HHsearch results for GI: 254781037 and protein with PDBid: 2vha_A

>2vha_A Periplasmic binding transport protein; periplasmic binding protein, ligand binding, ultrahigh resolution; HET: GLU; 1.00A {Shigella flexneri} PDB: 2ia4_A*
Probab=93.72  E-value=0.38  Score=26.38  Aligned_cols=192  Identities=14%  Similarity=0.160  Sum_probs=98.8

Q ss_pred             CCCEEEEECCC--HHHHH------------HHHHHHHHHHHHCCCCCCEEEEEEEEEECCCCCCCCHHHCCCHHHHHHHH
Q ss_conf             88289970798--88899------------99999999997408998338999997327411587556748622699999
Q gi|254781037|r    3 KKPFRIGTRCS--PLALA------------HAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEEI   68 (307)
Q Consensus         3 ~~~i~IgtR~S--~LAl~------------Qa~~v~~~L~~~~~~p~~~~ei~~i~T~GD~~~~~~l~~~g~kg~Ftkel   68 (307)
                      +++|+||+..+  |.+..            -.+.+++.|....+.++++++++++..  +             .     .
T Consensus        16 ~g~l~Vg~~~~~~P~~~~d~~G~~~G~~vDl~~~ia~~l~~~l~~~~~~v~~~~~~~--~-------------~-----~   75 (287)
T 2vha_A           16 NGVIVVGHRESSVPFSYYDNQQKVVGYSQDYSNAIVEAVKKKLNKPDLQVKLIPITS--Q-------------N-----R   75 (287)
T ss_dssp             HTEEEEEECSEETTTEEECSSSCEESHHHHHHHHHHHHHHHHTTCTTCEEEEEECCT--T-------------T-----H
T ss_pred             CCEEEEEECCCCCCCEEECCCCCEEEEHHHHHHHHHHHHHHHHCCCCEEEEEEECCH--H-------------H-----H
T ss_conf             998999986898893689999988886699999999997477377870699998799--9-------------9-----9


Q ss_pred             HHHHHCCCCEEEEECCCCCCCCCCCCCEEEEECCCCCCCEEEEECCC---CCCCCCCCCCEEECCCCC-HHHHH----HH
Q ss_conf             99987098369974034321110122101222365683105665243---243324567322047530-28889----98
Q gi|254781037|r   69 EKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTA---QSLKDLALHSVIGTSSLR-RKALL----LR  140 (307)
Q Consensus        69 e~aLl~g~iDiAVHSlKDlP~~~~~~l~i~a~~~R~d~rD~lv~~~~---~~l~~lp~~a~IGTsS~R-R~aql----~~  140 (307)
                      ..+|.+|++|++.-++-.-|. ..+.+...... ... .-+++.+++   .++.+|. |.+||.-.-- ...++    ..
T Consensus        76 ~~~L~~G~~Di~~~~~~~t~~-R~~~~~fs~p~-~~~-~~~l~~~k~~~i~~~~dL~-g~~v~v~~gs~~~~~l~~~~~~  151 (287)
T 2vha_A           76 IPLLQNGTFDFECGSTTNNVE-RQKQAAFSDTI-FVV-GTRLLTKKGGDIKDFADLK-GKAVVVTSGTTSEVLLNKLNEE  151 (287)
T ss_dssp             HHHHHTTSCSEECSSCBCCHH-HHTTCEEEEEE-EEE-EEEEEEETTSSCCSGGGGT-TCEEEEETTSHHHHHHHHHHHH
T ss_pred             HHHHHCCCCCEEECCCCCCHH-HHHHCCCCCCC-CCC-CCEEEEECCCCCCCHHHCC-CCCEEECCCCHHHHHHHHHHHH
T ss_conf             999986996434113446645-65432455430-004-7257775489878987808-9812213786699999998887


Q ss_pred             HHCCCCCHHHCCCHHHHHHHHHCCCCCEEEEEHHHHHHCCCCCCCCCCCCHHHCCCCCCCCEEEEEEECCCCHHHHHHHH
Q ss_conf             42377310330767999998637876556301454542162112223368667358543207899985276124556776
Q gi|254781037|r  141 WRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKV  220 (307)
Q Consensus       141 ~~p~l~~~~iRGNv~TRl~Kl~~g~~DaiilA~Agl~RL~l~~~i~~~l~~~~~~PA~gQGaIaIe~r~~d~~i~~il~~  220 (307)
                      ..++.+++... +...-+..|.+|++|+.++....+...-........+  ....+.-..-.+++..+++|+.+   +..
T Consensus       152 ~~~~~~iv~~~-~~~~~~~~l~~grvD~~i~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~av~k~~~~L---~~~  225 (287)
T 2vha_A          152 QKMNMRIISAK-DHGDSFRTLESGRAVAFMMDDALLAGERAKAKKPDNW--DIVGKPQSQEAYGCMLRKDDPQF---KKL  225 (287)
T ss_dssp             TTCCCEEEEES-SHHHHHHHHHTTSCSEEEEEHHHHHHHHTTSSSGGGE--EEESCCSCEEEEEEEECTTCHHH---HHH
T ss_pred             HCCCCCEEECC-HHHHHHHHHHCCCCEEEEEEHHHHHHHHHHCCCCCCE--EEECCCCCCCEEEEEEECCCHHH---HHH
T ss_conf             37896346522-1789999998699409996149999999965788867--99378777631899994899999---999


Q ss_pred             HCCH
Q ss_conf             2397
Q gi|254781037|r  221 INHE  224 (307)
Q Consensus       221 Ind~  224 (307)
                      ||..
T Consensus       226 in~~  229 (287)
T 2vha_A          226 MDDT  229 (287)
T ss_dssp             HHHH
T ss_pred             HHHH
T ss_conf             9999