PSIBLAST alignment of GI: 254781037 and protein with PDB id: 1ypn

>gi|157834325|pdb|1YPN|A Chain A, Reduced Form Hydroxymethylbilane Synthase (K59q Mutant) Crystal Structure After 2 Hours In A Flow Cell Determined By Time-Resolved Laue Diffraction Length = 313
 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           +GLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 59  QGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 179 LESRIRAALPPEISLPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303