HHsearch results for GI: 254781037 and protein with PDBid: 2pyy_A

>2pyy_A Ionotropic glutamate receptor bacterial homologue; GLUR0 ligand binding domain, transport protein; HET: GLU; 2.10A {Nostoc punctiforme pcc 73102}
Probab=90.83  E-value=0.86  Score=24.07  Aligned_cols=148  Identities=18%  Similarity=0.163  Sum_probs=78.3

Q ss_pred             CCCEEEEECCCH---------HHHHHHHHHHHHHHHHCCCCCCEEEEEEEEEECCCCCCCCHHHCCCHHHHHHHHHHHHH
Q ss_conf             882899707988---------88999999999999740899833899999732741158755674862269999999987
Q gi|254781037|r    3 KKPFRIGTRCSP---------LALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEEIEKKLI   73 (307)
Q Consensus         3 ~~~i~IgtR~S~---------LAl~Qa~~v~~~L~~~~~~p~~~~ei~~i~T~GD~~~~~~l~~~g~kg~Ftkele~aLl   73 (307)
                      +++|+|||+..|         +.=.-.+.+....++.    +++++++.+.+                   -.++-++|.
T Consensus         2 ~~~l~v~~~~~PPf~~~~~g~~~G~~~di~~~i~~~l----g~~~~~v~~~~-------------------~~~~~~~l~   58 (228)
T 2pyy_A            2 QQPLLVATRVIPPFVLSNKGELSGFSIDLWRSIATQI----GIESKLIEYSS-------------------VPELISAIK   58 (228)
T ss_dssp             --CEEEEECCBTTTBBCC---CBSHHHHHHHHHHHHH----TCCEEEEECSS-------------------HHHHHHHHH
T ss_pred             CCCEEEEECCCCCEEECCCCEEEEEHHHHHHHHHHHH----CCCEEEEECCC-------------------HHHHHHHHH
T ss_conf             9648999677198187449968885999999999996----99739996799-------------------999999998


Q ss_pred             CCCCEEEEECCCCCCCCCCCCCEEEEECCCCCCCEEEEECC-------CCCCCCCCCCCEEECCCCCHHHHHHHHHCCCC
Q ss_conf             09836997403432111012210122236568310566524-------32433245673220475302888998423773
Q gi|254781037|r   74 SGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHT-------AQSLKDLALHSVIGTSSLRRKALLLRWRSDIS  146 (307)
Q Consensus        74 ~g~iDiAVHSlKDlP~~~~~~l~i~a~~~R~d~rD~lv~~~-------~~~l~~lp~~a~IGTsS~RR~aql~~~~p~l~  146 (307)
                      +|++|+++=++=.-|. ....+.... +.-.++ -+++.+.       ..++++|....+.+.....-...++.  +..+
T Consensus        59 ~g~~Di~~~~~~~t~~-r~~~~~~s~-p~~~~~-~~~i~~~~~~~~~~~~~~~~l~~~~i~~~~g~~~~~~l~~--~~~~  133 (228)
T 2pyy_A           59 DNKVNLGIAAISITAE-REQNFDFSL-PIFASG-LQIMVRNLESGTGDIRSIDDLPGKVVATTAGSTAATYLRE--HHIS  133 (228)
T ss_dssp             TTSCSEECSSCBCCHH-HHHHSEECS-CSEEEE-EEEEEEC-----CCCCSGGGCTTCEEEEETTSHHHHHHHH--TTCE
T ss_pred             CCCCCEEEECCCCCHH-HHHHCCCCC-CCCCCC-CEEEEECCCCCCCCCCCHHHCCCCEEEECCCCHHHHHHHH--HHCC
T ss_conf             5997667102557988-985344678-721256-1367631445653458878829988984389689999987--5202


Q ss_pred             CHHHCCCHHHHHHHHHCCCCCEEEEEHHHHHHC
Q ss_conf             103307679999986378765563014545421
Q gi|254781037|r  147 VIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL  179 (307)
Q Consensus       147 ~~~iRGNv~TRl~Kl~~g~~DaiilA~Agl~RL  179 (307)
                      +.. .-+.+.-++.|..|++|+.+.....+..+
T Consensus       134 ~~~-~~~~~~~~~~l~~gr~d~~i~~~~~~~~~  165 (228)
T 2pyy_A          134 VLE-VPKIEEAYKALQTKKADAVVFDAPVLLFY  165 (228)
T ss_dssp             EEE-ESSHHHHHHHHHTTSSSEEEEEHHHHHHH
T ss_pred             CHH-HHHHHHHHHHHHCCCEEEEEECHHHHHHH
T ss_conf             111-32488888786459467999631888999