HHSEARCH alignment of GI: 254781037 and SCOP domain: d1pdaa2

Alignment
>d1pdaa2 d.50.2.1 (A:220-307) Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain {Escherichia coli [TaxId: 562]}
Probab=99.89  E-value=3.2e-23  Score=167.73  Aligned_cols=85  Identities=27%  Similarity=0.406  Sum_probs=83.7

Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEECCEEEEEEEEECCCCCEEEEEEEECCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             39788888788999998717764885289999999989999999869987899999843988899999999999997060
Q gi|254781037|r  222 NHEDTWDSVNCERAFLAELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN  301 (307)
Q Consensus       222 nd~~T~~~v~aER~fL~~L~GgC~~PIGa~A~i~~~~l~l~a~v~s~DG~~~i~~~~~g~~~~a~~LG~~la~~Ll~~g~  301 (307)
                      ||++|+.|+.+||+||+.|+|||++||||||++++++++|+++|+|+||++.++.+.+++++++.++|+++|++|+++||
T Consensus         1 Nd~~T~~~v~aER~fL~~L~ggC~~PIga~A~~~~~~i~l~~~v~s~dG~~~~~~~~~g~~~~~~~lg~~la~~L~~~Ga   80 (88)
T d1pdaa2           1 NHHETALRVTAERAMNTRLEGACQVPIGSYAELIDGEIWLRGLVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNGA   80 (88)
T ss_dssp             CCHHHHHHHHHHHHHHHHTTCCTTSCEEEEEEEETTEEEEEEEEECTTSSCEEEEEEEECGGGHHHHHHHHHHHHHHTTH
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCEEEEEEEEECCCCCEEEEEEEEECHHHHHHHHHHHHHHHHHHCH
T ss_conf             98889999999999999838999886111359988879999999999898899999997788999999999999999089


Q ss_pred             HHHCC
Q ss_conf             56337
Q gi|254781037|r  302 KNVFN  306 (307)
Q Consensus       302 k~iLn  306 (307)
                      ++||+
T Consensus        81 ~~il~   85 (88)
T d1pdaa2          81 REILA   85 (88)
T ss_dssp             HHHHH
T ss_pred             HHHHH
T ss_conf             99999


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: dsRBD-like
superfamily: Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain
family: Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain
domain: Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain
species: Escherichia coli [TaxId: 562]