BLAST/PSIBLAST alignment of GI: 254781037 and GI: 190893753 at iteration 1
>gi|190893753|ref|YP_001980295.1| porphobilinogen deaminase [Rhizobium etli CIAT 652] Length = 309
>gi|190699032|gb|ACE93117.1| porphobilinogen deaminase protein [Rhizobium etli CIAT 652] Length = 309
 Score =  344 bits (883), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 166/306 (54%), Positives = 217/306 (70%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KPFRIGTR SPLALA A E R  LM  H +P     I+ LSTKGDRIT+R+L EIGG
Sbjct: 1   MQTKPFRIGTRGSPLALAQAHEARDRLMAAHHLPEEMFEIVVLSTKGDRITDRSLAEIGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFTEE+E+KL+SGE+D AVHSAKDMPT L  GL +SAYLPREDIRD  I  TA  L D
Sbjct: 61  KGLFTEELEQKLVSGELDFAVHSAKDMPTHLPDGLHLSAYLPREDIRDAVIGRTAPKLID 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +G+SSLRR+AL+ R R DI+VI FRG +ETRL KL   +  A LLA AG+KRL 
Sbjct: 121 LPHGATVGSSSLRRQALIRRMRPDINVIIFRGSVETRLRKLEEGQVDATLLALAGLKRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           K +V+ +IL+ + FPP+P QGAICIE+ + + +  +L+  +N   T+D+V+CERAFLA L
Sbjct: 181 KVEVLTDILDPDTFPPAPAQGAICIESRIGDSRIDDLLAAVNDAATFDTVSCERAFLAAL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ I G+A C+G  + F G+++  DG+  H V+ +G+R DA  +G  A Q +R  +
Sbjct: 241 DGSCRTPIGGYAVCEGDLIRFSGLIITPDGRSQHAVTTDGHRRDAAALGTRAGQDVRARA 300

Query: 301 NKNVFN 306
               F+
Sbjct: 301 GSAFFD 306