HHsearch results for GI: 254781037 and protein with PDBid: 3gxa_A

>3gxa_A Outer membrane lipoprotein GNA1946; periplasmic, L-methionine bingding, protein binding; 2.25A {Neisseria meningitidis}
Probab=98.00  E-value=0.00071  Score=44.03  Aligned_cols=207  Identities=12%  Similarity=0.045  Sum_probs=114.7

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEEEECCCCCCCCHHHCCCHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             88289970798888999999999999740899833899999732741158755674862269999999987098369974
Q gi|254781037|r    3 KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEEIEKKLISGEIDCAVH   82 (307)
Q Consensus         3 ~~~i~IgtR~S~LAl~Qa~~v~~~L~~~~~~p~~~~ei~~i~T~GD~~~~~~l~~~g~kg~Ftkele~aLl~g~iDiAVH   82 (307)
                      .++|+||+-.++-+-.-.+.|...+++.    ++++|++.+..-                   ..+.+||.+|++|+...
T Consensus        22 ~~~i~ig~~~~~~~~~~~~~v~~~~k~~----Gi~Ve~v~f~d~-------------------~~~n~AL~~G~iD~n~~   78 (275)
T 3gxa_A           22 KKEIVFGTTVGDFGDMVKEQIQPELEKK----GYTVKLVEFTDY-------------------VRPNLALAEGELDINVF   78 (275)
T ss_dssp             -CEEEEEEETTHHHHHHHHTHHHHHHTT----TCEEEEEEESSS-------------------SHHHHHHHHTSCSEEEE
T ss_pred             CCEEEEEEECCCHHHHHHHHHHHHHHHC----CCEEEEEEECCC-------------------HHHHHHHHCCCCCEECC
T ss_conf             8528999606987999999989999965----987999995783-------------------35789986699554314


Q ss_pred             CCCCCCCC--CCCCCEEEEECCCCCCCEEEEECCCCCCCCCCCCCEEECCCCC----HHHHHHHHHC-------------
Q ss_conf             03432111--0122101222365683105665243243324567322047530----2888998423-------------
Q gi|254781037|r   83 SAKDMPTK--LLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVIGTSSLR----RKALLLRWRS-------------  143 (307)
Q Consensus        83 SlKDlP~~--~~~~l~i~a~~~R~d~rD~lv~~~~~~l~~lp~~a~IGTsS~R----R~aql~~~~p-------------  143 (307)
                      .-.-.-..  -..+..+..+-+-....-.+.+++.+++.+||.|++|+.+.--    |...++...-             
T Consensus        79 q~~p~l~~~~~~~g~~l~~v~~~~~~~~glys~k~ksl~dl~~G~kIaip~d~sn~~raL~~L~~~Gli~l~~~~~~~~~  158 (275)
T 3gxa_A           79 QHKPYLDDFKKEHNLDITEVFQVPTAPLGLYPGKLKSLEEVKDGSTVSAPNDPSNFARVLVMLDELGWIKLKDGINPLTA  158 (275)
T ss_dssp             ECHHHHHHHHHHHTCCEEEEEECCBCCCEEEESSCCCGGGCCTTCEEEEECSHHHHHHHHHHHHHTTSSEECTTCCGGGC
T ss_pred             CCHHHHHHHHHHCCCCEEEEEEEECCCEEEEECCCCCHHHCCCCCEEEEECCCCHHHHHHHHHHHCCCEECCCCCCCCCC
T ss_conf             45788999999779967998563115506663265654135899989982486368899999986695311688775545


Q ss_pred             ----------CCCCHHHCCCHHHHHHHHHCCCCCEEEEEHHHHHHCCCCCCCCCCCCHHHCCCCCCCCEEEEEEECCC--
Q ss_conf             ----------77310330767999998637876556301454542162112223368667358543207899985276--
Q gi|254781037|r  144 ----------DISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKEILNIEDFPPSPGQGAICIETHVNN--  211 (307)
Q Consensus       144 ----------~l~~~~iRGNv~TRl~Kl~~g~~DaiilA~Agl~RL~l~~~i~~~l~~~~~~PA~gQGaIaIe~r~~d--  211 (307)
                                +++++++-...-.|  -|  +++|+.|....-...-++.....-+.++      .-+=+..|.+|.+|  
T Consensus       159 t~~di~~n~~~l~~~~~~~~~l~~--~l--~dvD~avi~~~~~~~agl~~~~~l~~e~------~~~y~nvivvr~~~~d  228 (275)
T 3gxa_A          159 SKADIAENLKNIKIVELEAAQLPR--SR--ADVDFAVVNGNYAISSGMKLTEALFQEP------SFAYVNWSAVKTADKD  228 (275)
T ss_dssp             CGGGEEECTTCCEEEEECGGGHHH--HT--TTSSEEEECHHHHHHTTCCGGGCSEECC------CCTTCCEEEEEGGGTT
T ss_pred             CCCHHHHCCCCCEEEECCHHHHHH--HC--CCCCEEEECCCHHHHCCCCHHHCCCCCC------CCCEEEEEEEECCCCC
T ss_conf             400043276564599856666313--12--6755899646468775998234000277------8763699998076779


Q ss_pred             -CHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCCCCEE
Q ss_conf             -12455677623978888878899999871776488528
Q gi|254781037|r  212 -PKAQELVKVINHEDTWDSVNCERAFLAELDGSCKSAIA  249 (307)
Q Consensus       212 -~~i~~il~~Ind~~T~~~v~aER~fL~~L~GgC~~PIG  249 (307)
                       +.+..+++..+++++..       |+...=.|+-.|-+
T Consensus       229 ~~~ik~l~ea~~s~ev~~-------~i~~~y~G~~~pa~  260 (275)
T 3gxa_A          229 SQWLKDVTEAYNSDAFKA-------YAHKRFEGYKSPAA  260 (275)
T ss_dssp             CHHHHHHHHHTTSHHHHH-------HHHHHSTTCBCCTT
T ss_pred             CHHHHHHHHHHCCHHHHH-------HHHHHCCCEEECCE
T ss_conf             599999999976999999-------99987799188254