = 21.9 bits (45), Expect = 2.2, Method: Composition-based stats. Identities = 11/39 (28%), Positives = 18/39 (46%) Query: 14 LSRYVKSGVFNLDSLLVDFSVSLKEHFFDTYSIPWHSIF 52 L V+ VFN +L+++ + FFD + IF Sbjct: 280 LGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVDATKIF 318 >gi|254780956|ref|YP_003065369.1| thymidylate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 264 Score = 20.0 bits (40), Expect = 7.9, Method: Compositional matrix adjust. Identities = 7/18 (38%), Positives = 10/18 (55%) Query: 47 PWHSIFYFVSENSKEYCK 64 P H +F F +N K C+ Sbjct: 145 PCHCLFQFYVDNGKLSCQ 162 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.325 0.139 0.442 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,931 Number of Sequences: 1233 Number of extensions: 1614 Number of successful extensions: 5 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 65 length of database: 328,796 effective HSP length: 36 effective length of query: 29 effective length of database: 284,408 effective search space: 8247832 effective search space used: 8247832 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 31 (16.5 bits)