BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781037|ref|YP_003065450.1| porphobilinogen deaminase
[Candidatus Liberibacter asiaticus str. psy62]
         (307 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|90414241|ref|ZP_01222221.1| porphobilinogen deaminase [Photobacterium profundum 3TCK]
 gi|90324688|gb|EAS41229.1| porphobilinogen deaminase [Photobacterium profundum 3TCK]
          Length = 341

 Score =  296 bits (757), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 108/306 (35%), Positives = 167/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  KP RI TR SPLA+  A   ++ L   H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 32  MTDKPIRIATRKSPLAMWQAEFVQAELEKAH--PGLVVELVPMVTKGDIILDTPLAKVGG 89

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL +     RED RD F+S+T  S+ +
Sbjct: 90  KGLFVKELEVAMLEGRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNTYNSIAE 149

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ + D RG + TRL KL+  +  AI+LA AG+ RL+
Sbjct: 150 LPAGSIVGTSSLRRQCQLRAQRPDLIINDLRGNVNTRLRKLDEGQYDAIILACAGLMRLE 209

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I+  +  E+  P+ GQGA+ IE  +++ + + L+  +NH +T   + CERA    L
Sbjct: 210 MHDRIRSAIEPEESLPAVGQGAVGIECRLDDHRVRALLATLNHPETATRIFCERAMNNHL 269

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  ++  +G  ++   +V   DG         G   D   +G   A+ +    
Sbjct: 270 QGGCQVPIGSYSELQGDQIWLRALVGEPDGSKMVRGEITGAAIDGEALGTQLAEQLLADG 329

Query: 301 NKNVFN 306
            K + +
Sbjct: 330 AKEILD 335


>gi|209693832|ref|YP_002261760.1| porphobilinogen deaminase [Aliivibrio salmonicida LFI1238]
 gi|226706282|sp|B6EPK1|HEM3_ALISL RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|208007783|emb|CAQ77905.1| porphobilinogen deaminase HemC [Aliivibrio salmonicida LFI1238]
          Length = 311

 Score =  296 bits (757), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 110/307 (35%), Positives = 168/307 (54%), Gaps = 3/307 (0%)

Query: 1   MEKK-PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M ++ P RI TR SPLAL  A   + +L   H  P   + ++ + TKGD I +  L +IG
Sbjct: 1   MSQQLPVRIATRKSPLALWQAHFVKDALQAAH--PGLEVELVTMVTKGDIILDTPLAKIG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  ++ G  D AVHS KD+P +  +GL +     R D RD F+S+T  ++ 
Sbjct: 59  GKGLFVKELEVAMLEGRADLAVHSMKDVPVEFPEGLGLVTICERGDPRDAFVSNTYNNID 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           +L   + +GT SLRR+  L  +R D+ + + RG + TRL KL++    AI+LA AG+ RL
Sbjct: 119 ELPQGATVGTCSLRRQCQLKEYRPDLIIKELRGNVGTRLQKLDDGNYDAIILACAGLIRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
             E  IK  +  E   P+ GQGA+ IET +N+ + + L+  +NH +T   V CERA    
Sbjct: 179 GLEDRIKSSIEPEQSLPAVGQGAVGIETRLNDDRIRALLAPLNHPETAHRVLCERAMNNR 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I  ++   G  ++   +V   DG I       G   DA  +G   A+ +   
Sbjct: 239 LEGGCQVPIGSYSLIDGDQIWLRALVGEPDGSIMVRGETTGPVSDAEELGTKLAEQLLND 298

Query: 300 SNKNVFN 306
             K++ +
Sbjct: 299 GAKDILD 305


>gi|90581042|ref|ZP_01236842.1| porphobilinogen deaminase [Vibrio angustum S14]
 gi|90437738|gb|EAS62929.1| porphobilinogen deaminase [Vibrio angustum S14]
          Length = 310

 Score =  295 bits (755), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 106/306 (34%), Positives = 168/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +P RI TR SPLA+  A   ++ L   H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 1   MSNQPIRIATRKSPLAMWQAEFVKAELEQAH--PGIIVELVPMITKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL +     RED RD F+S+   ++ +
Sbjct: 59  KGLFVKELEVAMLEGRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNKYNNIDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  L   R D+ V D RG + TRL K++  +  AI+LA AG+KRLK
Sbjct: 119 LPQGAIVGTSSLRRQCQLRAQRPDLIVNDLRGNVNTRLRKMDEGQYDAIILACAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  +++ + ++L+  ++ + T   V CERA    L
Sbjct: 179 MEDRIRSEIAPEVSLPAVGQGAVGIECRLDDTRVRQLLAALSDQATTTRVLCERAMNNYL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G  ++   +V   DG         G    A  +G   A+ +    
Sbjct: 239 QGGCQVPIGSYAELEGDQIWLRALVGEPDGSKIVRAEIRGPIEQAEQLGETLAEQLLNDG 298

Query: 301 NKNVFN 306
            +++ +
Sbjct: 299 ARDILD 304


>gi|330444901|ref|ZP_08308556.1| porphobilinogen deaminase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489211|dbj|GAA03053.1| porphobilinogen deaminase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 310

 Score =  295 bits (754), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 108/306 (35%), Positives = 169/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +P RI TR SPLA+  A   ++ L   H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 1   MTSQPIRIATRKSPLAMWQAEFVKAELEQAH--PGIVVELVPMVTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL +     RED RD F+S+   ++ +
Sbjct: 59  KGLFVKELEVAMLEGRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNKYNNIDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  +   R D+ V D RG + TRL KL++ +  AI+LA AG+KRLK
Sbjct: 119 LPQGAIVGTSSLRRQCQIRAQRPDLIVNDLRGNVNTRLRKLDDGEYDAIILACAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I+  +  E   P+ GQGA+ IE  +++ + ++L+  +NH+ T   V CERA    L
Sbjct: 179 MDDRIRSEIAPETSLPAVGQGAVGIECRLDDTRVRQLLDALNHQPTATRVLCERAMNNRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G  ++   +V   DG         G    A  +G   A  +    
Sbjct: 239 QGGCQVPIGSYALLEGDEIWLRALVGEPDGSKIVRAEIRGPIAQAEQLGTTLADQLLADG 298

Query: 301 NKNVFN 306
            K++ +
Sbjct: 299 AKDILD 304


>gi|157368427|ref|YP_001476416.1| porphobilinogen deaminase [Serratia proteamaculans 568]
 gi|167008819|sp|A8G848|HEM3_SERP5 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|157320191|gb|ABV39288.1| porphobilinogen deaminase [Serratia proteamaculans 568]
          Length = 313

 Score =  294 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 117/305 (38%), Positives = 166/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  LM  H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQQRLMANH--PGLQVELVPMVTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P     GL +     R+D RD F+S+   SL  
Sbjct: 59  KGLFVKELELALLDGRADIAVHSMKDVPVDFPAGLGLVTICERDDPRDAFVSNRFTSLDQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+ V D RG + TRL+KL+N    AI+LA AG+KRL 
Sbjct: 119 LPQGSVVGTSSLRRQCQLRERRPDLIVRDLRGNVGTRLSKLDNGDYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I+  L+ E+  P+ GQGA+ IE  +++   + L+  +NH  T   V  ERA    L
Sbjct: 179 LEQRIRSPLSPEECLPAVGQGAVGIECRLDDETTRALLAPLNHAVTETRVRAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A   G +L+   +V + DG       R G    A  +G + A+ +    
Sbjct: 239 EGGCQVPIGSYAELDGDSLWLRALVGSPDGSQMVRGERRGPAALAEQMGIELAEELLAQG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|261210172|ref|ZP_05924469.1| porphobilinogen deaminase [Vibrio sp. RC341]
 gi|260840712|gb|EEX67261.1| porphobilinogen deaminase [Vibrio sp. RC341]
          Length = 311

 Score =  294 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 113/306 (36%), Positives = 169/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 1   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T   + D
Sbjct: 59  KGLFVKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYAKIDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL 
Sbjct: 119 LPSGAVVGTCSLRRQCQLKSARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  +++ + +EL+  +NH DT D V CERA    L
Sbjct: 179 LESRIRNFIEPEQSLPAVGQGAVGIECRLDDQRVRELLAPLNHTDTADRVRCERAMNLTL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G  ++   +V   DG         G R +A  +G   A+ +    
Sbjct: 239 QGGCQVPIGSYALLEGDHIWLRALVGEPDGSQIVRGEIRGPRSEAEQLGITLAEQLLEQG 298

Query: 301 NKNVFN 306
            K + +
Sbjct: 299 AKEILD 304


>gi|270264251|ref|ZP_06192518.1| porphobilinogen deaminase [Serratia odorifera 4Rx13]
 gi|270041900|gb|EFA14997.1| porphobilinogen deaminase [Serratia odorifera 4Rx13]
          Length = 313

 Score =  294 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 116/305 (38%), Positives = 166/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  LM  H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQQRLMASH--PGLQVELVPMVTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P     GL +     R+D RD F+S+   S   
Sbjct: 59  KGLFVKELELALLEGRADIAVHSMKDVPIDFPAGLGLVTICERDDPRDAFVSNRFASFDQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR++ L   R D+ V D RG + TRL KL+N    AI+LA AG+KRL 
Sbjct: 119 LPQGSVVGTSSLRRQSQLRERRPDLIVRDLRGNVGTRLAKLDNGDYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I+  L+ E+  P+ GQGA+ IE  +++   + L+  +NH  T   V  ERA    L
Sbjct: 179 LEQRIRSPLSPEECLPAVGQGAVGIECRLDDDATRALLAPLNHAATDIRVRAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +G +L+   +V + DG       R G    A  +G + A+ +    
Sbjct: 239 EGGCQVPIGSYAELEGDSLWLRALVGSPDGSQMVRGERRGPAALAEQMGVELAEELLARG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|330827978|ref|YP_004390930.1| Porphobilinogen deaminase [Aeromonas veronii B565]
 gi|328803114|gb|AEB48313.1| Porphobilinogen deaminase [Aeromonas veronii B565]
          Length = 330

 Score =  293 bits (749), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 106/305 (34%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  +I TR SPLAL  A   +  L  +H  P   + ++P+ST+GD+I +  L ++GG
Sbjct: 22  MAARTLKIATRKSPLALWQANFVKDRLEALH--PQLQVELVPMSTQGDKILDTPLAKVGG 79

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL +     RED RD F+S+  +++ +
Sbjct: 80  KGLFVKELETAMLEGRADIAVHSMKDVPVEFPEGLGLHTICEREDPRDAFVSNRFKAIAE 139

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L   R D+ + D RG + TRL KL+  +  AI+LA AG+KRL+
Sbjct: 140 LPQGAVVGTSSLRRQCQLRAARPDLVIRDLRGNVNTRLAKLDAGEYDAIILAAAGLKRLE 199

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I   +  E   P+ GQGA+ IE  +++ +   L+  + H +T   V  ERA    L
Sbjct: 200 MAHRITAFIEPEQSLPANGQGAVGIECRLDDVELHALLAPLEHTETRARVLTERAMNRAL 259

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G  ++  G+V + DG         G   D   +G   AQ +    
Sbjct: 260 QGGCQVPIGAYALVEGEQIWLRGLVGSPDGTQVIRDEIRGPLADGEALGEQLAQRLLAAG 319

Query: 301 NKNVF 305
              + 
Sbjct: 320 ADEIL 324


>gi|162139476|ref|YP_855002.2| porphobilinogen deaminase [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
          Length = 315

 Score =  293 bits (749), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 105/305 (34%), Positives = 162/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  +I TR SPLAL  A   +  L  ++  P   + ++P+ST+GD+I +  L ++GG
Sbjct: 7   MAARTLKIATRKSPLALWQANFVKDRLEALY--PELQVELVPMSTQGDKILDTPLAKVGG 64

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL +     RED RD F+S+    + +
Sbjct: 65  KGLFVKELETAMLEGRADIAVHSMKDVPVEFPEGLGLHTICEREDPRDAFVSNRFGQIDE 124

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L   R D+ + D RG + TRL KL+  +  AI+LA AG+KRL+
Sbjct: 125 LPQGAVVGTSSLRRQCQLRAARPDLVIRDLRGNVNTRLAKLDAGEYDAIILAAAGLKRLE 184

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I   +  E   P+ GQGA+ IE  +++ +   L+  + H +T   V  ERA    L
Sbjct: 185 MAHRITAFIEPEQSLPANGQGAVGIECRLDDHELHALLAPLEHPETRIRVLTERAMNRAL 244

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G  ++  G+V + DG         G   D   +G   AQ +    
Sbjct: 245 QGGCQVPIGAYALVQGEEVWLRGLVGSPDGSRVIRDEIRGPLADGEALGHTLAQRLLADG 304

Query: 301 NKNVF 305
              + 
Sbjct: 305 ADVIL 309


>gi|262172879|ref|ZP_06040557.1| porphobilinogen deaminase [Vibrio mimicus MB-451]
 gi|261893955|gb|EEY39941.1| porphobilinogen deaminase [Vibrio mimicus MB-451]
          Length = 311

 Score =  293 bits (749), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 114/306 (37%), Positives = 167/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 1   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLKVELVTMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P    KGL +     RED RD F+S+T   + D
Sbjct: 59  KGLFVKELEVAMLEGRADLAVHSMKDVPVDFPKGLGLVTICEREDPRDAFVSNTYAKIDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL 
Sbjct: 119 LPSGAVVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  +++ + +EL+  +NH DT D V CERA    L
Sbjct: 179 LESRIRNFIEPEQSLPAVGQGAVGIECRLDDQRVRELLAPLNHTDTADRVRCERAMNLTL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A   G  ++   +V   DG         G R +A  +G   A+ +    
Sbjct: 239 QGGCQVPIGSYALLDGDEIWLRALVGEPDGSQIVRGEIRGPRSEAEQLGITLAEQLLGQG 298

Query: 301 NKNVFN 306
            K +  
Sbjct: 299 AKEILE 304


>gi|308051395|ref|YP_003914961.1| porphobilinogen deaminase [Ferrimonas balearica DSM 9799]
 gi|307633585|gb|ADN77887.1| porphobilinogen deaminase [Ferrimonas balearica DSM 9799]
          Length = 310

 Score =  293 bits (749), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 116/305 (38%), Positives = 176/305 (57%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +K  RI TR SPLAL  A   ++ L   H  P   + ++ +STKGDRI +  L ++GG
Sbjct: 1   MARKEIRIATRKSPLALWQAEFVKAELEKAH--PGLTVTLLKMSTKGDRILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  +++GE D AVHS KD+P +  +GL ++    RED RD F+S+T ++L D
Sbjct: 59  KGLFVKELEVAMLNGEADIAVHSMKDVPVEFPEGLGLAVICDREDPRDAFVSNTYKNLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++G+SSLRR+  L   R D+ V D RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 119 LPHGAIVGSSSLRRQCQLRAMRPDLDVRDLRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I   +  E   P+ GQGA+ IE  +++ +   L+ V+NH  T   V  ERA    L
Sbjct: 179 LEERITAFIEPEQSLPANGQGAVGIECRLDDAELLALIGVLNHAPTHARVIAERAMNTHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  ++  +G TL+  G+V   DG    +    G   DA  +G + A+ +    
Sbjct: 239 EGGCQVPIGAYSVIEGDTLWLRGLVGDPDGSKIIQDELRGPVADAQKLGIELAERLLAQG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 AGEIL 303


>gi|117559297|gb|ABK36245.1| porphobilinogen deaminase [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
          Length = 330

 Score =  293 bits (749), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 105/305 (34%), Positives = 162/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  +I TR SPLAL  A   +  L  ++  P   + ++P+ST+GD+I +  L ++GG
Sbjct: 22  MAARTLKIATRKSPLALWQANFVKDRLEALY--PELQVELVPMSTQGDKILDTPLAKVGG 79

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL +     RED RD F+S+    + +
Sbjct: 80  KGLFVKELETAMLEGRADIAVHSMKDVPVEFPEGLGLHTICEREDPRDAFVSNRFGQIDE 139

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L   R D+ + D RG + TRL KL+  +  AI+LA AG+KRL+
Sbjct: 140 LPQGAVVGTSSLRRQCQLRAARPDLVIRDLRGNVNTRLAKLDAGEYDAIILAAAGLKRLE 199

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I   +  E   P+ GQGA+ IE  +++ +   L+  + H +T   V  ERA    L
Sbjct: 200 MAHRITAFIEPEQSLPANGQGAVGIECRLDDHELHALLAPLEHPETRIRVLTERAMNRAL 259

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G  ++  G+V + DG         G   D   +G   AQ +    
Sbjct: 260 QGGCQVPIGAYALVQGEEVWLRGLVGSPDGSRVIRDEIRGPLADGEALGHTLAQRLLADG 319

Query: 301 NKNVF 305
              + 
Sbjct: 320 ADVIL 324


>gi|294142612|ref|YP_003558590.1| porphobilinogen deaminase [Shewanella violacea DSS12]
 gi|293329081|dbj|BAJ03812.1| porphobilinogen deaminase [Shewanella violacea DSS12]
          Length = 309

 Score =  292 bits (748), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 116/306 (37%), Positives = 168/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLAL  A   ++ L   H  P   + ++P+STKGD I +  L ++GG
Sbjct: 1   MSQNVIRIATRKSPLALWQAEFVKAELEKFH--PGLTVELLPMSTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+  +S+ D
Sbjct: 59  KGLFVKELEIAMLDGRADIAVHSIKDVPVDFPDGLGLEVICEREDPRDAFVSNDYKSIDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  +   R D+ + D RG + TRL KL+     AI+LA AG+KRLK
Sbjct: 119 LPKGAVVGTSSLRRQCQIRAMRPDLKITDLRGNVGTRLGKLDAGNYDAIILAAAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I   ++ E+  P+ GQGA+ IE   ++ + + L+  + H +T   V  ERA    L
Sbjct: 179 LEERISSFISAEESLPANGQGAVGIECRTDDERVKALLAPLEHTETRYRVTAERAMNTHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  FA  +G TL   G+V   DG      +  G + DA  IG   A+ +    
Sbjct: 239 QGGCQVPIGAFAEIQGDTLTLRGLVGNPDGSKIITGTSVGPKTDAKAIGITLAKELLSKG 298

Query: 301 NKNVFN 306
            K + +
Sbjct: 299 AKEILD 304


>gi|262404857|ref|ZP_06081411.1| porphobilinogen deaminase [Vibrio sp. RC586]
 gi|262348941|gb|EEY98080.1| porphobilinogen deaminase [Vibrio sp. RC586]
          Length = 311

 Score =  292 bits (748), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 113/306 (36%), Positives = 167/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 1   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T   + D
Sbjct: 59  KGLFVKELEVAMLEGRADLAVHSMKDVPVDFPQGLGLVTICEREDPRDAFVSNTYVKIDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL 
Sbjct: 119 LPSGAVVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  +++ + +EL+  +NH DT D V CERA    L
Sbjct: 179 LESRIRNFIEPEQSLPAVGQGAVGIECRLDDQRVRELLAPLNHTDTADRVRCERAMNLTL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A   G  ++   +V   DG         G R +A  +G   A+ +    
Sbjct: 239 QGGCQVPIGSYALLDGDDIWLRALVGEPDGSQIVHGEIRGPRSEAEQLGITLAEQLLEQG 298

Query: 301 NKNVFN 306
            K +  
Sbjct: 299 AKEILE 304


>gi|311281516|ref|YP_003943747.1| porphobilinogen deaminase [Enterobacter cloacae SCF1]
 gi|308750711|gb|ADO50463.1| porphobilinogen deaminase [Enterobacter cloacae SCF1]
          Length = 318

 Score =  292 bits (747), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 166/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 6   MLDKVLRIATRQSPLALWQAHYVKDRLTACH--PGLQVELVPMVTRGDVILDTPLAKVGG 63

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL ++    RED RD F+S+   SL  
Sbjct: 64  KGLFVKELELALLEHRADIAVHSMKDVPVEFPQGLGLTTICEREDPRDAFVSNQYASLDA 123

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N    AI+LA AG+KRL 
Sbjct: 124 LPAGSIVGTSSLRRQCQLAAQRPDLVIRSLRGNVGTRLSKLDNGDYDAIILAVAGLKRLG 183

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I++ L+ E   P+ GQGA+ IE  +++   + L+  +NH +T   V  ERA    L
Sbjct: 184 LESRIRQALSPEQSLPAVGQGAVGIECRLDDDATRALLAPLNHPETAVRVGAERAMNTRL 243

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +G  L+   +V A DG       R G   +A  +G   A+ +    
Sbjct: 244 EGGCQVPIGSYAELQGGELWLRALVGAPDGSRMVRGERRGTPEEAERLGVSLAEELLDNG 303

Query: 301 NKNVF 305
            + + 
Sbjct: 304 AREIL 308


>gi|258626632|ref|ZP_05721462.1| porphobilinogen deaminase [Vibrio mimicus VM603]
 gi|258581136|gb|EEW06055.1| porphobilinogen deaminase [Vibrio mimicus VM603]
          Length = 311

 Score =  292 bits (746), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 113/306 (36%), Positives = 167/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 1   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLKVELVTMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T   + D
Sbjct: 59  KGLFVKELEVAMLEGRADLAVHSMKDVPVDFPQGLGLVTICEREDPRDAFVSNTYAKIDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL 
Sbjct: 119 LPSGAVVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  +++ + +EL+  +NH DT D V CERA    L
Sbjct: 179 LESRIRNFIEPEQSLPAVGQGAVGIECRLDDQRVRELLVPLNHTDTADRVRCERAMNLTL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A   G  ++   +V   DG         G R +A  +G   A+ +    
Sbjct: 239 QGGCQVPIGSYALLDGDEIWLRALVGEPDGSQIVRGEIRGPRSEAEQLGITLAEQLLGQG 298

Query: 301 NKNVFN 306
            K +  
Sbjct: 299 AKEILE 304


>gi|254291929|ref|ZP_04962710.1| porphobilinogen deaminase [Vibrio cholerae AM-19226]
 gi|150422139|gb|EDN14105.1| porphobilinogen deaminase [Vibrio cholerae AM-19226]
          Length = 311

 Score =  292 bits (746), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 114/306 (37%), Positives = 168/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 1   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T   ++D
Sbjct: 59  KGLFVKELEIAMLEGRADLAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNTYAKIED 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 119 LPSGAIVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  VN+ + + L+  +NH DT D V CERA    L
Sbjct: 179 LESRIRSFIEPEQSLPAVGQGAVGIECRVNDQRVRALLAPLNHADTADRVRCERAMNLTL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G T++   +V   DG         G R  A  +G   A+ +    
Sbjct: 239 QGGCQVPIGSYALLEGDTIWLRALVGEPDGSKIVRGEIRGPRTQAEQLGITLAEQLLSQG 298

Query: 301 NKNVFN 306
            K +  
Sbjct: 299 AKEILE 304


>gi|59710673|ref|YP_203449.1| porphobilinogen deaminase [Vibrio fischeri ES114]
 gi|197333951|ref|YP_002154835.1| porphobilinogen deaminase [Vibrio fischeri MJ11]
 gi|75431912|sp|Q5E8T5|HEM3_VIBF1 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|226706298|sp|B5FF97|HEM3_VIBFM RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|59478774|gb|AAW84561.1| hydroxymethylbilane synthase [Vibrio fischeri ES114]
 gi|197315441|gb|ACH64888.1| porphobilinogen deaminase [Vibrio fischeri MJ11]
          Length = 311

 Score =  292 bits (746), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 108/307 (35%), Positives = 168/307 (54%), Gaps = 3/307 (0%)

Query: 1   MEKK-PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M ++ P RI TR SPLAL  A   + +L   H  P   + ++ + TKGD I +  L ++G
Sbjct: 1   MSQQLPVRIATRKSPLALWQAHFVKDALQAAH--PGLEVELVTMVTKGDIILDTPLAKVG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  ++ G  D AVHS KD+P +  +GL +     RED RD F+S+T  ++ 
Sbjct: 59  GKGLFVKELEVAMLEGRADLAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNTYNNID 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           +L   +V+GT SLRR+  L   R D+ + + RG + TRL KL++    AI+LA AG+ RL
Sbjct: 119 ELPQGAVVGTCSLRRQCQLKEARPDLIIKELRGNVGTRLQKLDDGNYDAIILACAGLIRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
             E  IK  +  E   P+ GQGA+ IE  +++ + + L++ +NH +T + V CERA    
Sbjct: 179 GLEDRIKSAIEPEQSLPAVGQGAVGIEARLDDDRLRALLEPLNHPETANRVLCERAMNNR 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I  ++   G  ++   +V   DG +      +G   DA  +G   A  +   
Sbjct: 239 LEGGCQVPIGSYSLIDGDQIWLRALVGEPDGSVMIRGEVSGPVSDAEALGTQLADQLLND 298

Query: 300 SNKNVFN 306
             K +  
Sbjct: 299 GAKEILE 305


>gi|255743926|ref|ZP_05417881.1| porphobilinogen deaminase [Vibrio cholera CIRS 101]
 gi|262151165|ref|ZP_06028304.1| porphobilinogen deaminase [Vibrio cholerae INDRE 91/1]
 gi|262167035|ref|ZP_06034752.1| porphobilinogen deaminase [Vibrio cholerae RC27]
 gi|262189994|ref|ZP_06048299.1| porphobilinogen deaminase [Vibrio cholerae CT 5369-93]
 gi|11386839|sp|Q9KVM1|HEM3_VIBCH RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|255738409|gb|EET93799.1| porphobilinogen deaminase [Vibrio cholera CIRS 101]
 gi|262024553|gb|EEY43237.1| porphobilinogen deaminase [Vibrio cholerae RC27]
 gi|262031059|gb|EEY49684.1| porphobilinogen deaminase [Vibrio cholerae INDRE 91/1]
 gi|262034117|gb|EEY52552.1| porphobilinogen deaminase [Vibrio cholerae CT 5369-93]
          Length = 311

 Score =  291 bits (745), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 114/306 (37%), Positives = 168/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 1   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T   ++D
Sbjct: 59  KGLFVKELEIAMLEGRADLAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNTYAKIED 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 119 LPSGAIVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  VN+ + + L+  +NH DT D V CERA    L
Sbjct: 179 LESRIRSFIEPEQSLPAVGQGAVGIECRVNDQRVRALLAPLNHADTADRVRCERAMNLTL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G T++   +V   DG         G R  A  +G   A+ +    
Sbjct: 239 QGGCQVPIGSYALLEGDTIWLRALVGEPDGSQIVRGEIRGPRTQAEQLGITLAEQLLSQG 298

Query: 301 NKNVFN 306
            K +  
Sbjct: 299 AKEILE 304


>gi|153214841|ref|ZP_01949649.1| porphobilinogen deaminase [Vibrio cholerae 1587]
 gi|153830620|ref|ZP_01983287.1| porphobilinogen deaminase [Vibrio cholerae 623-39]
 gi|124115084|gb|EAY33904.1| porphobilinogen deaminase [Vibrio cholerae 1587]
 gi|148873892|gb|EDL72027.1| porphobilinogen deaminase [Vibrio cholerae 623-39]
          Length = 311

 Score =  291 bits (745), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 114/306 (37%), Positives = 169/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 1   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T   ++D
Sbjct: 59  KGLFVKELEIAMLEGRADLAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNTYAKIED 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 119 LPSGAIVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  VN+ + + L+  +NH DT D V CERA    L
Sbjct: 179 LESRIRSFIEPEQSLPAVGQGAVGIECRVNDQRVRALLAPLNHADTADRVRCERAMNLTL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G+T++   +V   DG         G R  A  +G   A+ +    
Sbjct: 239 QGGCQVPIGSYALLEGNTIWLRALVGEPDGSQIVRGEIRGPRTQAEQLGITLAEQLLSQG 298

Query: 301 NKNVFN 306
            K +  
Sbjct: 299 AKEILE 304


>gi|188532369|ref|YP_001906166.1| Porphobilinogen deaminase [Erwinia tasmaniensis Et1/99]
 gi|238058922|sp|B2VG55|HEM3_ERWT9 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|188027411|emb|CAO95258.1| Porphobilinogen deaminase [Erwinia tasmaniensis Et1/99]
          Length = 313

 Score =  291 bits (745), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 111/305 (36%), Positives = 169/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L+  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MSDKILRIATRRSPLALWQAEYVQRRLIACH--PGLRVELLPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ ++SG  D AVHS KD+P     GL + A   RED  D F+SH   S+  
Sbjct: 59  KGLFVKELEQAMLSGSADIAVHSMKDVPVAFPPGLGLVAICEREDPHDAFVSHHYTSVDS 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  L   R D+ +   RG + TRL KL+  +  AI+LA AG+KRL 
Sbjct: 119 LPQGAIVGTSSLRRQCQLSARRPDLVIRSLRGNVGTRLGKLDAGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I++++  E+  P+ GQGA+ IE  +++ +   L+  +NH +T   V+ ERA    L
Sbjct: 179 LGDRIRQVMPAEESLPAVGQGAVGIECRLDDIQTIALLAALNHSETACRVSAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +   L+  G+V + DG       R G R DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYALLEDDQLWLRGLVGSPDGNEMVRGERRGPRADAEKMGISLAEELLENG 298

Query: 301 NKNVF 305
            +++ 
Sbjct: 299 ARDIL 303


>gi|262273217|ref|ZP_06051033.1| porphobilinogen deaminase [Grimontia hollisae CIP 101886]
 gi|262222795|gb|EEY74104.1| porphobilinogen deaminase [Grimontia hollisae CIP 101886]
          Length = 311

 Score =  291 bits (745), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 107/306 (34%), Positives = 165/306 (53%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M   P RI TR SPLAL  A   +++L   H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 1   MTSTPIRIATRQSPLALWQAEFVKAALEATH--PGLTVELVPMVTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ ++ G  D AVHS KD+P +  +GL +     RED RD F+S+   S+ +
Sbjct: 59  KGLFVKELEQAMLDGRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNHYTSISE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  L   R D+ + D RG + TRL KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPQGAIVGTSSLRRQCQLRAMRPDLVIKDLRGNVGTRLGKLDNGEYDAIILASAGLKRLN 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I+  +  E+  P+ GQGA+ IE  +++ + + L++ +   +T   V CERA    L
Sbjct: 179 LHDRIRNEIEPEEILPAVGQGAVGIECRLDDERVRALLEPLADANTTYRVLCERAMNNRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A   G  ++   +V   DG         G    A  +G   A+ +    
Sbjct: 239 MGGCQVPIGSYAEIHGDQIHLRALVGEPDGSKIVRGEVTGPLEKAEELGTGLAEQLLDDG 298

Query: 301 NKNVFN 306
            + +  
Sbjct: 299 ARAILE 304


>gi|327483021|gb|AEA77428.1| Porphobilinogen deaminase [Vibrio cholerae LMA3894-4]
          Length = 311

 Score =  291 bits (745), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 113/306 (36%), Positives = 168/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 1   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T   ++D
Sbjct: 59  KGLFVKELEIAMLEGRADLAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNTYAKIED 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 119 LPSGAIVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  V++ + + L+  +NH DT D V CERA    L
Sbjct: 179 LESRIRSFIEPEQSLPAVGQGAVGIECRVDDQRVRALLAPLNHADTADRVRCERAMNLTL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G T++   +V   DG         G R  A  +G   A+ +    
Sbjct: 239 QGGCQVPIGSYALLEGDTIWLRALVGEPDGSQIVRGEIRGPRTQAEQLGITLAEQLLSQG 298

Query: 301 NKNVFN 306
            K +  
Sbjct: 299 AKEILE 304


>gi|89074445|ref|ZP_01160922.1| porphobilinogen deaminase [Photobacterium sp. SKA34]
 gi|89049733|gb|EAR55283.1| porphobilinogen deaminase [Photobacterium sp. SKA34]
          Length = 310

 Score =  291 bits (744), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 104/306 (33%), Positives = 168/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR SPLA+  A   ++ +   H  P  ++ ++P+ TKGD I +  L ++GG
Sbjct: 1   MSNQLIRIATRKSPLAMWQAEFVKAEIEQAH--PGISVELVPMITKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL +     RED RD F+S+   ++ +
Sbjct: 59  KGLFVKELEVAMLEGRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNKYNNIDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  L   R D+ V D RG + TRL K++  +  AI+LA AG+KRLK
Sbjct: 119 LPQGAIVGTSSLRRQCQLRAQRPDLIVNDLRGNVNTRLRKMDEGQYDAIILACAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  +++ + ++L+  ++ + T   V CERA    L
Sbjct: 179 MEDRIRSEIAPEVSLPAVGQGAVGIECRLDDTRVRQLLTALSDQATTTRVLCERAMNNHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G  ++   +V   DG         G    A  +G   A+ +    
Sbjct: 239 QGGCQVPIGSYAELEGDQVWLRALVGEPDGSKIVRAEIRGPIEQAEQLGETLAEQLLNDG 298

Query: 301 NKNVFN 306
            +++ +
Sbjct: 299 ARDILD 304


>gi|288937772|ref|YP_003441831.1| porphobilinogen deaminase [Klebsiella variicola At-22]
 gi|288892481|gb|ADC60799.1| porphobilinogen deaminase [Klebsiella variicola At-22]
          Length = 318

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 169/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  +I TR SPLAL  A   ++ L   H  P  N+ ++P+ T+GD I +  L ++GG
Sbjct: 6   MLDKVLKIATRQSPLALWQAQYVKARLEQAH--PGLNVELVPMVTRGDVILDTPLAKVGG 63

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL +     R+D RD F+S+   S+ +
Sbjct: 64  KGLFVKELELAMLEGRADIAVHSMKDVPVEFPEGLGLVTICERDDPRDAFVSNHYASIDE 123

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRLK
Sbjct: 124 LPAGSVVGTSSLRRQCQLAATRPDLVIRSLRGNVGTRLSKLDNGEYDAIILAAAGLKRLK 183

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I++ L+ E   P+ GQGA+ IE  +++   Q L+  +NH +T   V  ERA    L
Sbjct: 184 LEARIRQPLSPEQSLPAVGQGAVGIECRLDDAWTQALLAPLNHAETAVRVRAERAMNTRL 243

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      L+   +V A DG       R G    A  +G   A+ +    
Sbjct: 244 EGGCQVPIGSYAELVNGELWLRALVGAPDGSQMVRGERRGPAEQAEALGISLAEELLDNG 303

Query: 301 NKNVF 305
            +++ 
Sbjct: 304 ARDIL 308


>gi|153803403|ref|ZP_01957989.1| porphobilinogen deaminase [Vibrio cholerae MZO-3]
 gi|124121060|gb|EAY39803.1| porphobilinogen deaminase [Vibrio cholerae MZO-3]
          Length = 311

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 113/306 (36%), Positives = 169/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 1   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T   ++D
Sbjct: 59  KGLFVKELEIAMLEGRADLAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNTYAKIED 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 119 LPSGAIVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  V++ + + L+  +NH DT D V CERA    L
Sbjct: 179 LESRIRSFIEPEQSLPAVGQGAVGIECRVDDQRVRALLAPLNHADTADRVRCERAMNLTL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G+T++   +V   DG         G R  A  +G   A+ +    
Sbjct: 239 QGGCQVPIGSYALLEGNTIWLRALVGEPDGSQIVRGEIRGPRTQAEQLGITLAEQLLSQG 298

Query: 301 NKNVFN 306
            K +  
Sbjct: 299 AKEILE 304


>gi|310766129|gb|ADP11079.1| porphobilinogen deaminase [Erwinia sp. Ejp617]
          Length = 313

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 111/305 (36%), Positives = 173/305 (56%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L+D H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MSDKILRIATRKSPLALWQAKYVQQRLIDCH--PGLRVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ ++SG  D AVHS KD+P    +GL + A   R+D  D F+S+   S+  
Sbjct: 59  KGLFVKELEQAMLSGSADIAVHSMKDVPVAFPQGLGLVAICERDDPHDAFVSNRHASVDS 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  L   R D+ +   RG + TRL KL+  +  AI+LA AG+KRL 
Sbjct: 119 LPQGAIVGTSSLRRQCQLSARRPDLVIHSLRGNVGTRLGKLDAGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I++++  E+  P+ GQGA+ IE  +++     L+  +NH++T   V+ ERA    L
Sbjct: 179 LSDRIRQVMPAEESLPAVGQGAVGIECRLDDMHTIGLLAALNHDETACRVSAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +G  L+  G+V + DG       R G+R DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYALLEGDQLWLRGLVGSPDGSQMVRGERRGSRADAEKMGISLAEELLDNG 298

Query: 301 NKNVF 305
            +++ 
Sbjct: 299 ARDIL 303


>gi|238793582|ref|ZP_04637206.1| Porphobilinogen deaminase [Yersinia intermedia ATCC 29909]
 gi|238727172|gb|EEQ18702.1| Porphobilinogen deaminase [Yersinia intermedia ATCC 29909]
          Length = 313

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQHLLQANH--PGLQVELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     R+D RD F+S     + D
Sbjct: 59  KGLFVKELELALLDGRADIAVHSMKDVPVAFPEGLGLVTICERDDPRDAFVSPHFAHIDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ + D RG + TRL KL+N   HAI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDNGDYHAIILAVAGLNRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I+  +  E+  P+ GQGA+ IE  +++   ++L+  +NH  T   V  ERA    L
Sbjct: 179 LASRIRYAMPAEESLPAVGQGAVGIECRLDDDFTRQLLAPLNHRVTELRVCAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +G+TL+  G+V A DG       R G   +A  +G + A  +    
Sbjct: 239 EGGCQVPIGSYAELEGNTLWLRGLVGAPDGSEIIRGERRGPAENAEQMGIELADELLSRG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 ARAIL 303


>gi|259906881|ref|YP_002647237.1| porphobilinogen deaminase [Erwinia pyrifoliae Ep1/96]
 gi|224962503|emb|CAX53958.1| Porphobilinogen deaminase [Erwinia pyrifoliae Ep1/96]
 gi|283476674|emb|CAY72503.1| hemC [Erwinia pyrifoliae DSM 12163]
          Length = 313

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 111/305 (36%), Positives = 172/305 (56%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L+D H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MSDKILRIATRKSPLALWQAKYVQQRLIDCH--PGLRVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ ++SG  D AVHS KD+P    +GL + A   R+D  D F+S+   S+  
Sbjct: 59  KGLFVKELEQAMLSGSADIAVHSMKDVPVAFPQGLGLVAICERDDPHDAFVSNRHASVDS 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  L   R D+ +   RG + TRL KL+  +  AI+LA AG+KRL 
Sbjct: 119 LPQGAIVGTSSLRRQCQLSARRPDLVIHSLRGNVGTRLGKLDAGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I++++  E+  P+ GQGA+ IE  + +     L+  +NH++T   V+ ERA    L
Sbjct: 179 LSDRIRQVMPAEESLPAVGQGAVGIECRLEDMHTIGLLAALNHDETACRVSAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +G  L+  G+V + DG       R G+R DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYALLEGDQLWLRGLVGSPDGSQMVRGERRGSRADAEKMGISLAEELLDNG 298

Query: 301 NKNVF 305
            +++ 
Sbjct: 299 ARDIL 303


>gi|238750675|ref|ZP_04612174.1| Porphobilinogen deaminase [Yersinia rohdei ATCC 43380]
 gi|238711065|gb|EEQ03284.1| Porphobilinogen deaminase [Yersinia rohdei ATCC 43380]
          Length = 313

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 114/305 (37%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLNKIIRIATRQSPLALWQAHYVQHLLQANH--PGLQVELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     R+D RD F+S     L D
Sbjct: 59  KGLFVKELELALLEGRADIAVHSMKDVPIAFPEGLGLVTICERDDPRDAFVSSHYAHLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ + D RG + TRL KL+N   HAI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDNGDYHAIILAVAGLNRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I+  +  E+  P+ GQGA+ IE  +++   ++L+  +NH +T   V  ERA    L
Sbjct: 179 LKSRIRYAMPAEESLPAVGQGAVGIECRLDDDFTRQLLVPLNHRETELRVCAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +G TL+   +V A DG       R G   DA  +G + A  +    
Sbjct: 239 EGGCQVPIGSYAELEGDTLWLRALVGAPDGSEIIRGERRGPAEDAEQMGIELADELLSRG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|206580079|ref|YP_002241132.1| porphobilinogen deaminase [Klebsiella pneumoniae 342]
 gi|290513167|ref|ZP_06552529.1| porphobilinogen deaminase [Klebsiella sp. 1_1_55]
 gi|226706289|sp|B5XYL1|HEM3_KLEP3 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|206569137|gb|ACI10913.1| porphobilinogen deaminase [Klebsiella pneumoniae 342]
 gi|289774378|gb|EFD82384.1| porphobilinogen deaminase [Klebsiella sp. 1_1_55]
          Length = 313

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 169/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  +I TR SPLAL  A   ++ L   H  P  N+ ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKVLKIATRQSPLALWQAQYVKARLEQAH--PGLNVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL +     R+D RD F+S+   S+ +
Sbjct: 59  KGLFVKELELAMLEGRADIAVHSMKDVPVEFPEGLGLVTICERDDPRDAFVSNHYASIDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRLK
Sbjct: 119 LPAGSVVGTSSLRRQCQLAATRPDLVIRSLRGNVGTRLSKLDNGEYDAIILAAAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I++ L+ E   P+ GQGA+ IE  +++   Q L+  +NH +T   V  ERA    L
Sbjct: 179 LEARIRQPLSPEQSLPAVGQGAVGIECRLDDAWTQALLAPLNHAETAVRVRAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      L+   +V A DG       R G    A  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELVNGELWLRALVGAPDGSQMVRGERRGPAEQAEALGISLAEELLDNG 298

Query: 301 NKNVF 305
            +++ 
Sbjct: 299 ARDIL 303


>gi|238765355|ref|ZP_04626280.1| Porphobilinogen deaminase [Yersinia kristensenii ATCC 33638]
 gi|238696442|gb|EEP89234.1| Porphobilinogen deaminase [Yersinia kristensenii ATCC 33638]
          Length = 313

 Score =  290 bits (743), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 166/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQHLLQANH--PGLQVELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P    +GL +     R+D RD F+S     L D
Sbjct: 59  KGLFVKELELAMLDGRADIAVHSMKDVPIAFPEGLGLVTICERDDPRDAFVSSNYAHLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ + D RG + TRL KL+  + HAI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDKGEYHAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E+  P+ GQGA+ IE  +++   ++L+  +NH +T   V  ERA    L
Sbjct: 179 LETRIRYAMPAEESLPAVGQGAVGIECRLDDDYTRQLLAPLNHRETELRVCAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A   G+TL+   +V A DG       R G   +A  +G + A  +    
Sbjct: 239 EGGCQVPIGSYAELDGNTLWLRALVGAPDGSEIIRGERRGPAENAEQMGVELADELLARG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|15640152|ref|NP_229779.1| porphobilinogen deaminase [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121587718|ref|ZP_01677479.1| porphobilinogen deaminase [Vibrio cholerae 2740-80]
 gi|121728303|ref|ZP_01681334.1| porphobilinogen deaminase [Vibrio cholerae V52]
 gi|147675270|ref|YP_001218298.1| porphobilinogen deaminase [Vibrio cholerae O395]
 gi|153818935|ref|ZP_01971602.1| porphobilinogen deaminase [Vibrio cholerae NCTC 8457]
 gi|153822325|ref|ZP_01974992.1| porphobilinogen deaminase [Vibrio cholerae B33]
 gi|227080356|ref|YP_002808907.1| porphobilinogen deaminase [Vibrio cholerae M66-2]
 gi|229508398|ref|ZP_04397902.1| porphobilinogen deaminase [Vibrio cholerae BX 330286]
 gi|229508921|ref|ZP_04398411.1| porphobilinogen deaminase [Vibrio cholerae B33]
 gi|229517035|ref|ZP_04406481.1| porphobilinogen deaminase [Vibrio cholerae RC9]
 gi|229606671|ref|YP_002877319.1| porphobilinogen deaminase [Vibrio cholerae MJ-1236]
 gi|254851504|ref|ZP_05240854.1| porphobilinogen deaminase [Vibrio cholerae MO10]
 gi|298501111|ref|ZP_07010911.1| porphobilinogen deaminase [Vibrio cholerae MAK 757]
 gi|9654520|gb|AAF93298.1| porphobilinogen deaminase [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121548017|gb|EAX58095.1| porphobilinogen deaminase [Vibrio cholerae 2740-80]
 gi|121629433|gb|EAX61862.1| porphobilinogen deaminase [Vibrio cholerae V52]
 gi|126510497|gb|EAZ73091.1| porphobilinogen deaminase [Vibrio cholerae NCTC 8457]
 gi|126520151|gb|EAZ77374.1| porphobilinogen deaminase [Vibrio cholerae B33]
 gi|146317153|gb|ABQ21692.1| porphobilinogen deaminase [Vibrio cholerae O395]
 gi|227008244|gb|ACP04456.1| porphobilinogen deaminase [Vibrio cholerae M66-2]
 gi|227011878|gb|ACP08088.1| porphobilinogen deaminase [Vibrio cholerae O395]
 gi|229346098|gb|EEO11070.1| porphobilinogen deaminase [Vibrio cholerae RC9]
 gi|229354038|gb|EEO18971.1| porphobilinogen deaminase [Vibrio cholerae B33]
 gi|229354671|gb|EEO19593.1| porphobilinogen deaminase [Vibrio cholerae BX 330286]
 gi|229369326|gb|ACQ59749.1| porphobilinogen deaminase [Vibrio cholerae MJ-1236]
 gi|254847209|gb|EET25623.1| porphobilinogen deaminase [Vibrio cholerae MO10]
 gi|297540145|gb|EFH76206.1| porphobilinogen deaminase [Vibrio cholerae MAK 757]
          Length = 317

 Score =  290 bits (743), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 114/306 (37%), Positives = 168/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 7   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDVILDTPLAKVGG 64

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T   ++D
Sbjct: 65  KGLFVKELEIAMLEGRADLAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNTYAKIED 124

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 125 LPSGAIVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 184

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  VN+ + + L+  +NH DT D V CERA    L
Sbjct: 185 LESRIRSFIEPEQSLPAVGQGAVGIECRVNDQRVRALLAPLNHADTADRVRCERAMNLTL 244

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G T++   +V   DG         G R  A  +G   A+ +    
Sbjct: 245 QGGCQVPIGSYALLEGDTIWLRALVGEPDGSQIVRGEIRGPRTQAEQLGITLAEQLLSQG 304

Query: 301 NKNVFN 306
            K +  
Sbjct: 305 AKEILE 310


>gi|238892405|ref|YP_002917139.1| porphobilinogen deaminase [Klebsiella pneumoniae NTUH-K2044]
 gi|329997497|ref|ZP_08302799.1| hydroxymethylbilane synthase [Klebsiella sp. MS 92-3]
 gi|238544721|dbj|BAH61072.1| porphobilinogen deaminase [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|328539065|gb|EGF65104.1| hydroxymethylbilane synthase [Klebsiella sp. MS 92-3]
          Length = 318

 Score =  290 bits (743), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 111/305 (36%), Positives = 169/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  +I TR SPLAL  A   ++ L   H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 6   MLDKVLKIATRQSPLALWQAQYVKARLEQAH--PGLKVELVPMVTRGDVILDTPLAKVGG 63

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL +     R+D RD F+S+   S+ +
Sbjct: 64  KGLFVKELELAMLEGRADIAVHSMKDVPVEFPEGLGLVTICERDDPRDAFVSNRYASIDE 123

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+++   RG + TRL+KL+N +  AI+LA AG+KRL+
Sbjct: 124 LPAGSVVGTSSLRRQCQLAATRPDLAIRSLRGNVGTRLSKLDNGEYDAIILAAAGLKRLQ 183

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I++ L+ E   P+ GQGA+ IE  +++   + L+  +NH +T   V  ERA    L
Sbjct: 184 LEARIRQPLSPEQSLPAVGQGAVGIECRLDDAWTRGLLAPLNHTETAVRVRAERAMNTRL 243

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  K   L+   +V A DG       R G    A  +G   A+ +    
Sbjct: 244 EGGCQVPIGSYAELKDGELWLRALVGAPDGSQLVRGERRGPAEQAEALGISLAEELLDNG 303

Query: 301 NKNVF 305
            + + 
Sbjct: 304 AREIL 308


>gi|238760184|ref|ZP_04621331.1| Porphobilinogen deaminase [Yersinia aldovae ATCC 35236]
 gi|238701620|gb|EEP94190.1| Porphobilinogen deaminase [Yersinia aldovae ATCC 35236]
          Length = 313

 Score =  290 bits (743), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 114/305 (37%), Positives = 163/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQHLLQANH--PGLQVELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P     GL +     R+D RD F+S     L D
Sbjct: 59  KGLFVKELELALLEGRADIAVHSMKDVPIAFPDGLGLVTICERDDPRDAFVSSHFAHLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ + D RG + TRL KL+  + HAI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLRERRPDLVIRDLRGNVGTRLAKLDKGEYHAIILAVAGLNRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E+  P+ GQGA+ IE  +++   ++L+  +NH DT   V  ERA    L
Sbjct: 179 LETRIRYAMPAEESLPAVGQGAVGIECRLDDDFTRQLLAPLNHRDTELRVLAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A   G TL+   +V A DG       R G   +A  +G + A  +    
Sbjct: 239 EGGCQVPIGSYAELDGDTLWLRALVGAPDGSEIIRGERRGPVANAEQMGIELADELLSRG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|152972793|ref|YP_001337939.1| porphobilinogen deaminase [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|166217775|sp|A6TGI8|HEM3_KLEP7 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|150957642|gb|ABR79672.1| porphobilinogen deaminase [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
          Length = 313

 Score =  290 bits (743), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 111/305 (36%), Positives = 169/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  +I TR SPLAL  A   ++ L   H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKVLKIATRQSPLALWQAQYVKARLEQAH--PGLKVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL +     R+D RD F+S+   S+ +
Sbjct: 59  KGLFVKELELAMLEGRADIAVHSMKDVPVEFPEGLGLVTICERDDPRDAFVSNRYASIDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+++   RG + TRL+KL+N +  AI+LA AG+KRL+
Sbjct: 119 LPAGSVVGTSSLRRQCQLAATRPDLAIRSLRGNVGTRLSKLDNGEYDAIILAAAGLKRLQ 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I++ L+ E   P+ GQGA+ IE  +++   + L+  +NH +T   V  ERA    L
Sbjct: 179 LEARIRQPLSPEQSLPAVGQGAVGIECRLDDAWTRGLLAPLNHTETAVRVRAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  K   L+   +V A DG       R G    A  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELKDGELWLRALVGAPDGSQLVRGERRGPAEQAEALGISLAEELLDNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|229525016|ref|ZP_04414421.1| porphobilinogen deaminase [Vibrio cholerae bv. albensis VL426]
 gi|229338597|gb|EEO03614.1| porphobilinogen deaminase [Vibrio cholerae bv. albensis VL426]
          Length = 317

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 114/306 (37%), Positives = 169/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 7   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDVILDTPLAKVGG 64

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T   ++D
Sbjct: 65  KGLFVKELEIAMLEGRADLAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNTYAKIED 124

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 125 LPSGAIVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 184

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  VN+ + + L+  +NH DT D V CERA    L
Sbjct: 185 LESRIRSFIEPEQSLPAVGQGAVGIECRVNDQRVRALLAPLNHADTADRVRCERAMNLTL 244

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G+T++   +V   DG         G R  A  +G   A+ +    
Sbjct: 245 QGGCQVPIGSYALLEGNTIWLRALVGEPDGSQIVRGEIRGPRTQAEQLGITLAEQLLSQG 304

Query: 301 NKNVFN 306
            K +  
Sbjct: 305 AKEILE 310


>gi|258623142|ref|ZP_05718154.1| porphobilinogen deaminase [Vibrio mimicus VM573]
 gi|258584625|gb|EEW09362.1| porphobilinogen deaminase [Vibrio mimicus VM573]
          Length = 326

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 113/306 (36%), Positives = 168/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 16  MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLKVELVTMVTRGDVILDTPLAKVGG 73

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T   + D
Sbjct: 74  KGLFVKELEVAMLEGRADLAVHSMKDVPVDFPQGLGLVTICEREDPRDAFVSNTYAKIDD 133

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 134 LPSGAVVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 193

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  +++ + +EL+  +NH DT D V CERA    L
Sbjct: 194 LESRIRSFIEPEQSLPAVGQGAVGIECRLDDQRVRELLAPLNHTDTADRVRCERAMNLTL 253

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A   G  ++   +V   DG         G R +A  +G   A+ +    
Sbjct: 254 QGGCQVPIGSYALLDGDEIWLRALVGEPDGSQIVRGEIRGPRSEAEQLGITLAEQLLGQG 313

Query: 301 NKNVFN 306
            K +  
Sbjct: 314 AKEILE 319


>gi|163748699|ref|ZP_02155952.1| porphobilinogen deaminase [Shewanella benthica KT99]
 gi|161331809|gb|EDQ02613.1| porphobilinogen deaminase [Shewanella benthica KT99]
          Length = 309

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 118/306 (38%), Positives = 169/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLAL  A   ++ L   H  P   + ++P+STKGD I +  L ++GG
Sbjct: 1   MSQNVIRIATRKSPLALWQAEFVKAELEKFH--PGLTVELLPMSTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++    D AVHS KD+P     GL +     RED RD F+S+  +S+ D
Sbjct: 59  KGLFVKELEVAILEDRADIAVHSIKDVPVDFPDGLGLEVICEREDPRDAFVSNDYKSIGD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  +   R D+ +ID RG + TRL KL+     AI+LA AG+KRLK
Sbjct: 119 LPQGAVVGTSSLRRQCQIRGMRPDLKIIDLRGNVGTRLGKLDAGNYDAIILAAAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I   ++ ED  P+ GQGA+ IE   +N + + L+  + H +T   V  ERA    L
Sbjct: 179 LEERITSFISTEDSLPANGQGAVGIECRTDNERVKALLAPLEHAETRFRVTAERAMNTHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  FA  +G TL   G+V   DG      +  G + DA  IG   A+ +    
Sbjct: 239 EGGCQVPIGAFAEIQGDTLTLRGLVGNPDGSKIITGTCVGPKTDAKAIGIALAEELLGKG 298

Query: 301 NKNVFN 306
            K + +
Sbjct: 299 AKEILD 304


>gi|229515846|ref|ZP_04405304.1| porphobilinogen deaminase [Vibrio cholerae TMA 21]
 gi|229527138|ref|ZP_04416532.1| porphobilinogen deaminase [Vibrio cholerae 12129(1)]
 gi|229335369|gb|EEO00852.1| porphobilinogen deaminase [Vibrio cholerae 12129(1)]
 gi|229347109|gb|EEO12070.1| porphobilinogen deaminase [Vibrio cholerae TMA 21]
          Length = 317

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 113/306 (36%), Positives = 168/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 7   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDVILDTPLAKVGG 64

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T   ++D
Sbjct: 65  KGLFVKELEIAMLEGRADLAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNTYAKIED 124

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 125 LPSGAIVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 184

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  V++ + + L+  +NH DT D V CERA    L
Sbjct: 185 LESRIRSFIEPEQSLPAVGQGAVGIECRVDDQRVRALLAPLNHADTADRVRCERAMNLTL 244

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G T++   +V   DG         G R  A  +G   A+ +    
Sbjct: 245 QGGCQVPIGSYALLEGDTIWLRALVGEPDGSQIVRGEIRGPRTQAEQLGITLAEQLLSQG 304

Query: 301 NKNVFN 306
            K +  
Sbjct: 305 AKEILE 310


>gi|254473214|ref|ZP_05086612.1| porphobilinogen deaminase [Pseudovibrio sp. JE062]
 gi|211957935|gb|EEA93137.1| porphobilinogen deaminase [Pseudovibrio sp. JE062]
          Length = 307

 Score =  290 bits (741), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 136/306 (44%), Positives = 195/306 (63%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KP RIGTR S LALA A ETR+ L   H +   +  I+ + T GD+I +R L+E GG
Sbjct: 1   MQTKPIRIGTRGSALALAQAHETRARLAKAHGLTDDDFEIVVIKTTGDQIQDRPLSEAGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ L+   ID AVHS+KDMPT L  GL ++AYLPRED+RD FIS   + L D
Sbjct: 61  KGLFTKEIEEALLDKSIDLAVHSSKDMPTVLPDGLGMTAYLPREDVRDAFISPKVEKLTD 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+G+SSLRR+A + R R D+ V+ +RG ++TRL KL+     A  LAYAG++RL 
Sbjct: 121 LPQGAVVGSSSLRRQAQIKRLRPDLDVVMYRGNLQTRLRKLDEGVVDATFLAYAGLRRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           +  ++  ++++E F P+ GQGAI IE  + + +   ++  I+H +T   +  ERA+LAE+
Sbjct: 181 QGDLVTSLMDLEHFLPAVGQGAIGIEARLGDEETARILAPIHHAETESRLLLERAYLAEM 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG ++ +G  + F G V+  DG   H V   G   DA  IGR+  + ++  S
Sbjct: 241 DGSCRTPIAGLSHVEGDRIKFRGEVIKPDGSQTHTVEGEGPVSDAEEIGRELGKELKAKS 300

Query: 301 NKNVFN 306
             N   
Sbjct: 301 GPNFLE 306


>gi|21957067|gb|AAM83970.1|AE013638_8 porphobilinogen deaminase; hydroxymethylbilane synthase [Yersinia
           pestis KIM 10]
 gi|45437816|gb|AAS63365.1| porphobilinogen deaminase [Yersinia pestis biovar Microtus str.
           91001]
          Length = 369

 Score =  290 bits (741), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 117/305 (38%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P   I ++P+ T+GD I +  L ++GG
Sbjct: 57  MLDKIIRIATRQSPLALWQAHYVQHLLQANH--PGLQIELVPMVTRGDIILDTPLAKVGG 114

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     RED RD F+S     L D
Sbjct: 115 KGLFVKELELALLDGRADIAVHSMKDVPIAFPEGLGLVTICEREDPRDAFVSSHYAHLDD 174

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+ + D RG + TRL KL+N    AI+LA AG+KRL 
Sbjct: 175 LPAGSVVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDNGDYQAIILAVAGLKRLG 234

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  ++ E+  P+ GQGA+ IE  +++   ++L+  +NH  T   V  ERA    L
Sbjct: 235 LENRIRYAMSAEESLPAVGQGAVGIECRLDDDHTRQLLAPLNHRHTELRVCAERAMNIRL 294

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +G TL+   +V A DG       R G   +A  +G + A  +    
Sbjct: 295 EGGCQVPIGSYAELEGDTLWLRALVGAPDGSQMIRGERRGPAAEAEQMGIELADELLSRG 354

Query: 301 NKNVF 305
            + + 
Sbjct: 355 AREIL 359


>gi|297581838|ref|ZP_06943759.1| porphobilinogen deaminase [Vibrio cholerae RC385]
 gi|297533932|gb|EFH72772.1| porphobilinogen deaminase [Vibrio cholerae RC385]
          Length = 317

 Score =  290 bits (741), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 115/306 (37%), Positives = 170/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 7   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDVILDTPLAKVGG 64

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T   ++D
Sbjct: 65  KGLFVKELEIAMLEGRADLAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNTYAKIED 124

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GT SLRR+  L   RSD+ + + RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 125 LPSGAIVGTCSLRRQCQLKAARSDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 184

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  VN+ + + L+  +NH DT D V CERA    L
Sbjct: 185 LESRIRSFIEPEQSLPAVGQGAVGIECRVNDQRVRALLAPLNHADTADRVRCERAMNLTL 244

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G+T++   +V   DG         G R  A  +G   A+ +    
Sbjct: 245 QGGCQVPIGSYALLEGNTIWLRALVGEPDGSQIVRGEIRGPRTQAEQLGITLAEQLLSQG 304

Query: 301 NKNVFN 306
            K +  
Sbjct: 305 AKEILE 310


>gi|153826278|ref|ZP_01978945.1| porphobilinogen deaminase [Vibrio cholerae MZO-2]
 gi|149739946|gb|EDM54125.1| porphobilinogen deaminase [Vibrio cholerae MZO-2]
          Length = 311

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 112/306 (36%), Positives = 167/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 1   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T   ++D
Sbjct: 59  KGLFVKELEIAMLEGRADLAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNTYAKIED 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 119 LPSGAIVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  V++ + + L+  +NH DT D V CERA    L
Sbjct: 179 LESRIRSFIEPEQSLPAVGQGALGIECRVDDQRVRALLAPLNHADTADRVRCERAMNLTL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G  ++   +V   DG         G R  A  +G   A+ +    
Sbjct: 239 QGGCQVPIGSYALLEGDHIWLRALVGEPDGSQIVRGEIRGPRTQAEQLGITLAEQLLSQG 298

Query: 301 NKNVFN 306
            K +  
Sbjct: 299 AKEILE 304


>gi|156935870|ref|YP_001439786.1| porphobilinogen deaminase [Cronobacter sakazakii ATCC BAA-894]
 gi|166217766|sp|A7MQJ1|HEM3_ENTS8 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|156534124|gb|ABU78950.1| hypothetical protein ESA_03753 [Cronobacter sakazakii ATCC BAA-894]
          Length = 313

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 111/305 (36%), Positives = 167/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  L   H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAQYVKQRLEACH--PGLTVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL +     RED RD F+S+  +SL +
Sbjct: 59  KGLFVKELELAMLDGRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNQYKSLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           +   S++GTSSLRR+  +   R D+ +   RG + TRL+KL+N    AI+LA AG+KRL+
Sbjct: 119 MPAGSIVGTSSLRRQCQIAARRPDLIIRSLRGNVGTRLSKLDNGDYDAIILAVAGLKRLQ 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I   L  E   P+ GQGA+ IE  +++ + +EL+  +NHE+T   V  ERA    L
Sbjct: 179 LDARITSPLAPEISLPAVGQGAVGIECRLDDTRTRELLAPLNHEETAVRVRAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +   L+   +V A DG       R G   DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELRDGELWLRALVGAPDGSRIVRGERRGAPEDARQLGISLAEELLNHG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|238784737|ref|ZP_04628740.1| Porphobilinogen deaminase [Yersinia bercovieri ATCC 43970]
 gi|238714333|gb|EEQ06342.1| Porphobilinogen deaminase [Yersinia bercovieri ATCC 43970]
          Length = 313

 Score =  289 bits (740), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 114/305 (37%), Positives = 166/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P  ++ ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQHLLQANH--PGLHVELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P     GL +     R+D RD F+S +   L D
Sbjct: 59  KGLFVKELELALLDGRADIAVHSMKDVPIAFPDGLGLVTICERDDPRDAFVSSSYAHLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ + D RG + TRL KL+N   HAI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDNGDYHAIILAVAGLNRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  + +E+  P+ GQGA+ IE  +++   ++L+  +NH DT   V  ERA    L
Sbjct: 179 LETRIRYAMPVEESLPAVGQGAVGIECRLDDDFTRQLLAPLNHRDTELRVCAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +G  L+   +V A DG       R G   +A  +G + A  +    
Sbjct: 239 EGGCQVPIGSYAELEGDVLWLRALVGAPDGSEIIRGERRGPANNAEQMGIELADELLSRG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|238789375|ref|ZP_04633161.1| Porphobilinogen deaminase [Yersinia frederiksenii ATCC 33641]
 gi|238722518|gb|EEQ14172.1| Porphobilinogen deaminase [Yersinia frederiksenii ATCC 33641]
          Length = 313

 Score =  289 bits (740), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 114/305 (37%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQDLLQANH--PGLQVELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     R+D RD F+S     L D
Sbjct: 59  KGLFVKELELALLEGRADIAVHSMKDVPIAFPEGLGLVTICERDDPRDAFVSPNYAHLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ + D RG + TRL KL+N   HAI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDNGDYHAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E+  P+ GQGA+ IE  +++   ++L+  +NH +T   V  ERA    L
Sbjct: 179 LETRIRSAMPAEESLPAVGQGAVGIECRLDDDFTRQLLAPLNHRETELRVCAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +G  L+   +V A DG       R G    A  +G + A  +    
Sbjct: 239 EGGCQVPIGSYAELEGDILWLRALVGAPDGSEIIRGERRGPAQHAEQMGIELADELLSRG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|262040885|ref|ZP_06014111.1| hydroxymethylbilane synthase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259041774|gb|EEW42819.1| hydroxymethylbilane synthase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 318

 Score =  289 bits (739), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 110/305 (36%), Positives = 168/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  +I TR SPLAL  A   ++ L   H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 6   MLDKVLKIATRQSPLALWQAQYVKARLEQAH--PGLKVELVPMVTRGDVILDTPLAKVGG 63

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  + L +     R+D RD F+S+   S+ +
Sbjct: 64  KGLFVKELELAMLEGRADIAVHSMKDVPVEFPECLGLVTICERDDPRDAFVSNRYASIDE 123

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+++   RG + TRL+KL+N +  AI+LA AG+KRL+
Sbjct: 124 LPAGSVVGTSSLRRQCQLAATRPDLAIRSLRGNVGTRLSKLDNGEYDAIILAAAGLKRLQ 183

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I++ L+ E   P+ GQGA+ IE  +++   + L+  +NH +T   V  ERA    L
Sbjct: 184 LEARIRQPLSPEQSLPAVGQGAVGIECRLDDAWTRGLLAPLNHTETAVRVRAERAMNTRL 243

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  K   L+   +V A DG       R G    A  +G   A+ +    
Sbjct: 244 EGGCQVPIGSYAELKDGELWLRALVGAPDGSQLVRGERRGPAEQAEALGISLAEELLDNG 303

Query: 301 NKNVF 305
            + + 
Sbjct: 304 AREIL 308


>gi|324111028|gb|EGC05015.1| porphobilinogen deaminase [Escherichia fergusonii B253]
 gi|325499227|gb|EGC97086.1| porphobilinogen deaminase [Escherichia fergusonii ECD227]
          Length = 313

 Score =  289 bits (739), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 114/305 (37%), Positives = 169/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   + +LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDALMAKH--PGLTVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL +
Sbjct: 59  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNKYASLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I++ L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 179 LESRIRDALPPEVSLPAVGQGAVGIECRLDDTRTRELLAALNHPETALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A   G  ++   +V A DG       R G+  DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELIGGEIWLRALVGAPDGSQMIRGERRGSPQDAEKMGISLAEELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 ARAIL 303


>gi|218550973|ref|YP_002384764.1| porphobilinogen deaminase [Escherichia fergusonii ATCC 35469]
 gi|226740637|sp|B7LU53|HEM3_ESCF3 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|218358514|emb|CAQ91161.1| hydroxymethylbilane synthase [Escherichia fergusonii ATCC 35469]
          Length = 313

 Score =  289 bits (739), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 114/305 (37%), Positives = 169/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   + +LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDALMAKH--PGLTVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL +
Sbjct: 59  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNKYASLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I++ L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 179 LESRIRDALPPEVSLPAVGQGAVGIECRLDDTRTRELLAALNHPETALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A   G  ++   +V A DG       R G+  DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELIGGEIWLRALVGAPDGSQMIRGERRGSPQDAEKMGISLAEELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 ARAIL 303


>gi|170724850|ref|YP_001758876.1| porphobilinogen deaminase [Shewanella woodyi ATCC 51908]
 gi|238059003|sp|B1KQC6|HEM3_SHEWM RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|169810197|gb|ACA84781.1| porphobilinogen deaminase [Shewanella woodyi ATCC 51908]
          Length = 309

 Score =  289 bits (739), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 111/306 (36%), Positives = 168/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLAL  A   ++ L   H  P   + ++P+STKGD I +  L ++GG
Sbjct: 1   MSQNVIRIATRKSPLALWQAEFVKAELEKFH--PDLTVELLPMSTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++    D AVHS KD+P    +GL +     RED RD F+S+  +S+ +
Sbjct: 59  KGLFVKELEVAMLENRADIAVHSMKDVPVDFPEGLGLEIICEREDPRDAFVSNNYKSISE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  +   R D+ + D RG + TRL KL+     AI+LA AG+KRLK
Sbjct: 119 LPKGAVVGTSSLRRQCQIRAARPDLQIRDLRGNVGTRLGKLDAGTYDAIILAAAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I   ++ E+  P+ GQGA+ IE   ++ + + L+  + H +T   V  ERA    L
Sbjct: 179 LEERITSFISAEESLPANGQGAVGIECRTDDERVKALLAPLEHAETRFRVIAERAMNTHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A     TL   G+V   DG      ++ G + DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGAYAEIVDDTLTLRGLVGNPDGTQIIASTKVGPKTDAKALGISLAEELLSKG 298

Query: 301 NKNVFN 306
            K + +
Sbjct: 299 AKTILD 304


>gi|157960202|ref|YP_001500236.1| porphobilinogen deaminase [Shewanella pealeana ATCC 700345]
 gi|189028157|sp|A8GZG4|HEM3_SHEPA RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|157845202|gb|ABV85701.1| porphobilinogen deaminase [Shewanella pealeana ATCC 700345]
          Length = 310

 Score =  289 bits (739), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 113/306 (36%), Positives = 172/306 (56%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLA+  A   ++ L  +H+     + ++P+STKGD I +  L ++GG
Sbjct: 1   MSQNLIRIATRKSPLAMWQAEFVKAELEKIHE--GLTVELLPMSTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T ++++D
Sbjct: 59  KGLFVKELEVAMLEGLADIAVHSMKDVPVDFPEGLGLEVICEREDPRDAFVSNTYKTIED 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  +   R D+ + D RG + TRL KL+     AI+LA AG+KRLK
Sbjct: 119 LPQGAVVGTSSLRRQCQIRAARPDLVIKDLRGNVGTRLAKLDAGNYDAIILAAAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I   ++ E   P+ GQGA+ IE   ++ + + L+  + H +T   V  ERA    L
Sbjct: 179 LEERIASFISAEQSLPANGQGAVGIECRTDDARVKALLAPLEHAETRMRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A   G TL   G+V   DG      S +G+  DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGAYAEIDGDTLSLRGLVGNPDGSQIITASSSGSTADAEKLGVALAEELLSKG 298

Query: 301 NKNVFN 306
            K + +
Sbjct: 299 AKTILD 304


>gi|292486675|ref|YP_003529545.1| Porphobilinogen deaminase [Erwinia amylovora CFBP1430]
 gi|292897912|ref|YP_003537281.1| porphobilinogen deaminase [Erwinia amylovora ATCC 49946]
 gi|291197760|emb|CBJ44855.1| porphobilinogen deaminase [Erwinia amylovora ATCC 49946]
 gi|291552092|emb|CBA19129.1| Porphobilinogen deaminase [Erwinia amylovora CFBP1430]
 gi|312170741|emb|CBX79003.1| Porphobilinogen deaminase [Erwinia amylovora ATCC BAA-2158]
          Length = 313

 Score =  289 bits (739), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 173/305 (56%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L+D H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MSDKILRIATRKSPLALWQAKYVQQRLIDCH--PRLRVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++SG  D AVHS KD+P    +GL + A   R+D  D F+S+   S+  
Sbjct: 59  KGLFVKELENAMLSGHADIAVHSMKDVPVAFPQGLGLVAICERDDPHDAFVSNHYASVDS 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  L   R D+ +   RG + TRL KL+  +  AI+LA AG+KRL 
Sbjct: 119 LPAGAIVGTSSLRRQCQLSARRPDLVIHSLRGNVGTRLGKLDAGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I++++  E+  P+ GQGA+ IE  +++ +   L+  +NH+DT   V+ ERA    L
Sbjct: 179 LSGRIRQVMPAEESLPAVGQGAVGIECRLDDMRTIGLLAALNHDDTACRVSAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +G  L+  G+V + DG       R G+R DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYALLEGDRLWLRGLVGSPDGSQMVRGERRGSRADAEKMGISLAEELLDNG 298

Query: 301 NKNVF 305
            +++ 
Sbjct: 299 ARDIL 303


>gi|123440582|ref|YP_001004576.1| porphobilinogen deaminase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|332159812|ref|YP_004296389.1| porphobilinogen deaminase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|158512667|sp|A1JI86|HEM3_YERE8 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|122087543|emb|CAL10324.1| porphobilinogen deaminase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|318607646|emb|CBY29144.1| porphobilinogen deaminase [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325664042|gb|ADZ40686.1| porphobilinogen deaminase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330862558|emb|CBX72712.1| porphobilinogen deaminase [Yersinia enterocolitica W22703]
          Length = 313

 Score =  289 bits (739), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQHLLQANH--PGLQVELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     R+D RD F+S     L +
Sbjct: 59  KGLFVKELELALLEGRADIAVHSMKDVPIAFPEGLGLVTICERDDPRDAFVSINYAHLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ + D RG + TRL KL+  + HAI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDKGEYHAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E+  P+ GQGA+ IE  +++   ++L+  +NH +T   V  ERA    L
Sbjct: 179 LETRIRYAMPAEESLPAVGQGAVGIECRLDDNFTRQLLAPLNHRETELRVCAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A   G TL+   +V A DG       R G   +A  +G + A  +    
Sbjct: 239 EGGCQVPIGSYAELDGDTLWLRALVGAPDGSEIIRGERRGPAENAEQMGVELADELLSRG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|261250035|ref|ZP_05942612.1| porphobilinogen deaminase [Vibrio orientalis CIP 102891]
 gi|260939539|gb|EEX95524.1| porphobilinogen deaminase [Vibrio orientalis CIP 102891]
          Length = 312

 Score =  289 bits (739), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 110/306 (35%), Positives = 173/306 (56%), Gaps = 3/306 (0%)

Query: 1   MEK-KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M +  P RI TR SPLAL  A   + +L   H  P   + ++ + TKGD I +  L ++G
Sbjct: 1   MTQSTPIRIATRKSPLALWQAHFVKDALKAAH--PGLEVELVTMVTKGDIILDTPLAKVG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T  ++ 
Sbjct: 59  GKGLFVKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYHNID 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           +L   +++GT SLRR+  L  +R D+ + + RG + TRL KL++ +  AI+LA AG+KRL
Sbjct: 119 ELPQGAIVGTCSLRRQCQLKEYRPDLVIKELRGNVGTRLGKLDDGQYDAIILAAAGLKRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
           + E+ IK  +  E   P+ GQGA+ IE  +++ +  +L++ +NH++T D V CERA    
Sbjct: 179 ELEERIKSFIEPEQSLPAVGQGAVGIECRLDDERLIKLLEPLNHKETADRVLCERAMNLT 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I  ++   G  ++   +V   DG         G+R DA  +G + A  +   
Sbjct: 239 LEGGCQVPIGSYSLIDGDNIWLRALVGEPDGSKIIRGEIRGSRADAETLGVELANQLLDD 298

Query: 300 SNKNVF 305
             K + 
Sbjct: 299 GAKEIL 304


>gi|27364543|ref|NP_760071.1| porphobilinogen deaminase [Vibrio vulnificus CMCP6]
 gi|37678265|ref|NP_932874.1| porphobilinogen deaminase [Vibrio vulnificus YJ016]
 gi|33301181|sp|Q8DD85|HEM3_VIBVU RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|55976475|sp|Q7MQC7|HEM3_VIBVY RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|27360662|gb|AAO09598.1| porphobilinogen deaminase [Vibrio vulnificus CMCP6]
 gi|37197004|dbj|BAC92845.1| porphobilinogen deaminase [Vibrio vulnificus YJ016]
          Length = 312

 Score =  289 bits (739), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 110/301 (36%), Positives = 167/301 (55%), Gaps = 2/301 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P RI TR SPLAL  A+  + +L   H  P   + ++ + TKGD I +  L ++GGKGLF
Sbjct: 6   PIRIATRKSPLALWQAYYVKDALQKAH--PGLEVELVTMVTKGDVILDTPLAKVGGKGLF 63

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T   + +L   
Sbjct: 64  VKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYHHVDELPQG 123

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           +V+GT SLRR+  L  +R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+ E+ 
Sbjct: 124 AVVGTCSLRRQCQLKAYRPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLELEER 183

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I+  +  E   P+ GQGA+ IE   N+ +  +L++ +NH DT D V CERA    L+G C
Sbjct: 184 IRSFIEPEQSLPAVGQGAVGIECRTNDERILKLLEPLNHADTADRVKCERAMNLTLEGGC 243

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           +  I  +A  +G  ++   +V   DG         G R  A  +G   A  +     + +
Sbjct: 244 QVPIGSYALLEGDEIWLRALVGEPDGSEIVRGEIRGPRAQAEQLGVQLANQLLDEGAREI 303

Query: 305 F 305
            
Sbjct: 304 L 304


>gi|320154944|ref|YP_004187323.1| porphobilinogen deaminase [Vibrio vulnificus MO6-24/O]
 gi|319930256|gb|ADV85120.1| porphobilinogen deaminase [Vibrio vulnificus MO6-24/O]
          Length = 312

 Score =  288 bits (738), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 110/301 (36%), Positives = 167/301 (55%), Gaps = 2/301 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P RI TR SPLAL  A+  + +L   H  P   + ++ + TKGD I +  L ++GGKGLF
Sbjct: 6   PIRIATRKSPLALWQAYYVKDALQKAH--PGLEVELVTMVTKGDVILDTPLAKVGGKGLF 63

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T   + +L   
Sbjct: 64  VKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYHHVDELPQG 123

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           +V+GT SLRR+  L  +R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+ E+ 
Sbjct: 124 AVVGTCSLRRQCQLKAYRPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLELEER 183

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I+  +  E   P+ GQGA+ IE   N+ +  +L++ +NH DT D V CERA    L+G C
Sbjct: 184 IRSFIEPEQSLPAVGQGAVGIECRTNDERILKLLEPLNHTDTADRVKCERAMNLTLEGGC 243

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           +  I  +A  +G  ++   +V   DG         G R  A  +G   A  +     + +
Sbjct: 244 QVPIGSYALLEGDEIWLRALVGEPDGSEIVRGEIRGPRAQAEQLGVQLANQLLDEGAREI 303

Query: 305 F 305
            
Sbjct: 304 L 304


>gi|145300736|ref|YP_001143577.1| porphobilinogen deaminase [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|142853508|gb|ABO91829.1| porphobilinogen deaminase [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 315

 Score =  288 bits (738), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 105/305 (34%), Positives = 162/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  +I TR SPLAL  A   +  L  ++  P   + ++P+ST+GD+I +  L ++GG
Sbjct: 7   MAARTLKIATRKSPLALWQANFVKDRLEALY--PELQVELVPMSTQGDKILDTPLAKVGG 64

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL +     RED RD F+S+    ++ 
Sbjct: 65  KGLFVKELETAMLEGRADIAVHSMKDVPVEFPEGLGLHTICEREDPRDAFVSNRFSQIEA 124

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L   R D+ + D RG + TRL KL+  +  AI+LA AG+KRL+
Sbjct: 125 LPQGAVVGTSSLRRQCQLRAARPDLVIRDLRGNVNTRLAKLDAGEYDAIILAAAGLKRLE 184

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I   +  E   P+ GQGA+ IE  +++ +   L+  + H +T   V  ERA    L
Sbjct: 185 MAHRITAFIEPEQSLPANGQGAVGIECRLDDHELHTLLAPLEHAETRIRVLTERAMNRAL 244

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G  ++  G+V + DG         G   D   +G   AQ +    
Sbjct: 245 QGGCQVPIGAYALVQGDEVWLRGLVGSPDGSQVIHDEIRGPLADGEALGHTLAQRLLAAG 304

Query: 301 NKNVF 305
              + 
Sbjct: 305 ADVIL 309


>gi|114561627|ref|YP_749140.1| porphobilinogen deaminase [Shewanella frigidimarina NCIMB 400]
 gi|122300909|sp|Q088L3|HEM3_SHEFN RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|114332920|gb|ABI70302.1| porphobilinogen deaminase [Shewanella frigidimarina NCIMB 400]
          Length = 309

 Score =  288 bits (738), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 110/306 (35%), Positives = 171/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLA+  A   ++ L  +H  P   + ++P+STKGD I +  L +IGG
Sbjct: 1   MSENIIRIATRKSPLAMWQAEFVKAELERIH--PGLTVELLPMSTKGDVILDTPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++    D AVHS KD+P +  +GL +     RED RD F+S+  +S+ +
Sbjct: 59  KGLFVKELEVAMLENRADIAVHSMKDLPVEFPEGLGLQVICEREDPRDAFVSNNYKSISE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  +   R D+ + D RG + TRL KL++    AI+LA AG+ RLK
Sbjct: 119 LPQGAVVGTSSLRRQCQIRAARPDLVIKDLRGNVGTRLAKLDSGDYDAIILAAAGLIRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I   ++ E+  P+ GQGA+ IE   ++ + + L+  + H +T   V  ERA    L
Sbjct: 179 LNERIANFISAEESLPANGQGAVGIECRTDDARVKALLAPLEHLETRYRVLAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  FA   G  L   G+V   DG      + +G++ DA+ +G   A+ +    
Sbjct: 239 EGGCQVPIGAFAEINGDNLTLRGLVGNPDGSQIIIGTVSGSKTDAVALGESLAEDLLSRG 298

Query: 301 NKNVFN 306
            K + +
Sbjct: 299 AKTILD 304


>gi|260596029|ref|YP_003208600.1| porphobilinogen deaminase [Cronobacter turicensis z3032]
 gi|260215206|emb|CBA27057.1| Porphobilinogen deaminase [Cronobacter turicensis z3032]
          Length = 313

 Score =  288 bits (738), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 167/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  L   H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAQYVKQRLEACH--PGLTVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL +     RED RD F+S+  +SL +
Sbjct: 59  KGLFVKELELAMLDGRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNRYKSLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           +   S++GTSSLRR+  +   R D+ +   RG + TRL+KL+N    AI+LA AG+KRL+
Sbjct: 119 MPAGSIVGTSSLRRQCQIAARRPDLIIRSLRGNVGTRLSKLDNGDYDAIILAVAGLKRLQ 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I   L  E   P+ GQGA+ IE  +++ + +EL+  +NHE+T   V  ERA    L
Sbjct: 179 LDARITSPLAPEISLPAVGQGAVGIECRLDDTRTRELLAPLNHEETAVRVRAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  K   L+   +V A DG       R G   DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELKDGELWLRALVGAPDGSRIVRGERRGAPQDASQLGVSLAEELLNHG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|157377265|ref|YP_001475865.1| porphobilinogen deaminase [Shewanella sediminis HAW-EB3]
 gi|189028158|sp|A8G0W4|HEM3_SHESH RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|157319639|gb|ABV38737.1| Hydroxymethylbilane synthase [Shewanella sediminis HAW-EB3]
          Length = 309

 Score =  288 bits (738), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 112/306 (36%), Positives = 172/306 (56%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLAL  A   ++ L   H+     + ++P+STKGD I +  L ++GG
Sbjct: 1   MSQNVIRIATRKSPLALWQAEFVKAELEKFHE--GLTVELLPMSTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++    D AVHS KD+P    +GL +     RED RD F+S+  +++ +
Sbjct: 59  KGLFVKELEVAMLEDRADIAVHSMKDVPVDFPEGLGLEVICEREDPRDAFVSNNYKNISE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  +   R D+ + D RG + TRL KL+     AI+LA AG+KRLK
Sbjct: 119 LPQGAVVGTSSLRRQCQIRASRPDLVIRDLRGNVGTRLGKLDAGNYDAIILAAAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I   ++ E+  P+ GQGA+ IE  +N+ + + L+  + H +T   V  ERA    L
Sbjct: 179 LEERITSFISAEESLPANGQGAVGIECRINDERVKALLAPLEHTETRHRVIAERAMNTHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +  TL   G+V   DG    E ++ G++ DA  IG   A+ +    
Sbjct: 239 EGGCQVPIGAYAEIQDDTLTLRGLVGNPDGSHIIEATKVGSKTDAQAIGVALAEELLSKG 298

Query: 301 NKNVFN 306
            K + +
Sbjct: 299 AKAILD 304


>gi|148978777|ref|ZP_01815157.1| porphobilinogen deaminase [Vibrionales bacterium SWAT-3]
 gi|145962198|gb|EDK27482.1| porphobilinogen deaminase [Vibrionales bacterium SWAT-3]
          Length = 326

 Score =  288 bits (737), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 112/306 (36%), Positives = 173/306 (56%), Gaps = 3/306 (0%)

Query: 1   MEKK-PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M    P RI TR SPLAL  A+  R +L   H  P   + ++ + TKGD I +  L ++G
Sbjct: 15  MTNSAPIRIATRKSPLALWQAYFVRDALQAAH--PGLEVELVTMVTKGDIILDTPLAKVG 72

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T  ++ 
Sbjct: 73  GKGLFVKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYNNID 132

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           +L   +V+GT SLRR+  LL +R D+ + + RG + TRL KL++ +  AI+LA AG+KRL
Sbjct: 133 ELPQGAVVGTCSLRRQCQLLEYRPDLIIKELRGNVGTRLGKLDDGQYDAIVLAAAGLKRL 192

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
           + E+ I+  +  E   P+ GQGA+ IE  +++ +  +L++ +NH+DT D V CERA    
Sbjct: 193 ELEERIRSFIEPEQSLPAVGQGAVGIECRLDDERLIKLLEPLNHQDTADRVLCERAMNLT 252

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I  ++   G  ++   +V   DG        +G R DA  +G   A  +   
Sbjct: 253 LEGGCQVPIGSYSLLDGDNIWLRALVGEPDGSKMVRGEISGPRKDAEALGVTLANQLLDD 312

Query: 300 SNKNVF 305
             + + 
Sbjct: 313 GAREIL 318


>gi|322834934|ref|YP_004214961.1| porphobilinogen deaminase [Rahnella sp. Y9602]
 gi|321170135|gb|ADW75834.1| porphobilinogen deaminase [Rahnella sp. Y9602]
          Length = 313

 Score =  288 bits (736), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 118/305 (38%), Positives = 171/305 (56%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +S LM  H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAQYVQSRLMACH--PGLQVELVPMVTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL +     RED RD F+S+   SL D
Sbjct: 59  KGLFVKELELAMLDGRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNQYASLAD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L + R D+ + D RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPQGSIVGTSSLRRQCQLRQKRPDLMIRDLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   L  E+  P+ GQGA+ IE  +++   ++L+  + H +T   V  ERA    L
Sbjct: 179 LENRITYALTPEECLPAVGQGAVGIECRLDDQTTRDLLAPLAHRETTLRVQAERAMNMRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +G  L+   +V A DG       R G   +A  +G D A+ +    
Sbjct: 239 EGGCQVPIGSYAELEGDELWLRALVGAPDGSQMVCGERRGPAANAHRMGVDLAEELLANG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|127511252|ref|YP_001092449.1| porphobilinogen deaminase [Shewanella loihica PV-4]
 gi|126636547|gb|ABO22190.1| porphobilinogen deaminase [Shewanella loihica PV-4]
          Length = 317

 Score =  288 bits (736), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 111/306 (36%), Positives = 171/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLA+  A   ++ L   H+     + ++P+STKGD I +  L ++GG
Sbjct: 9   MSQNVIRIATRKSPLAMWQAEFVKAELEKAHE--GLVVELLPMSTKGDVILDTPLAKVGG 66

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G+ D AVHS KD+P    +GL +     RED RD F+S+T +++++
Sbjct: 67  KGLFVKELEVAMLEGKADIAVHSMKDVPVDFPEGLGLQVICEREDPRDAFVSNTYKNIEE 126

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  +   R D+ + D RG + TRL KL+     AI+LA AG+KRLK
Sbjct: 127 LPQGAIVGTSSLRRQCQIRAARPDLEIRDLRGNVGTRLAKLDAGNYDAIILAAAGLKRLK 186

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++ ED  P+ GQGA+ IE   ++ + + L+  + H +T   V  ERA    L
Sbjct: 187 LEDRIASFISAEDSLPANGQGAVGIECRTDDERVKALLAPLEHIETRYRVIAERAMNTRL 246

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A   G TL   G+V   DG      + +G + DA  +G   A  +    
Sbjct: 247 EGGCQVPIGAYAEIDGDTLSLRGLVGNPDGSQVIRGTTSGAKQDAEQLGIALADELLSKG 306

Query: 301 NKNVFN 306
            K + +
Sbjct: 307 AKAILD 312


>gi|229520088|ref|ZP_04409516.1| porphobilinogen deaminase [Vibrio cholerae TM 11079-80]
 gi|229342876|gb|EEO07866.1| porphobilinogen deaminase [Vibrio cholerae TM 11079-80]
          Length = 317

 Score =  288 bits (736), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 113/306 (36%), Positives = 167/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 7   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDAILDTPLAKVGG 64

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T   ++D
Sbjct: 65  KGLFVKELEIAMLEGRADLAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNTYAKIED 124

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 125 LPSGAIVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 184

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  VN+ + + L+  +NH DT D V CERA    L
Sbjct: 185 LESRIRSFIEPEQSLPAVGQGAVGIECRVNDQRVRALLAPLNHADTADRVRCERAMNLTL 244

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G  ++   +V   DG         G R  A  +G   A+ +    
Sbjct: 245 QGGCQVPIGSYALLEGDHIWLRALVGEPDGSQIVRGEIRGPRTQAEQLGITLAEQLLSQG 304

Query: 301 NKNVFN 306
            K +  
Sbjct: 305 AKEILE 310


>gi|323495298|ref|ZP_08100379.1| porphobilinogen deaminase [Vibrio brasiliensis LMG 20546]
 gi|323310475|gb|EGA63658.1| porphobilinogen deaminase [Vibrio brasiliensis LMG 20546]
          Length = 312

 Score =  288 bits (736), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 111/306 (36%), Positives = 170/306 (55%), Gaps = 3/306 (0%)

Query: 1   MEKK-PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M +  P RI TR SPLAL  A   + +L   H  P   + ++ + TKGD I +  L ++G
Sbjct: 1   MTQTTPIRIATRKSPLALWQAHFVKDALQAAH--PGLEVELVTMVTKGDIILDTPLAKVG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T  S+ 
Sbjct: 59  GKGLFVKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYNSID 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           +L   +V+GT SLRR+  +   R D+ + + RG + TRL KL+     AI+LA AG+KRL
Sbjct: 119 ELPQGAVVGTCSLRRQCQIKEARPDLIIKELRGNVGTRLGKLDAGDYDAIILAAAGLKRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
           + E+ IK  +  E   P+ GQGA+ IE  +++ +  +L++ +NH++T D V CERA    
Sbjct: 179 ELEERIKSFIEPEQSLPAVGQGAVGIECRLDDDRLIKLLEPLNHKETADRVLCERAMNLT 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I  ++   G  ++   +V   DG         G+R DA  +G + A  +   
Sbjct: 239 LEGGCQVPIGSYSLIDGDNIWLRALVGEPDGSKIVRGEIRGSRTDAEALGVELANQLLAD 298

Query: 300 SNKNVF 305
             K + 
Sbjct: 299 GAKEIL 304


>gi|149191476|ref|ZP_01869725.1| porphobilinogen deaminase [Vibrio shilonii AK1]
 gi|148834664|gb|EDL51652.1| porphobilinogen deaminase [Vibrio shilonii AK1]
          Length = 329

 Score =  288 bits (736), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 111/307 (36%), Positives = 171/307 (55%), Gaps = 3/307 (0%)

Query: 1   MEK-KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M + +P RI TR SPLAL  A   + +L+  H  P   + ++ + TKGD I +  L ++G
Sbjct: 18  MTQTQPIRIATRKSPLALWQAHYVKDALIAAH--PGLEVELVTMVTKGDIILDTPLAKVG 75

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T  ++ 
Sbjct: 76  GKGLFVKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYTNIS 135

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           +L   +V+GT SLRR+  L   R D+ + + RG + TRL KL+N +  AI+LA AG+KRL
Sbjct: 136 ELPQGAVVGTCSLRRQCQLKEQRPDLVIKELRGNVGTRLGKLDNGEYDAIILAAAGLKRL 195

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
           + E  I+  +  E+  P+ GQGA+ IE  +++ +  +L++ +NH +T D V CERA    
Sbjct: 196 ELESRIRSFIEPEESLPAVGQGAVGIECRLDDERLIKLLEPLNHTNTADRVLCERAMNLT 255

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I  ++   G  ++   +V   DG         G R DA  +G   A  +   
Sbjct: 256 LEGGCQVPIGSYSLIDGDEIWLRALVGEPDGSKIVRGEIRGKRADAEALGVQLANQLLND 315

Query: 300 SNKNVFN 306
             K +  
Sbjct: 316 GAKEILE 322


>gi|51594540|ref|YP_068731.1| porphobilinogen deaminase [Yersinia pseudotuberculosis IP 32953]
 gi|186893538|ref|YP_001870650.1| porphobilinogen deaminase [Yersinia pseudotuberculosis PB1/+]
 gi|61213379|sp|Q66G00|HEM3_YERPS RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|238059007|sp|B2K065|HEM3_YERPB RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|51587822|emb|CAH19424.1| porphobilinogen deaminase [Yersinia pseudotuberculosis IP 32953]
 gi|186696564|gb|ACC87193.1| porphobilinogen deaminase [Yersinia pseudotuberculosis PB1/+]
          Length = 313

 Score =  288 bits (736), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 118/305 (38%), Positives = 166/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P   I ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQHLLQANH--PGLQIELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL + A   RED RD F+S     L D
Sbjct: 59  KGLFVKELELALLDGRADIAVHSMKDVPIAFPEGLGLVAICEREDPRDAFVSSHYAHLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+ + D RG + TRL KL+N    AI+LA AG+KRL 
Sbjct: 119 LPAGSVVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDNGDYQAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  ++ E+  P+ GQGA+ IE  +++   ++L+  +NH  T   V  ERA    L
Sbjct: 179 LETRIRYAMSAEESLPAVGQGAVGIECRLDDDHTRQLLAPLNHRHTELRVCAERAMNIRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +G TL+   +V A DG       R G   +A  +G + A  +    
Sbjct: 239 EGGCQVPIGSYAELEGDTLWLRALVGAPDGSQMIRGERRGPAAEAEQMGIELADELLSRG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|254226598|ref|ZP_04920179.1| porphobilinogen deaminase [Vibrio cholerae V51]
 gi|125620870|gb|EAZ49223.1| porphobilinogen deaminase [Vibrio cholerae V51]
          Length = 317

 Score =  288 bits (736), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 112/306 (36%), Positives = 167/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 7   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDVILDTPLAKVGG 64

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T   ++D
Sbjct: 65  KGLFVKELEIAMLEGRADLAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNTYAKIED 124

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 125 LPSGAIVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 184

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  V++ + + L+  +NH DT D V CERA    L
Sbjct: 185 LESRIRSFIEPEQSLPAVGQGAVGIECRVDDQRVRALLTPLNHADTADRVRCERAMNLTL 244

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G  ++   +V   DG         G R  A  +G   A+ +    
Sbjct: 245 QGGCQVPIGSYALLEGDHIWLRALVGEPDGSQIVRGEIRGPRTQAEQLGITLAEQLLSQG 304

Query: 301 NKNVFN 306
            K +  
Sbjct: 305 AKEILE 310


>gi|269961540|ref|ZP_06175903.1| porphobilinogen deaminase [Vibrio harveyi 1DA3]
 gi|269833769|gb|EEZ87865.1| porphobilinogen deaminase [Vibrio harveyi 1DA3]
          Length = 312

 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 111/306 (36%), Positives = 173/306 (56%), Gaps = 3/306 (0%)

Query: 1   MEK-KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M +  P RI TR SPLAL  A   + +L   H  P   + ++ + TKGD I +  L ++G
Sbjct: 1   MTQSTPIRIATRKSPLALWQAHYVKDALQAAH--PGLEVELVTMVTKGDIILDTPLAKVG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T  ++ 
Sbjct: 59  GKGLFVKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYNNID 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           +L   +V+GT SLRR+  L  +R D+ + + RG + TRL KL+  +  AI+LA AG+KRL
Sbjct: 119 ELPQGAVVGTCSLRRQCQLKEYRPDLVIKELRGNVGTRLGKLDAGEYDAIILAAAGLKRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
           + E+ I+  +  E   P+ GQGA+ IE  V++ +  +L++ +NH+DT D V CERA    
Sbjct: 179 ELEERIRSFIEPEQSLPAVGQGAVGIECRVDDERLLKLLEPLNHQDTADRVRCERAMNLT 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I  ++   G  ++   +V   DG +       G+R DA  +G   A  +   
Sbjct: 239 LEGGCQVPIGSYSLLDGDNIWLRALVGEPDGSLIVRGEIRGHRNDAEALGVQLANELLEN 298

Query: 300 SNKNVF 305
             +++ 
Sbjct: 299 GARDIL 304


>gi|251787830|ref|YP_003002551.1| porphobilinogen deaminase [Dickeya zeae Ech1591]
 gi|247536451|gb|ACT05072.1| porphobilinogen deaminase [Dickeya zeae Ech1591]
          Length = 322

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 115/305 (37%), Positives = 169/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  L D H  P   + ++P+ T+GD + +  L ++GG
Sbjct: 11  MVDTILRIATRQSPLALWQAHFVKQRLEDCH--PGLQVELVPMVTRGDVLLDTPLAKVGG 68

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     R+D RD F+S+   +L D
Sbjct: 69  KGLFVKELELALLENRADIAVHSMKDVPVEFPEGLGLVTICERDDPRDAFVSNHYATLDD 128

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +GTSSLRR+  L  +R D+ V D RG + TRL+KL+N    AI+LA AG+KRL 
Sbjct: 129 LPEGACVGTSSLRRQCQLRAYRPDLVVRDLRGNVGTRLSKLDNGDYDAIILAVAGLKRLG 188

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I+  L+ E   P+ GQGA+ +E  +++ + + L+  +NHEDT   V  ERA    L
Sbjct: 189 LAHRIRTALSPEQSLPAVGQGAVGVECRLDDARTRALLAPLNHEDTATRVLAERAMNTRL 248

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +  TLY   +V A DG       R G+R DA  +G   A  +    
Sbjct: 249 EGGCQVPIGSYAELQDETLYLRALVGAPDGSRIIYAERRGSRQDAETLGIALADELLERG 308

Query: 301 NKNVF 305
            +++ 
Sbjct: 309 ARDIL 313


>gi|238798585|ref|ZP_04642061.1| Porphobilinogen deaminase [Yersinia mollaretii ATCC 43969]
 gi|238717541|gb|EEQ09381.1| Porphobilinogen deaminase [Yersinia mollaretii ATCC 43969]
          Length = 313

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 115/305 (37%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQHLLQANH--PGLQVELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     R+D RD F+S     L D
Sbjct: 59  KGLFVKELELALLDGRADIAVHSMKDVPIAFPEGLGLVTICERDDPRDAFVSSHYAHLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ + D RG + TRL KL+N   HAI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDNGDYHAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E+  P+ GQGA+ IE  +++   ++L+  +NH DT   V  ERA    L
Sbjct: 179 LETRIRYAMPAEESLPAVGQGAVGIECRLDDDVTRQLLAPLNHRDTELRVCAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A   G  L+   +V A DG       R G   +A  +G + A  +    
Sbjct: 239 EGGCQVPIGSYAELAGGELWLRALVGAPDGSEIIRGERRGPAENAEQMGIELADELLSRG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|167625822|ref|YP_001676116.1| porphobilinogen deaminase [Shewanella halifaxensis HAW-EB4]
 gi|189028156|sp|B0TJ54|HEM3_SHEHH RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|167355844|gb|ABZ78457.1| porphobilinogen deaminase [Shewanella halifaxensis HAW-EB4]
          Length = 310

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 113/306 (36%), Positives = 175/306 (57%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLA+  A   ++ L  +H+     + ++P+STKGD I +  L ++GG
Sbjct: 1   MSQNLIRIATRKSPLAMWQAEFVKAELEKIHE--GLTVELLPMSTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G+ D AVHS KD+P +  +GL +     RED RD F+S+T ++++D
Sbjct: 59  KGLFVKELEVAMLEGKADIAVHSMKDVPVEFPEGLGLEVICEREDPRDAFVSNTYKTIED 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  +   R D+ + D RG + TRL KL+     AI+LA AG+KRLK
Sbjct: 119 LPQGAVVGTSSLRRQCQIRAARPDLVIKDLRGNVGTRLAKLDAGNYDAIILAAAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I   ++ E   P+ GQGA+ IE   ++ + + L+  + H +T   V  ERA    L
Sbjct: 179 LEERIASFISAEQSLPANGQGAVGIECRTDDARVKALLAPLEHAETRMRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A   G TL   G+V   DG      + +GN+ DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGAYAEIDGDTLSLRGLVGNPDGSQIITAASSGNKADAEKLGVALAEELLAKG 298

Query: 301 NKNVFN 306
            K + +
Sbjct: 299 AKTILD 304


>gi|153835503|ref|ZP_01988170.1| porphobilinogen deaminase [Vibrio harveyi HY01]
 gi|156972662|ref|YP_001443569.1| porphobilinogen deaminase [Vibrio harveyi ATCC BAA-1116]
 gi|166217790|sp|A7MXU9|HEM3_VIBHB RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|148867929|gb|EDL67139.1| porphobilinogen deaminase [Vibrio harveyi HY01]
 gi|156524256|gb|ABU69342.1| hypothetical protein VIBHAR_00314 [Vibrio harveyi ATCC BAA-1116]
          Length = 312

 Score =  287 bits (734), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 111/306 (36%), Positives = 173/306 (56%), Gaps = 3/306 (0%)

Query: 1   MEK-KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M +  P RI TR SPLAL  A   + +L   H  P   + ++ + TKGD I +  L ++G
Sbjct: 1   MTQSTPIRIATRKSPLALWQAHFVKDALQAAH--PGLEVELVTMVTKGDIILDTPLAKVG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T  ++ 
Sbjct: 59  GKGLFVKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYNNID 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           +L   +V+GT SLRR+  L  +R D+ + + RG + TRL KL+  +  AI+LA AG+KRL
Sbjct: 119 ELPQGAVVGTCSLRRQCQLKEYRPDLVIKELRGNVGTRLGKLDAGEYDAIILAAAGLKRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
           + E+ I+  +  E   P+ GQGA+ IE  V++ +  +L++ +NH+DT D V CERA    
Sbjct: 179 ELEERIRSFIEPEQSLPAVGQGAVGIECRVDDERLLKLLEPLNHQDTADRVRCERAMNLT 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I  ++   G  ++   +V   DG +       G+R DA  +G   A  +   
Sbjct: 239 LEGGCQVPIGSYSLLDGDNIWLRALVGEPDGSLIVRGEIRGHRNDAEALGVQLANELLEN 298

Query: 300 SNKNVF 305
             +++ 
Sbjct: 299 GARDIL 304


>gi|109896672|ref|YP_659927.1| porphobilinogen deaminase [Pseudoalteromonas atlantica T6c]
 gi|123065108|sp|Q15Z15|HEM3_PSEA6 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|109698953|gb|ABG38873.1| hydroxymethylbilane synthase [Pseudoalteromonas atlantica T6c]
          Length = 309

 Score =  287 bits (734), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 176/305 (57%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LA+  A   ++ L++ H  P   + ++P+ST+GDRI +  L +IGG
Sbjct: 1   MSDRVIRIATRKSALAMWQAEYVQAKLLEAH--PQLKVELVPMSTQGDRILDTPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  +  G  D AVHS KD+P     G  +     RE+  D F+S+T  S+++
Sbjct: 59  KGLFIKELEVAMSEGRADIAVHSMKDVPVDFPAGFGLHCICERENPYDAFVSNTYASIEE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  +   R D+++ D RG + TRL KL++ +  AI+LA AG+ RL+
Sbjct: 119 LPQGAIVGTSSLRRQCQIRSARPDLTIRDLRGNVNTRLAKLDDGQYDAIILAAAGLIRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  IK  +      P+ GQGA+ IE   ++ +  EL+K +NH DT   V  ERA  A+L
Sbjct: 179 MQDRIKTYIEPTVSLPAVGQGAVGIECRNDDAELIELLKPLNHSDTESRVKAERAMNAKL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A   G  LY  G+V + DG +  +  + GN  DA++IG D A+ +    
Sbjct: 239 NGGCQVPIGSYAVLNGDELYLRGLVGSPDGSVLLQAEKRGNVNDALSIGVDVAEQLLEKG 298

Query: 301 NKNVF 305
             ++ 
Sbjct: 299 AGDIL 303


>gi|108806170|ref|YP_650086.1| porphobilinogen deaminase [Yersinia pestis Antiqua]
 gi|108810280|ref|YP_646047.1| porphobilinogen deaminase [Yersinia pestis Nepal516]
 gi|145600717|ref|YP_001164793.1| porphobilinogen deaminase [Yersinia pestis Pestoides F]
 gi|153949991|ref|YP_001399195.1| porphobilinogen deaminase [Yersinia pseudotuberculosis IP 31758]
 gi|153997095|ref|ZP_02022228.1| porphobilinogen deaminase [Yersinia pestis CA88-4125]
 gi|161484901|ref|NP_667719.2| porphobilinogen deaminase [Yersinia pestis KIM 10]
 gi|161511325|ref|NP_994488.2| porphobilinogen deaminase [Yersinia pestis biovar Microtus str.
           91001]
 gi|165926233|ref|ZP_02222065.1| porphobilinogen deaminase [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165939151|ref|ZP_02227702.1| porphobilinogen deaminase [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166011678|ref|ZP_02232576.1| porphobilinogen deaminase [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166213633|ref|ZP_02239668.1| porphobilinogen deaminase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167401822|ref|ZP_02307310.1| porphobilinogen deaminase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167421084|ref|ZP_02312837.1| porphobilinogen deaminase [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167426299|ref|ZP_02318052.1| porphobilinogen deaminase [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|167470637|ref|ZP_02335341.1| porphobilinogen deaminase [Yersinia pestis FV-1]
 gi|218930852|ref|YP_002348727.1| porphobilinogen deaminase [Yersinia pestis CO92]
 gi|229837182|ref|ZP_04457347.1| hydroxymethylbilane synthase [Yersinia pestis Pestoides A]
 gi|229839542|ref|ZP_04459701.1| hydroxymethylbilane synthase [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229900105|ref|ZP_04515242.1| hydroxymethylbilane synthase [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229900449|ref|ZP_04515578.1| hydroxymethylbilane synthase [Yersinia pestis Nepal516]
 gi|270488804|ref|ZP_06205878.1| hydroxymethylbilane synthase [Yersinia pestis KIM D27]
 gi|294505512|ref|YP_003569574.1| porphobilinogen deaminase [Yersinia pestis Z176003]
 gi|17380441|sp|P46355|HEM3_YERPE RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|122979815|sp|Q1CBN1|HEM3_YERPA RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|123373560|sp|Q1CNI3|HEM3_YERPN RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|158514109|sp|A4TRA8|HEM3_YERPP RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|167008820|sp|A7FD67|HEM3_YERP3 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|108773928|gb|ABG16447.1| hydroxymethylbilane synthase [Yersinia pestis Nepal516]
 gi|108778083|gb|ABG12141.1| hydroxymethylbilane synthase [Yersinia pestis Antiqua]
 gi|115349463|emb|CAL22436.1| porphobilinogen deaminase [Yersinia pestis CO92]
 gi|145212413|gb|ABP41820.1| hydroxymethylbilane synthase [Yersinia pestis Pestoides F]
 gi|149289401|gb|EDM39479.1| porphobilinogen deaminase [Yersinia pestis CA88-4125]
 gi|152961486|gb|ABS48947.1| porphobilinogen deaminase [Yersinia pseudotuberculosis IP 31758]
 gi|165912924|gb|EDR31550.1| porphobilinogen deaminase [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165921757|gb|EDR38954.1| porphobilinogen deaminase [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165989447|gb|EDR41748.1| porphobilinogen deaminase [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166205306|gb|EDR49786.1| porphobilinogen deaminase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166961213|gb|EDR57234.1| porphobilinogen deaminase [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167048715|gb|EDR60123.1| porphobilinogen deaminase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167054818|gb|EDR64622.1| porphobilinogen deaminase [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|229682468|gb|EEO78555.1| hydroxymethylbilane synthase [Yersinia pestis Nepal516]
 gi|229686885|gb|EEO78964.1| hydroxymethylbilane synthase [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229695908|gb|EEO85955.1| hydroxymethylbilane synthase [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229706125|gb|EEO92134.1| hydroxymethylbilane synthase [Yersinia pestis Pestoides A]
 gi|262363578|gb|ACY60299.1| porphobilinogen deaminase [Yersinia pestis D106004]
 gi|262367506|gb|ACY64063.1| porphobilinogen deaminase [Yersinia pestis D182038]
 gi|270337308|gb|EFA48085.1| hydroxymethylbilane synthase [Yersinia pestis KIM D27]
 gi|294355971|gb|ADE66312.1| porphobilinogen deaminase [Yersinia pestis Z176003]
 gi|320013550|gb|ADV97121.1| hydroxymethylbilane synthase [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 313

 Score =  287 bits (734), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 117/305 (38%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P   I ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQHLLQANH--PGLQIELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     RED RD F+S     L D
Sbjct: 59  KGLFVKELELALLDGRADIAVHSMKDVPIAFPEGLGLVTICEREDPRDAFVSSHYAHLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+ + D RG + TRL KL+N    AI+LA AG+KRL 
Sbjct: 119 LPAGSVVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDNGDYQAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  ++ E+  P+ GQGA+ IE  +++   ++L+  +NH  T   V  ERA    L
Sbjct: 179 LENRIRYAMSAEESLPAVGQGAVGIECRLDDDHTRQLLAPLNHRHTELRVCAERAMNIRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +G TL+   +V A DG       R G   +A  +G + A  +    
Sbjct: 239 EGGCQVPIGSYAELEGDTLWLRALVGAPDGSQMIRGERRGPAAEAEQMGIELADELLSRG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|254490211|ref|ZP_05103401.1| porphobilinogen deaminase [Methylophaga thiooxidans DMS010]
 gi|224464558|gb|EEF80817.1| porphobilinogen deaminase [Methylophaga thiooxydans DMS010]
          Length = 309

 Score =  287 bits (733), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 107/305 (35%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M K+  RI TR SPLA+  A   + SL+ +H  P   + ++ + T+GD I +  L ++GG
Sbjct: 1   MSKRTVRIATRNSPLAVWQAEFVKDSLLALH--PDLTVELVKMKTQGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ ++ G  D AVHS KD+P +  +GL +     RED  D F+S+  Q++ D
Sbjct: 59  KGLFVKELEQGMLDGRADIAVHSMKDVPVEFPEGLHLPVICKREDPHDAFVSNHYQTIDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +GTSSLRR+      R D+ V+  RG + TRL KL+  +  AI+LA AG+KRL 
Sbjct: 119 LPHGARLGTSSLRRECQARTHRPDLEVLPLRGNVNTRLRKLDEGQFDAIILAMAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I+  L  E   P+ GQGA+ IET +++ +   L+  ++   T   +  ERA    L
Sbjct: 179 FDDRIRSALTPEQSLPAIGQGALGIETRIDDDEMNALIAPLHCPQTAIVLTAERALNRRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  IAG+A  +G  ++  G+V   DG         G   DA  +G   A+ +    
Sbjct: 239 SGGCQVPIAGYAMLEGDEVWLRGLVGRPDGTNTLYADVRGAAKDADKLGVQIAETLLTKG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 ADKIL 303


>gi|307942602|ref|ZP_07657950.1| porphobilinogen deaminase [Roseibium sp. TrichSKD4]
 gi|307774241|gb|EFO33454.1| porphobilinogen deaminase [Roseibium sp. TrichSKD4]
          Length = 307

 Score =  287 bits (733), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 142/305 (46%), Positives = 197/305 (64%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+    RIGTR S LALA A ETR  LM  H +P     I+ + T GD+I +R L+E+GG
Sbjct: 1   MQSTLLRIGTRGSQLALAQAHETRDRLMAAHGLPEDAFEIVVVKTSGDQIQDRPLSEVGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE  L+ G +D AVHS+KDMPT L  GL I+A+LPRED+RD FIS  A++L+D
Sbjct: 61  KGLFTKEIEDMLLDGSLDLAVHSSKDMPTVLPAGLDITAFLPREDVRDAFISPKAKTLRD 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+G+SSLRR+A++ R R DI V+ +RG ++TRL KL+     A LLA+AG+KRL 
Sbjct: 121 LPHGAVVGSSSLRRQAMVKRLRPDIDVVMYRGNVQTRLRKLDEGVVDATLLAHAGLKRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
              V+  ++  +DF P+ GQGAIC+E+ +++ K   L+  IN  +T   +  ERAFL  L
Sbjct: 181 LGDVVTSVIEADDFVPAVGQGAICLESRLDDEKTNGLLSAINDPETRVRLEAERAFLGVL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DG+C++ I G A   G TL   G++L  DG   HEV  +G+  DA  IG  A + ++  +
Sbjct: 241 DGTCRTPIGGLATVDGDTLTLKGVILKPDGSQMHEVEHSGSVQDAEAIGLAAGEELKSKA 300

Query: 301 NKNVF 305
             N  
Sbjct: 301 GPNFL 305


>gi|162419364|ref|YP_001605129.1| porphobilinogen deaminase [Yersinia pestis Angola]
 gi|238059008|sp|A9R8K0|HEM3_YERPG RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|162352179|gb|ABX86127.1| porphobilinogen deaminase [Yersinia pestis Angola]
          Length = 313

 Score =  287 bits (733), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 117/305 (38%), Positives = 166/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P   I ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQHLLQANH--PGLQIELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     RED RD F+S     L D
Sbjct: 59  KGLFVKELELALLDGRADIAVHSMKDVPIAFPEGLGLVTICEREDPRDAFVSSHYAHLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+ + D RG + TRL KL+N    AI+LA AG+KRL 
Sbjct: 119 LPAGSVVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDNGDYQAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  ++ E+  P+ GQGA+ IE  +++   ++L+  +NH  T   V  ERA    L
Sbjct: 179 LENRIRYAMSAEESLPAVGQGAVGIECRLDDDHTRQLLAPLNHRHTELRVCAERAMNIRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +G TL+   +V A DG       R G   +A  +G + A  +  + 
Sbjct: 239 EGGCQVPIGSYAELEGDTLWLRALVGAPDGSQMIRGERRGPAAEAEQMGIELADELLSLG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|312884198|ref|ZP_07743909.1| porphobilinogen deaminase [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309368126|gb|EFP95667.1| porphobilinogen deaminase [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 312

 Score =  287 bits (733), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 111/304 (36%), Positives = 168/304 (55%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           +  P RI TR SPLAL  A   + +L+  H  P   + +I + TKGD I +  L ++GGK
Sbjct: 3   KSTPIRIATRKSPLALWQANYVKEALIKAH--PGLQVELITMVTKGDIILDTPLAKVGGK 60

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  ++ G  D AVHS KD+P    KGL +     RED RD F+S+  Q++  L
Sbjct: 61  GLFVKELENAMLEGRADLAVHSMKDVPVDFPKGLGLVTICEREDPRDAFVSNHYQNIDAL 120

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
             ++++GT SLRR+  +  +R D+ V + RG + TRLNKL+  +  AI+LA AG+KRL  
Sbjct: 121 PNNAIVGTCSLRRQCQIKEYRPDLIVKELRGNVGTRLNKLDAGEYDAIILAAAGLKRLGL 180

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E  I   L  E   P+ GQGA+ IE  +++ +  +L+  +N  DT D V CERA    L+
Sbjct: 181 ESRIASFLEPEQSLPAVGQGAVGIECRLDDQRLIDLLAPLNDRDTNDRVKCERAMNLTLE 240

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I  ++  +G  ++   +V   DG         G R DA  +G + A  +     
Sbjct: 241 GGCQVPIGSYSVLEGEQIWLRALVGEPDGSQMVRGEIRGKRDDAEQLGIELANQLLDKGA 300

Query: 302 KNVF 305
           +++ 
Sbjct: 301 RDIL 304


>gi|332304814|ref|YP_004432665.1| porphobilinogen deaminase [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332172143|gb|AEE21397.1| porphobilinogen deaminase [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 309

 Score =  286 bits (732), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 174/305 (57%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LA+  A   ++ L++ H  P   + ++P+ST+GDRI +  L +IGG
Sbjct: 1   MSDRVIRIATRKSTLAMWQAEYVQAKLLEAH--PQLKVELVPMSTQGDRILDTPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  +  G  D AVHS KD+P     G  +     RE+  D F+S+T  ++++
Sbjct: 59  KGLFIKELEIAMSEGRADIAVHSMKDVPVDFPDGFGLHCICERENPYDAFVSNTYSAIEE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  +   R D+++ D RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPQGAVVGTSSLRRQCQIRSARPDLTIRDLRGNVNTRLAKLDEGQYDAIILAAAGLIRLN 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            ++ IK  +      P+ GQGA+ IE   ++ +  EL+K +NH DT   V  ERA  A+L
Sbjct: 179 MQERIKAYIEPTVSLPAVGQGAVGIECRNDDAELIELLKPLNHADTESRVKAERAMNAKL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A   G  LY  G+V + DG +  +  + G+  DA +IG D A+ +    
Sbjct: 239 NGGCQVPIGSYAVLNGDELYLRGLVGSPDGSLLLQAEKRGSINDAQSIGIDVAEQLLEKG 298

Query: 301 NKNVF 305
             ++ 
Sbjct: 299 AGDIL 303


>gi|194438640|ref|ZP_03070728.1| porphobilinogen deaminase [Escherichia coli 101-1]
 gi|194422444|gb|EDX38443.1| porphobilinogen deaminase [Escherichia coli 101-1]
          Length = 318

 Score =  286 bits (732), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 6   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 63

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   +L  
Sbjct: 64  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDNLDA 123

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 124 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 183

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 184 LESRIRAALPPEISLPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAMNTRL 243

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 244 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 303

Query: 301 NKNVF 305
            + + 
Sbjct: 304 AREIL 308


>gi|254163746|ref|YP_003046854.1| porphobilinogen deaminase [Escherichia coli B str. REL606]
 gi|242379335|emb|CAQ34146.1| hydroxymethylbilane synthase [Escherichia coli BL21(DE3)]
 gi|253975647|gb|ACT41318.1| porphobilinogen deaminase [Escherichia coli B str. REL606]
 gi|253979803|gb|ACT45473.1| porphobilinogen deaminase [Escherichia coli BL21(DE3)]
 gi|323959059|gb|EGB54728.1| porphobilinogen deaminase [Escherichia coli H489]
 gi|323969355|gb|EGB64654.1| porphobilinogen deaminase [Escherichia coli TA007]
          Length = 313

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   +L  
Sbjct: 59  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDNLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 179 LESRIRAALPPEISLPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|271502386|ref|YP_003335412.1| porphobilinogen deaminase [Dickeya dadantii Ech586]
 gi|270345941|gb|ACZ78706.1| porphobilinogen deaminase [Dickeya dadantii Ech586]
          Length = 312

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 114/305 (37%), Positives = 167/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  L   H  P   + ++P+ T+GD + +  L ++GG
Sbjct: 1   MVDTILRIATRQSPLALWQAHFVQQRLEACH--PGLRVELVPMVTRGDVLLDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     R+D RD F+S+   +L D
Sbjct: 59  KGLFVKELELALLENRADIAVHSMKDVPVEFPEGLGLVTICERDDPRDAFVSNNYATLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +GTSSLRR+  L   R D+ V D RG + TRL+KL+N    AI+LA AG+KRL 
Sbjct: 119 LPEGACVGTSSLRRQCQLRAHRPDLVVRDLRGNVGTRLSKLDNGDYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L+ E   P+ GQGA+ +E  +++ + + L+  +NH+DT   V  ERA    L
Sbjct: 179 LENRIRTALSPEQSLPAVGQGAVGVECRLDDARTRALLAPLNHDDTATRVLAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +  TLY   +V A DG       R G R DA  +G   A  +    
Sbjct: 239 EGGCQVPIGSYAELQDDTLYLRALVGAPDGSRIIYAERRGPRQDAEALGIGLADELLERG 298

Query: 301 NKNVF 305
            +++ 
Sbjct: 299 ARDIL 303


>gi|253690341|ref|YP_003019531.1| porphobilinogen deaminase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259646261|sp|C6DHC2|HEM3_PECCP RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|251756919|gb|ACT14995.1| porphobilinogen deaminase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 313

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 119/305 (39%), Positives = 170/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  L   H  P  ++ ++P+ T+GD I +  L ++GG
Sbjct: 1   MLANIIRIATRQSPLALWQARYVQQCL--NHLYPDLHVELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P +   GL ++    R+D RD F+S+   SL+ 
Sbjct: 59  KGLFVKELELALLEGRADIAVHSMKDVPVEFPDGLGLTTICERDDPRDAFVSNRYDSLEQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S +GTSSLRR+  L   R D+ + D RG + TRL KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPEGSCVGTSSLRRQCQLRARRPDLVIRDLRGNVGTRLAKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I+  L+ E+  P+ GQGAI IE  +N+ + ++L+  +NH  T   V  ERA    L
Sbjct: 179 LEERIRCALSPEESLPAVGQGAIGIECRLNDDRIRQLLAPLNHPATAARVQAERAMNVRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +G TL+   +V A DG       R GN  DA  IG   A+ +    
Sbjct: 239 EGGCQVPIGSYAELEGDTLWLRALVGAPDGSQMIVGERRGNVSDAEQIGIALAEELLAKG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 ASAIL 303


>gi|163803631|ref|ZP_02197496.1| porphobilinogen deaminase [Vibrio sp. AND4]
 gi|159172579|gb|EDP57439.1| porphobilinogen deaminase [Vibrio sp. AND4]
          Length = 312

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 111/306 (36%), Positives = 173/306 (56%), Gaps = 3/306 (0%)

Query: 1   MEK-KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M +  P RI TR SPLAL  A   + +L   H  P   + ++ + TKGD I +  L ++G
Sbjct: 1   MTQSTPIRIATRKSPLALWQAHFVKDALQSAH--PGLEVELVTMVTKGDIILDTPLAKVG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T  ++ 
Sbjct: 59  GKGLFVKELEVAMLEGRADLAVHSMKDVPIDFPDGLGLVTICEREDPRDAFVSNTYNNID 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           DL   +V+GT SLRR+  L  +R D+ + + RG + TRL KL+  +  AI+LA AG+KRL
Sbjct: 119 DLPQGAVVGTCSLRRQCQLKEYRPDLVIKELRGNVGTRLGKLDAGEYDAIILAAAGLKRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
           + E+ I+  +  E   P+ GQGA+ IE  +++ + ++L++ +NH DT D V CERA    
Sbjct: 179 ELEERIRSFIEPEQSLPAVGQGAVGIECRIDDERLRKLLEPLNHRDTADRVRCERAMNLT 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I  ++   G  ++   +V   DG +      +G+R DA  +G   A  +   
Sbjct: 239 LEGGCQVPIGSYSLLDGDNIWLRALVGEPDGSLIVRGEIHGHRNDAEALGVQLANELLAN 298

Query: 300 SNKNVF 305
             +++ 
Sbjct: 299 GARDIL 304


>gi|157833452|pdb|1PDA|A Chain A, Structure Of Porphobilinogen Deaminase Reveals A Flexible
           Multidomain Polymerase With A Single Catalytic Site
 gi|41664|emb|CAA27813.1| unnamed protein product [Escherichia coli]
          Length = 313

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 114/305 (37%), Positives = 166/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 59  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 179 LESRIRAALPPEISLPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G+C+  I  +A      ++  G+V A DG       R G   DA  +G   A+ +    
Sbjct: 239 EGACQVPIGSYAELIDGEIWLRGLVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|328472411|gb|EGF43277.1| porphobilinogen deaminase [Vibrio parahaemolyticus 10329]
          Length = 312

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 114/306 (37%), Positives = 171/306 (55%), Gaps = 3/306 (0%)

Query: 1   MEK-KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M +  P RI TR SPLAL  A   + +L   H  P   + ++ + TKGD I +  L ++G
Sbjct: 1   MTQSTPIRIATRKSPLALWQAHFVKDALQAAH--PGLEVELVTMVTKGDVILDTPLAKVG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T  S+ 
Sbjct: 59  GKGLFVKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYSSID 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           +L   +V+GT SLRR+  L  +R DI + + RG + TRL KL+  +  AI+LA AG+KRL
Sbjct: 119 ELPQGAVVGTCSLRRQCQLKEYRPDIIIKELRGNVGTRLGKLDAGEYDAIILAAAGLKRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
           K E  I+  +  E   P+ GQGA+ IE  V++ +  +L++ +NH+DT D V CERA    
Sbjct: 179 KLEDRIRSFIEPEQSLPAVGQGAVGIECRVDDERLLKLLEPLNHKDTADRVLCERAMNLT 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I  +A  +G  ++   +V   DG         G+R D   +G   A  +   
Sbjct: 239 LEGGCQVPIGSYALLEGDEIWLRALVGEPDGSEIVRGEVRGHRKDGEALGIQLANELLDN 298

Query: 300 SNKNVF 305
             +++ 
Sbjct: 299 GARDIL 304


>gi|28899762|ref|NP_799367.1| porphobilinogen deaminase [Vibrio parahaemolyticus RIMD 2210633]
 gi|153838754|ref|ZP_01991421.1| porphobilinogen deaminase [Vibrio parahaemolyticus AQ3810]
 gi|260365170|ref|ZP_05777735.1| hydroxymethylbilane synthase [Vibrio parahaemolyticus K5030]
 gi|260878130|ref|ZP_05890485.1| hydroxymethylbilane synthase [Vibrio parahaemolyticus AN-5034]
 gi|260895813|ref|ZP_05904309.1| hydroxymethylbilane synthase [Vibrio parahaemolyticus Peru-466]
 gi|260900854|ref|ZP_05909249.1| hydroxymethylbilane synthase [Vibrio parahaemolyticus AQ4037]
 gi|32363175|sp|Q87KI9|HEM3_VIBPA RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|28808014|dbj|BAC61251.1| porphobilinogen deaminase [Vibrio parahaemolyticus RIMD 2210633]
 gi|149747840|gb|EDM58724.1| porphobilinogen deaminase [Vibrio parahaemolyticus AQ3810]
 gi|308087192|gb|EFO36887.1| hydroxymethylbilane synthase [Vibrio parahaemolyticus Peru-466]
 gi|308092784|gb|EFO42479.1| hydroxymethylbilane synthase [Vibrio parahaemolyticus AN-5034]
 gi|308110595|gb|EFO48135.1| hydroxymethylbilane synthase [Vibrio parahaemolyticus AQ4037]
 gi|308111033|gb|EFO48573.1| hydroxymethylbilane synthase [Vibrio parahaemolyticus K5030]
          Length = 312

 Score =  286 bits (731), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 113/306 (36%), Positives = 171/306 (55%), Gaps = 3/306 (0%)

Query: 1   MEK-KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M +  P RI TR SPLAL  A   + +L   H  P   + ++ + TKGD I +  L ++G
Sbjct: 1   MTQSTPIRIATRKSPLALWQAHFVKDALQAAH--PGLEVELVTMVTKGDVILDTPLAKVG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T  ++ 
Sbjct: 59  GKGLFVKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYSNIN 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           +L   +V+GT SLRR+  L  +R DI + + RG + TRL KL+  +  AI+LA AG+KRL
Sbjct: 119 ELPQGAVVGTCSLRRQCQLKEYRPDIIIKELRGNVGTRLGKLDAGEYDAIILAAAGLKRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
           K E  I+  +  E   P+ GQGA+ IE  V++ +  +L++ +NH+DT D V CERA    
Sbjct: 179 KLEDRIRSFIEPEQSLPAVGQGAVGIECRVDDERLLKLLEPLNHKDTADRVLCERAMNLT 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I  +A  +G  ++   +V   DG         G+R D   +G   A  +   
Sbjct: 239 LEGGCQVPIGSYALLEGDEIWLRALVGEPDGSEIVRGEVRGHRKDGEALGIQLANELLDS 298

Query: 300 SNKNVF 305
             +++ 
Sbjct: 299 GARDIL 304


>gi|170026227|ref|YP_001722732.1| porphobilinogen deaminase [Yersinia pseudotuberculosis YPIII]
 gi|238059009|sp|B1JPE6|HEM3_YERPY RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|169752761|gb|ACA70279.1| porphobilinogen deaminase [Yersinia pseudotuberculosis YPIII]
          Length = 313

 Score =  286 bits (731), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 117/305 (38%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P   I ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQHLLQANH--PGLQIELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     RED RD F+S     L D
Sbjct: 59  KGLFVKELELALLDGRADIAVHSMKDVPIAFPEGLGLVTICEREDPRDAFVSSHYTHLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+ + D RG + TRL KL+N    AI+LA AG+KRL 
Sbjct: 119 LPAGSVVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDNGDYQAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  ++ E+  P+ GQGA+ IE  +++   ++L+  +NH  T   V  ERA    L
Sbjct: 179 LENRIRYAMSAEESLPAVGQGAVGIECRLDDGHTRQLLAPLNHRHTELRVCAERAMNIRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +G TL+   +V A DG       R G   +A  +G + A  +    
Sbjct: 239 EGGCQVPIGSYAELEGDTLWLRALVGAPDGSQMIRGERRGPAAEAEQMGIELADELLSRG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|218701284|ref|YP_002408913.1| porphobilinogen deaminase [Escherichia coli IAI39]
 gi|226740634|sp|B7NTE0|HEM3_ECO7I RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|218371270|emb|CAR19104.1| hydroxymethylbilane synthase [Escherichia coli IAI39]
          Length = 313

 Score =  286 bits (731), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   +L  
Sbjct: 59  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDNLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 179 LESRIRAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|170680193|ref|YP_001746121.1| porphobilinogen deaminase [Escherichia coli SMS-3-5]
 gi|170517911|gb|ACB16089.1| porphobilinogen deaminase [Escherichia coli SMS-3-5]
          Length = 318

 Score =  286 bits (731), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 6   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 63

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+  +SL  
Sbjct: 64  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYESLDA 123

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 124 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 183

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 184 LESRIRAALPPEISLPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAMNTRL 243

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 244 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 303

Query: 301 NKNVF 305
            + + 
Sbjct: 304 AREIL 308


>gi|307140503|ref|ZP_07499859.1| porphobilinogen deaminase [Escherichia coli H736]
          Length = 318

 Score =  286 bits (731), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 6   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 63

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 64  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 123

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 124 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 183

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 184 LESRIRAALPPEISLPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAMNTRL 243

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 244 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 303

Query: 301 NKNVF 305
            + + 
Sbjct: 304 AREIL 308


>gi|323964049|gb|EGB59539.1| porphobilinogen deaminase [Escherichia coli M863]
 gi|327250654|gb|EGE62360.1| porphobilinogen deaminase [Escherichia coli STEC_7v]
          Length = 313

 Score =  286 bits (731), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 114/305 (37%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 59  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +N+ + +EL+  +NH +T   V  ERA    L
Sbjct: 179 LESRIRAALPPEISLPAVGQGAVGIECRLNDTRTRELLAALNHHETALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|49176416|ref|YP_026260.1| hydroxymethylbilane synthase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|89110215|ref|AP_003995.1| hydroxymethylbilane synthase [Escherichia coli str. K-12 substr.
           W3110]
 gi|170083288|ref|YP_001732608.1| hydroxymethylbilane synthase [Escherichia coli str. K-12 substr.
           DH10B]
 gi|238902882|ref|YP_002928678.1| hydroxymethylbilane synthase [Escherichia coli BW2952]
 gi|256026151|ref|ZP_05440016.1| porphobilinogen deaminase [Escherichia sp. 4_1_40B]
 gi|312971913|ref|ZP_07786087.1| porphobilinogen deaminase [Escherichia coli 1827-70]
 gi|2506504|sp|P06983|HEM3_ECOLI RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|229836108|sp|B1XAH2|HEM3_ECODH RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|259647795|sp|C4ZZ69|HEM3_ECOBW RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|4388845|pdb|2YPN|A Chain A, Hydroxymethylbilane Synthase
 gi|28373294|pdb|1GTK|A Chain A, Time-Resolved And Static-Ensemble Structural Chemistry Of
           Hydroxymethylbilane Synthase
 gi|41666|emb|CAA31132.1| unnamed protein product [Escherichia coli]
 gi|48994974|gb|AAT48218.1| hydroxymethylbilane synthase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|85676246|dbj|BAE77496.1| hydroxymethylbilane synthase [Escherichia coli str. K12 substr.
           W3110]
 gi|169891123|gb|ACB04830.1| hydroxymethylbilane synthase [Escherichia coli str. K-12 substr.
           DH10B]
 gi|238861470|gb|ACR63468.1| hydroxymethylbilane synthase [Escherichia coli BW2952]
 gi|309704240|emb|CBJ03588.1| porphobilinogen deaminase [Escherichia coli ETEC H10407]
 gi|310334290|gb|EFQ00495.1| porphobilinogen deaminase [Escherichia coli 1827-70]
 gi|315618498|gb|EFU99084.1| porphobilinogen deaminase [Escherichia coli 3431]
 gi|323934193|gb|EGB30624.1| porphobilinogen deaminase [Escherichia coli E1520]
 gi|323938941|gb|EGB35160.1| porphobilinogen deaminase [Escherichia coli E482]
 gi|332345783|gb|AEE59117.1| porphobilinogen deaminase HemC [Escherichia coli UMNK88]
          Length = 313

 Score =  286 bits (731), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 59  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 179 LESRIRAALPPEISLPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|320197614|gb|EFW72226.1| Porphobilinogen deaminase [Escherichia coli WV_060327]
          Length = 318

 Score =  286 bits (731), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 6   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 63

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   +L  
Sbjct: 64  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDNLDA 123

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 124 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 183

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 184 LESRIRAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRL 243

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 244 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 303

Query: 301 NKNVF 305
            + + 
Sbjct: 304 AREIL 308


>gi|187776117|ref|ZP_02800653.2| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4196]
 gi|188025006|ref|ZP_02775407.2| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4113]
 gi|189010242|ref|ZP_02805709.2| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4076]
 gi|189401833|ref|ZP_02778707.2| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4401]
 gi|189403100|ref|ZP_02793091.2| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4486]
 gi|189404376|ref|ZP_02788935.2| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4501]
 gi|189404861|ref|ZP_02811648.2| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC869]
 gi|208806069|ref|ZP_03248406.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4206]
 gi|208812922|ref|ZP_03254251.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4045]
 gi|208819553|ref|ZP_03259873.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4042]
 gi|209396873|ref|YP_002273321.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4115]
 gi|217324566|ref|ZP_03440650.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. TW14588]
 gi|261225578|ref|ZP_05939859.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. FRIK2000]
 gi|261255624|ref|ZP_05948157.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. FRIK966]
 gi|187768841|gb|EDU32685.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4196]
 gi|188015439|gb|EDU53561.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4113]
 gi|189001539|gb|EDU70525.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4076]
 gi|189359021|gb|EDU77440.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4401]
 gi|189362764|gb|EDU81183.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4486]
 gi|189365984|gb|EDU84400.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4501]
 gi|189373238|gb|EDU91654.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC869]
 gi|208725870|gb|EDZ75471.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4206]
 gi|208734199|gb|EDZ82886.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4045]
 gi|208739676|gb|EDZ87358.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4042]
 gi|209158273|gb|ACI35706.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4115]
 gi|217320787|gb|EEC29211.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. TW14588]
 gi|320191103|gb|EFW65753.1| Porphobilinogen deaminase [Escherichia coli O157:H7 str. EC1212]
 gi|320666093|gb|EFX33107.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. LSU-61]
 gi|326344260|gb|EGD68020.1| Porphobilinogen deaminase [Escherichia coli O157:H7 str. 1125]
 gi|326347912|gb|EGD71626.1| Porphobilinogen deaminase [Escherichia coli O157:H7 str. 1044]
          Length = 318

 Score =  286 bits (731), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 6   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 63

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 64  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 123

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 124 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 183

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 184 LESRIRAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRL 243

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 244 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 303

Query: 301 NKNVF 305
            + + 
Sbjct: 304 AREIL 308


>gi|227114730|ref|ZP_03828386.1| porphobilinogen deaminase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 313

 Score =  285 bits (730), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 117/305 (38%), Positives = 167/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  L   H  P  ++ ++P+ T+GD I +  L ++GG
Sbjct: 1   MLANIIRIATRQSPLALWQARYVQQCL--NHLYPDLHVELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P +   GL ++    R+D RD F+S+   SL  
Sbjct: 59  KGLFVKELELALLEGRADIAVHSMKDVPVEFPDGLGLTTICERDDPRDAFVSNHYDSLDQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S +GTSSLRR+  L   R D+ + D RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPQGSCVGTSSLRRQCQLRARRPDLVIRDLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L+ E+  P+ GQGAI IE  +++   + L+  +NH  T   V  ERA    L
Sbjct: 179 LEARIRCALSPEESLPAVGQGAIGIECRLDDEHVRHLLAPLNHPATAARVLAERAMNVRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +G TL+   +V A DG       R GN  DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELEGDTLWLRALVGAPDGSQMIVGERKGNVSDAEQLGIALAEELLAKG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 ASAIL 303


>gi|168801133|ref|ZP_02826140.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC508]
 gi|195938092|ref|ZP_03083474.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4024]
 gi|218707439|ref|YP_002414958.1| porphobilinogen deaminase [Escherichia coli UMN026]
 gi|254795801|ref|YP_003080638.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. TW14359]
 gi|293413246|ref|ZP_06655908.1| porphobilinogen deaminase [Escherichia coli B354]
 gi|298383172|ref|ZP_06992766.1| hydroxymethylbilane synthase [Escherichia coli FVEC1302]
 gi|331665450|ref|ZP_08366349.1| hydroxymethylbilane synthase [Escherichia coli TA143]
 gi|23821693|sp|Q8XAP3|HEM3_ECO57 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|226740636|sp|B7NFA7|HEM3_ECOLU RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|189376679|gb|EDU95095.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC508]
 gi|218434536|emb|CAR15462.1| hydroxymethylbilane synthase [Escherichia coli UMN026]
 gi|254595201|gb|ACT74562.1| hydroxymethylbilane synthase [Escherichia coli O157:H7 str.
           TW14359]
 gi|284923908|emb|CBG37007.1| porphobilinogen deaminase [Escherichia coli 042]
 gi|291468194|gb|EFF10691.1| porphobilinogen deaminase [Escherichia coli B354]
 gi|298276408|gb|EFI17927.1| hydroxymethylbilane synthase [Escherichia coli FVEC1302]
 gi|320639287|gb|EFX08909.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. G5101]
 gi|320644672|gb|EFX13722.1| porphobilinogen deaminase [Escherichia coli O157:H- str. 493-89]
 gi|320649997|gb|EFX18500.1| porphobilinogen deaminase [Escherichia coli O157:H- str. H 2687]
 gi|320655343|gb|EFX23285.1| porphobilinogen deaminase [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|323974386|gb|EGB69514.1| porphobilinogen deaminase [Escherichia coli TW10509]
 gi|331057348|gb|EGI29337.1| hydroxymethylbilane synthase [Escherichia coli TA143]
          Length = 313

 Score =  285 bits (730), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 59  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 179 LESRIRAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|332998254|gb|EGK17856.1| porphobilinogen deaminase [Shigella flexneri K-272]
 gi|333013794|gb|EGK33157.1| porphobilinogen deaminase [Shigella flexneri K-227]
          Length = 313

 Score =  285 bits (730), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 59  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 179 LESRIRAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|253775572|ref|YP_003038403.1| porphobilinogen deaminase [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|300930031|ref|ZP_07145463.1| porphobilinogen deaminase [Escherichia coli MS 187-1]
 gi|253326616|gb|ACT31218.1| porphobilinogen deaminase [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|300462064|gb|EFK25557.1| porphobilinogen deaminase [Escherichia coli MS 187-1]
          Length = 320

 Score =  285 bits (730), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 8   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 65

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   +L  
Sbjct: 66  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDNLDA 125

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 126 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 185

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 186 LESRIRAALPPEISLPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAMNTRL 245

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 246 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 305

Query: 301 NKNVF 305
            + + 
Sbjct: 306 AREIL 310


>gi|204930376|ref|ZP_03221353.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|204320780|gb|EDZ05982.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
          Length = 320

 Score =  285 bits (730), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 111/305 (36%), Positives = 160/305 (52%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   + +LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 8   MLDNVLRIATRQSPLALWQAHYVKDALMATH--PGLTVELVPMVTRGDVILDTPLAKVGG 65

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P     GL +     RED RD F+S+   SL D
Sbjct: 66  KGLFVKELEIALLEKRADIAVHSMKDVPVAFPDGLGLVTICEREDPRDAFVSNKYHSLDD 125

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L     D+ +   RG + TRL KL+N    AI+LA AG+KRL 
Sbjct: 126 LPAGSIVGTSSLRRQCQLAERHPDLIIRSLRGNVGTRLGKLDNGDYDAIILAVAGLKRLG 185

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  +   P+ GQGA+ IE  +++ + Q L+  +NH  T   V  ERA    L
Sbjct: 186 LESRIRTALPPDVSLPAVGQGAVGIECRLDDARTQALLAPLNHSQTALRVTAERAMNTRL 245

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG +     R G+   A  +G   A+ +    
Sbjct: 246 EGGCQVPIGSYAEIINGEIWLRALVGAPDGSVMVRGERRGSPEQAEQMGISLAEELLENG 305

Query: 301 NKNVF 305
            + + 
Sbjct: 306 ARAIL 310


>gi|193067963|ref|ZP_03048928.1| porphobilinogen deaminase [Escherichia coli E110019]
 gi|192958583|gb|EDV89021.1| porphobilinogen deaminase [Escherichia coli E110019]
          Length = 318

 Score =  285 bits (730), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 6   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 63

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 64  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 123

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 124 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 183

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 184 LESRIRAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRL 243

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 244 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 303

Query: 301 NKNVF 305
            + + 
Sbjct: 304 AREIL 308


>gi|323161134|gb|EFZ47052.1| porphobilinogen deaminase [Escherichia coli E128010]
          Length = 313

 Score =  285 bits (730), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 163/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 59  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ +  EL+  +NH +T   V  ERA    L
Sbjct: 179 LESRIRAALPPEISLPAVGQGAVGIECRLDDTRTHELLAALNHHETALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   +A  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQNAEQMGISLAEELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|312969469|ref|ZP_07783671.1| porphobilinogen deaminase [Escherichia coli 2362-75]
 gi|312286016|gb|EFR13934.1| porphobilinogen deaminase [Escherichia coli 2362-75]
          Length = 313

 Score =  285 bits (730), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 114/305 (37%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+T  SL  
Sbjct: 59  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNTYDSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 179 LESRIRAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|254230107|ref|ZP_04923503.1| porphobilinogen deaminase [Vibrio sp. Ex25]
 gi|262392880|ref|YP_003284734.1| porphobilinogen deaminase [Vibrio sp. Ex25]
 gi|151937352|gb|EDN56214.1| porphobilinogen deaminase [Vibrio sp. Ex25]
 gi|262336474|gb|ACY50269.1| porphobilinogen deaminase [Vibrio sp. Ex25]
          Length = 312

 Score =  285 bits (730), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 112/306 (36%), Positives = 171/306 (55%), Gaps = 3/306 (0%)

Query: 1   MEK-KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M +  P RI TR SPLAL  A+  + +L   H  P   + ++ + TKGD I +  L ++G
Sbjct: 1   MTQSTPIRIATRKSPLALWQAYFVKDALQAAH--PGLEVELVTMVTKGDVILDTPLAKVG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T  ++ 
Sbjct: 59  GKGLFVKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYSNID 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           +L   +V+GT SLRR+  L  +R DI + + RG + TRL KL+  +  AI+LA AG+KRL
Sbjct: 119 ELPQGAVVGTCSLRRQCQLKEYRPDIIIKELRGNVGTRLGKLDAGEYDAIILAAAGLKRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
           K E+ I+  +  E   P+ GQGA+ IE  +++ +  +L++ +NH+DT D V CERA    
Sbjct: 179 KLEERIRSFIEPEQSLPAVGQGAVGIECRLDDERLLKLLEPLNHQDTVDRVLCERAMNLT 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I  +A   G  ++   +V   DG         G+R D   +G   A  +   
Sbjct: 239 LEGGCQVPIGSYALLDGDNIWLRALVGEPDGSEIVRGEIRGHRKDGEALGVQLANELLDN 298

Query: 300 SNKNVF 305
             + + 
Sbjct: 299 GAREIL 304


>gi|170769870|ref|ZP_02904323.1| porphobilinogen deaminase [Escherichia albertii TW07627]
 gi|170121308|gb|EDS90239.1| porphobilinogen deaminase [Escherichia albertii TW07627]
          Length = 313

 Score =  285 bits (730), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 115/305 (37%), Positives = 166/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDKLMTSH--PGLVVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+T  SL  
Sbjct: 59  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNTYDSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +N+ + +EL+  +NH +T   V  ERA    L
Sbjct: 179 LESRIRTALPPEVSLPAVGQGAVGIECRLNDTRTRELLAALNHNETALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G+  DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELVDGEIWLRALVGAPDGSQIIRGERRGSPQDAEQMGISLAEELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|194434066|ref|ZP_03066336.1| porphobilinogen deaminase [Shigella dysenteriae 1012]
 gi|194417724|gb|EDX33823.1| porphobilinogen deaminase [Shigella dysenteriae 1012]
 gi|320176046|gb|EFW51115.1| Porphobilinogen deaminase [Shigella dysenteriae CDC 74-1112]
          Length = 318

 Score =  285 bits (730), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 6   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 63

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 64  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 123

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 124 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 183

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 184 LESRIRAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRL 243

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 244 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 303

Query: 301 NKNVF 305
            + + 
Sbjct: 304 AREIL 308


>gi|157163278|ref|YP_001460596.1| porphobilinogen deaminase [Escherichia coli HS]
 gi|170022172|ref|YP_001727126.1| porphobilinogen deaminase [Escherichia coli ATCC 8739]
 gi|188494806|ref|ZP_03002076.1| porphobilinogen deaminase [Escherichia coli 53638]
 gi|254039017|ref|ZP_04873068.1| porphobilinogen deaminase [Escherichia sp. 1_1_43]
 gi|300950432|ref|ZP_07164354.1| porphobilinogen deaminase [Escherichia coli MS 116-1]
 gi|300955191|ref|ZP_07167588.1| porphobilinogen deaminase [Escherichia coli MS 175-1]
 gi|301646129|ref|ZP_07246029.1| porphobilinogen deaminase [Escherichia coli MS 146-1]
 gi|331644538|ref|ZP_08345658.1| hydroxymethylbilane synthase [Escherichia coli H736]
 gi|157068958|gb|ABV08213.1| porphobilinogen deaminase [Escherichia coli HS]
 gi|169757100|gb|ACA79799.1| porphobilinogen deaminase [Escherichia coli ATCC 8739]
 gi|188490005|gb|EDU65108.1| porphobilinogen deaminase [Escherichia coli 53638]
 gi|226838708|gb|EEH70736.1| porphobilinogen deaminase [Escherichia sp. 1_1_43]
 gi|260451352|gb|ACX41774.1| porphobilinogen deaminase [Escherichia coli DH1]
 gi|300317908|gb|EFJ67692.1| porphobilinogen deaminase [Escherichia coli MS 175-1]
 gi|300450239|gb|EFK13859.1| porphobilinogen deaminase [Escherichia coli MS 116-1]
 gi|301075655|gb|EFK90461.1| porphobilinogen deaminase [Escherichia coli MS 146-1]
 gi|315138381|dbj|BAJ45540.1| porphobilinogen deaminase [Escherichia coli DH1]
 gi|331036210|gb|EGI08445.1| hydroxymethylbilane synthase [Escherichia coli H736]
          Length = 320

 Score =  285 bits (729), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 8   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 65

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 66  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 125

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 126 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 185

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 186 LESRIRAALPPEISLPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAMNTRL 245

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 246 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 305

Query: 301 NKNVF 305
            + + 
Sbjct: 306 AREIL 310


>gi|291285218|ref|YP_003502036.1| Porphobilinogen deaminase [Escherichia coli O55:H7 str. CB9615]
 gi|209753314|gb|ACI74964.1| adenylate cyclase [Escherichia coli]
 gi|290765091|gb|ADD59052.1| Porphobilinogen deaminase [Escherichia coli O55:H7 str. CB9615]
          Length = 320

 Score =  285 bits (729), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 163/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 8   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 65

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +   GL +     RED RD F+S+   SL  
Sbjct: 66  KGLFVKELEVALLENRADIAVHSMKDVPVEFPHGLGLVTICEREDPRDAFVSNNYDSLDA 125

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 126 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 185

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 186 LESRIRAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRL 245

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 246 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 305

Query: 301 NKNVF 305
            + + 
Sbjct: 306 AREIL 310


>gi|149908497|ref|ZP_01897159.1| porphobilinogen deaminase [Moritella sp. PE36]
 gi|149808331|gb|EDM68268.1| porphobilinogen deaminase [Moritella sp. PE36]
          Length = 312

 Score =  285 bits (729), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 111/305 (36%), Positives = 169/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR SPLA+  A   ++ L  +H+     + +IP+ TKGD I +  L ++GG
Sbjct: 1   MATETLRIATRKSPLAMWQAEYVKARLEAIHQ--NLTVELIPMVTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++    D AVHS KD+P +  +GL +     RED RD F+S+T + +++
Sbjct: 59  KGLFVKELEVAILENRADIAVHSMKDVPVEFPEGLDLEVICEREDPRDAFVSNTYRQIEE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GT SLRR+  L   R D+ ++D RG + TRLNKL+N    AI+LA AG+KRL 
Sbjct: 119 LPPGAIVGTCSLRRQCQLSEARPDLKIMDLRGNVNTRLNKLDNKDYDAIILAAAGLKRLD 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   +  E   P+ GQGA+ IE  +++ + + L+  +NH  T D V  ERA    L
Sbjct: 179 MEYRIASYIEPEQSLPAVGQGAVGIECRIDDERVKALLAPLNHALTSDRVLAERAMNLAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A   G  L+  G+V   DG         G+R +A  +G + A  +    
Sbjct: 239 EGGCQVPIGSYAIIDGDELWLRGLVGKPDGTEVIRAEIRGDRKNARQLGLELADKLLAQG 298

Query: 301 NKNVF 305
            K + 
Sbjct: 299 AKEIL 303


>gi|205354497|ref|YP_002228298.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205274278|emb|CAR39298.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|326629631|gb|EGE35974.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 318

 Score =  285 bits (729), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 161/305 (52%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   + +LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 6   MLDNVLRIATRQSPLALWQAHYVKDALMATH--PGLTVELVPMVTRGDVILDTPLAKVGG 63

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P     GL +     RED RD F+S+   SL D
Sbjct: 64  KGLFVKELEIALLEKRADIAVHSMKDVPVAFPDGLGLVTICEREDPRDAFVSNKYHSLDD 123

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL KL+N    AI+LA AG+KRL 
Sbjct: 124 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLGKLDNGDYDAIILAVAGLKRLG 183

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  +   P+ GQGA+ IE  +++ + Q L+  +NH  T   V  ERA    L
Sbjct: 184 LEPRIRTALPPDVSLPAVGQGAVGIECRLDDARTQALLAPLNHSQTALRVTAERAMNTRL 243

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG +     R G+   A  +G   A+ +    
Sbjct: 244 EGGCQVPIGSYAEIINGEIWLRALVGAPDGSVMVRGERRGSPEQAEQMGISLAEELLENG 303

Query: 301 NKNVF 305
            + + 
Sbjct: 304 ARAIL 308


>gi|269964925|ref|ZP_06179095.1| porphobilinogen deaminase [Vibrio alginolyticus 40B]
 gi|269830401|gb|EEZ84625.1| porphobilinogen deaminase [Vibrio alginolyticus 40B]
          Length = 312

 Score =  285 bits (729), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 112/306 (36%), Positives = 170/306 (55%), Gaps = 3/306 (0%)

Query: 1   MEK-KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M +  P RI TR SPLAL  A+  + +L   H  P   + ++ + TKGD I +  L ++G
Sbjct: 1   MTQSTPIRIATRKSPLALWQAYFVKDALQAAH--PGLEVELVTMVTKGDVILDTPLAKVG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T   + 
Sbjct: 59  GKGLFVKELEIAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYSHID 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           +L   +V+GT SLRR+  L  +R DI + + RG + TRL KL+  +  AI+LA AG+KRL
Sbjct: 119 ELPQGAVVGTCSLRRQCQLKEYRPDIIIKELRGNVGTRLGKLDAGEYDAIILAAAGLKRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
           K E+ I+  +  E   P+ GQGA+ IE  +++ +  +L++ +NH+DT D V CERA    
Sbjct: 179 KLEERIRSFIEPEQSLPAVGQGAVGIECRLDDERLLKLLEPLNHQDTVDRVLCERAMNLT 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I  +A   G  ++   +V   DG         G+R D   +G   A  +   
Sbjct: 239 LEGGCQVPIGSYALLDGDNIWLRALVGEPDGSEIVRGEIRGHRKDGEALGVQLANELLDN 298

Query: 300 SNKNVF 305
             + + 
Sbjct: 299 GAREIL 304


>gi|191174267|ref|ZP_03035776.1| porphobilinogen deaminase [Escherichia coli F11]
 gi|190905450|gb|EDV65080.1| porphobilinogen deaminase [Escherichia coli F11]
          Length = 318

 Score =  285 bits (729), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 114/305 (37%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 6   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 63

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+T  SL  
Sbjct: 64  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNTYDSLDA 123

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 124 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 183

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 184 LESRIRAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRL 243

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 244 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 303

Query: 301 NKNVF 305
            + + 
Sbjct: 304 AREIL 308


>gi|331660148|ref|ZP_08361084.1| hydroxymethylbilane synthase [Escherichia coli TA206]
 gi|320185465|gb|EFW60234.1| Porphobilinogen deaminase [Shigella flexneri CDC 796-83]
 gi|331052716|gb|EGI24751.1| hydroxymethylbilane synthase [Escherichia coli TA206]
 gi|332084681|gb|EGI89869.1| porphobilinogen deaminase [Shigella boydii 5216-82]
 gi|332084931|gb|EGI90113.1| porphobilinogen deaminase [Shigella dysenteriae 155-74]
          Length = 313

 Score =  285 bits (729), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 59  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 179 LESRIRAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|293407432|ref|ZP_06651352.1| porphobilinogen deaminase [Escherichia coli FVEC1412]
 gi|291425543|gb|EFE98581.1| porphobilinogen deaminase [Escherichia coli FVEC1412]
          Length = 313

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 59  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 179 LESHIRAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|261823396|ref|YP_003261502.1| porphobilinogen deaminase [Pectobacterium wasabiae WPP163]
 gi|261607409|gb|ACX89895.1| porphobilinogen deaminase [Pectobacterium wasabiae WPP163]
          Length = 313

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 118/305 (38%), Positives = 172/305 (56%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  L   H  P  ++ ++P+ T+GD I +  L ++GG
Sbjct: 1   MLANIIRIATRQSPLALWQARYVQQRL--NHLYPDLSVELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P +   GL ++    R+D RD F+S+   SL  
Sbjct: 59  KGLFVKELELALLEGRADIAVHSMKDVPVEFPDGLGLTTICERDDPRDAFVSNHYDSLDQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S +GTSSLRR+  L   R D+ + D RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPQGSCVGTSSLRRQCQLRARRPDLVIRDLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I+  L+ E+  P+ GQGAI IE  +++ + ++L+  +NH DT   V  ERA    L
Sbjct: 179 LEERIRCALSPEESLPAVGQGAIGIECRLDDDRIRQLLAPLNHTDTAARVLAERAMNVRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +G+TL+   +V A DG       R G+  DA  IG   A+ +    
Sbjct: 239 EGGCQVPIGSYAELEGNTLWLRALVGAPDGSQMIVGERKGSVVDAEKIGIALAEELLAKG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 ASAIL 303


>gi|306815158|ref|ZP_07449311.1| porphobilinogen deaminase [Escherichia coli NC101]
 gi|34222567|sp|Q8FBP1|HEM3_ECOL6 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|222035503|emb|CAP78248.1| Porphobilinogen deaminase [Escherichia coli LF82]
 gi|305851527|gb|EFM51981.1| porphobilinogen deaminase [Escherichia coli NC101]
 gi|312948358|gb|ADR29185.1| porphobilinogen deaminase [Escherichia coli O83:H1 str. NRG 857C]
          Length = 313

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 114/305 (37%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+T  SL  
Sbjct: 59  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNTYDSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 179 LESRIRAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|56461658|ref|YP_156939.1| porphobilinogen deaminase [Idiomarina loihiensis L2TR]
 gi|61213262|sp|Q5QUS3|HEM3_IDILO RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|56180668|gb|AAV83390.1| Porphobilinogen deaminase [Idiomarina loihiensis L2TR]
          Length = 313

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 103/305 (33%), Positives = 164/305 (53%), Gaps = 3/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M ++  RI TR S LAL  A   +  L ++H  P  ++ ++P+STKGD I +  L +IGG
Sbjct: 1   MTQR-VRIATRKSKLALWQAEHIQQRLEELH--PGLSVELVPMSTKGDVILDTPLAKIGG 57

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +   GL++     RED RD F+S+  ++L +
Sbjct: 58  KGLFVKELEVAMLEGRADIAVHSMKDLPVEFPPGLELHTICEREDPRDAFVSNNYKNLNE 117

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GT SLRR+  +      + + D RG ++TRL KL+  +  AI+LA +G+ RL+
Sbjct: 118 LPEGAVVGTCSLRRRCQVKEQFPHLVIKDLRGNVQTRLRKLDEGEFDAIILAASGLIRLE 177

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I   + +E   P+ GQGA+ IE   ++ + + L+  +  ++T   V  ERA    L
Sbjct: 178 LGDRITSFIPVEQSLPANGQGALGIECRSDDDEMKALLAPLQCQETRTRVLAERAMNRGL 237

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DG C+  I  +A  +G  +Y  G+V   DG         G    A  +G + A+ +    
Sbjct: 238 DGGCQVPIGAYAELEGDEVYLRGLVGEPDGGKVLRDEVRGPASKAEELGSELAERLLKQG 297

Query: 301 NKNVF 305
              + 
Sbjct: 298 AAEIL 302


>gi|62182409|ref|YP_218826.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|167553883|ref|ZP_02347627.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|168244626|ref|ZP_02669558.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168263173|ref|ZP_02685146.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168467648|ref|ZP_02701485.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|194442426|ref|YP_002043172.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|197247501|ref|YP_002148864.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|213029666|ref|ZP_03344113.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
 gi|213416718|ref|ZP_03349862.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
 gi|213425401|ref|ZP_03358151.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213649584|ref|ZP_03379637.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213865139|ref|ZP_03387258.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|62130042|gb|AAX67745.1| porphobilinogen deaminase (hydroxymethylbilane synthase)
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|194401089|gb|ACF61311.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|195630016|gb|EDX48676.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197211204|gb|ACH48601.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|205321788|gb|EDZ09627.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205336530|gb|EDZ23294.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205348255|gb|EDZ34886.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|322716902|gb|EFZ08473.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 320

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 161/305 (52%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   + +LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 8   MLDNVLRIATRQSPLALWQAHYVKDALMATH--PGLTVELVPMVTRGDVILDTPLAKVGG 65

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P     GL +     RED RD F+S+   SL D
Sbjct: 66  KGLFVKELEIALLEKRADIAVHSMKDVPVAFPDGLGLVTICEREDPRDAFVSNKYHSLDD 125

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL KL+N    AI+LA AG+KRL 
Sbjct: 126 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLGKLDNGDYDAIILAVAGLKRLG 185

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  +   P+ GQGA+ IE  +++ + Q L+  +NH  T   V  ERA    L
Sbjct: 186 LESRIRTALPPDVSLPAVGQGAVGIECRLDDARTQALLAPLNHSQTALRVTAERAMNTRL 245

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG +     R G+   A  +G   A+ +    
Sbjct: 246 EGGCQVPIGSYAEIINGEIWLRALVGAPDGSVMVRGERRGSPEQAEQMGISLAEELLENG 305

Query: 301 NKNVF 305
            + + 
Sbjct: 306 ARAIL 310


>gi|16767209|ref|NP_462824.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|194449507|ref|YP_002047954.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|207859144|ref|YP_002245795.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|6960263|gb|AAF33453.1| 89% identity with E. coli porphobilinogen deaminase (HEMC)
           (SP:P06983); contains similarity to Pfam family PF01379
           (Porphobilinogen deaminase), score=627.8, E=6.2e-185,
           N=1 [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|16422502|gb|AAL22783.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|194407811|gb|ACF68030.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|206710947|emb|CAR35314.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|261249062|emb|CBG26922.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267996216|gb|ACY91101.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301160454|emb|CBW19983.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|320088349|emb|CBY98109.1| Porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|323132286|gb|ADX19716.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|326625658|gb|EGE32003.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|332990774|gb|AEF09757.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 318

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 161/305 (52%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   + +LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 6   MLDNVLRIATRQSPLALWQAHYVKDALMATH--PGLTVELVPMVTRGDVILDTPLAKVGG 63

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P     GL +     RED RD F+S+   SL D
Sbjct: 64  KGLFVKELEIALLEKRADIAVHSMKDVPVAFPDGLGLVTICEREDPRDAFVSNKYHSLDD 123

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL KL+N    AI+LA AG+KRL 
Sbjct: 124 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLGKLDNGDYDAIILAVAGLKRLG 183

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  +   P+ GQGA+ IE  +++ + Q L+  +NH  T   V  ERA    L
Sbjct: 184 LESRIRTALPPDVSLPAVGQGAVGIECRLDDARTQALLAPLNHSQTALRVTAERAMNTRL 243

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG +     R G+   A  +G   A+ +    
Sbjct: 244 EGGCQVPIGSYAEIINGEIWLRALVGAPDGSVMVRGERRGSPEQAEQMGISLAEELLENG 303

Query: 301 NKNVF 305
            + + 
Sbjct: 304 ARAIL 308


>gi|16762196|ref|NP_457813.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29143685|ref|NP_807027.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56415793|ref|YP_152868.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|194734788|ref|YP_002116870.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197264899|ref|ZP_03164973.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197301061|ref|ZP_02663450.2| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197364723|ref|YP_002144360.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|198243181|ref|YP_002217871.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|205358019|ref|ZP_02574964.2| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205360118|ref|ZP_02834695.2| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|224585757|ref|YP_002639556.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238912944|ref|ZP_04656781.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|289825622|ref|ZP_06544800.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|61225723|sp|P0A1Q8|HEM3_SALTY RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|61225724|sp|P0A1Q9|HEM3_SALTI RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|81599707|sp|Q5PKL7|HEM3_SALPA RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|226706297|sp|B5FN93|HEM3_SALDC RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|238059000|sp|B5BIU8|HEM3_SALPK RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|238059001|sp|B4TNV3|HEM3_SALSV RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|254800257|sp|C0Q3B3|HEM3_SALPC RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|25292188|pir||AD0920 porphobilinogen deaminase [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16504500|emb|CAD09382.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29139320|gb|AAO70887.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56130050|gb|AAV79556.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|194710290|gb|ACF89511.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197096200|emb|CAR61796.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197243154|gb|EDY25774.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197288774|gb|EDY28149.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197937697|gb|ACH75030.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|205328154|gb|EDZ14918.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205340974|gb|EDZ27738.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|224470285|gb|ACN48115.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|312915057|dbj|BAJ39031.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321225457|gb|EFX50514.1| Porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322613018|gb|EFY09969.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322617394|gb|EFY14294.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322625614|gb|EFY22436.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322627037|gb|EFY23830.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322631247|gb|EFY28010.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322638280|gb|EFY34979.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322642784|gb|EFY39371.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322646974|gb|EFY43476.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322650361|gb|EFY46774.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322656348|gb|EFY52642.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322657573|gb|EFY53843.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322665984|gb|EFY62165.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322666723|gb|EFY62900.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322671034|gb|EFY67164.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322679259|gb|EFY75311.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322681663|gb|EFY77690.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322686010|gb|EFY81998.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323192636|gb|EFZ77864.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323196502|gb|EFZ81652.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323203746|gb|EFZ88767.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323205379|gb|EFZ90353.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323210748|gb|EFZ95624.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323215916|gb|EGA00649.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323221409|gb|EGA05827.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323227573|gb|EGA11729.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323231758|gb|EGA15869.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323236173|gb|EGA20250.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323239590|gb|EGA23638.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323244314|gb|EGA28322.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323249589|gb|EGA33501.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323250319|gb|EGA34205.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323256526|gb|EGA40257.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323259776|gb|EGA43409.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323265184|gb|EGA48682.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323268387|gb|EGA51859.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 313

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 161/305 (52%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   + +LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDALMATH--PGLTVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P     GL +     RED RD F+S+   SL D
Sbjct: 59  KGLFVKELEIALLEKRADIAVHSMKDVPVAFPDGLGLVTICEREDPRDAFVSNKYHSLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL KL+N    AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLGKLDNGDYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  +   P+ GQGA+ IE  +++ + Q L+  +NH  T   V  ERA    L
Sbjct: 179 LESRIRTALPPDVSLPAVGQGAVGIECRLDDARTQALLAPLNHSQTALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG +     R G+   A  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAEIINGEIWLRALVGAPDGSVMVRGERRGSPEQAEQMGISLAEELLENG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 ARAIL 303


>gi|15804393|ref|NP_290433.1| porphobilinogen deaminase [Escherichia coli O157:H7 EDL933]
 gi|15833989|ref|NP_312762.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. Sakai]
 gi|300900647|ref|ZP_07118805.1| porphobilinogen deaminase [Escherichia coli MS 198-1]
 gi|301025752|ref|ZP_07189267.1| porphobilinogen deaminase [Escherichia coli MS 69-1]
 gi|331655487|ref|ZP_08356480.1| hydroxymethylbilane synthase [Escherichia coli M718]
 gi|331675273|ref|ZP_08376024.1| hydroxymethylbilane synthase [Escherichia coli TA280]
 gi|12518669|gb|AAG58997.1|AE005611_7 porphobilinogen deaminase = hydroxymethylbilane synthase
           [Escherichia coli O157:H7 str. EDL933]
 gi|13364211|dbj|BAB38158.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. Sakai]
 gi|209753308|gb|ACI74961.1| adenylate cyclase [Escherichia coli]
 gi|209753310|gb|ACI74962.1| adenylate cyclase [Escherichia coli]
 gi|209753312|gb|ACI74963.1| adenylate cyclase [Escherichia coli]
 gi|209753316|gb|ACI74965.1| adenylate cyclase [Escherichia coli]
 gi|300355863|gb|EFJ71733.1| porphobilinogen deaminase [Escherichia coli MS 198-1]
 gi|300395875|gb|EFJ79413.1| porphobilinogen deaminase [Escherichia coli MS 69-1]
 gi|320660969|gb|EFX28412.1| porphobilinogen deaminase [Escherichia coli O55:H7 str. USDA 5905]
 gi|331046808|gb|EGI18892.1| hydroxymethylbilane synthase [Escherichia coli M718]
 gi|331067559|gb|EGI38963.1| hydroxymethylbilane synthase [Escherichia coli TA280]
          Length = 320

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 8   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 65

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 66  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 125

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 126 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 185

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 186 LESRIRAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRL 245

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 246 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 305

Query: 301 NKNVF 305
            + + 
Sbjct: 306 AREIL 310


>gi|300939977|ref|ZP_07154605.1| porphobilinogen deaminase [Escherichia coli MS 21-1]
 gi|300455181|gb|EFK18674.1| porphobilinogen deaminase [Escherichia coli MS 21-1]
          Length = 320

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 8   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 65

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+  +SL  
Sbjct: 66  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYESLDA 125

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 126 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 185

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 186 LESRIRAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRL 245

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 246 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 305

Query: 301 NKNVF 305
            + + 
Sbjct: 306 AREIL 310


>gi|86148167|ref|ZP_01066465.1| porphobilinogen deaminase [Vibrio sp. MED222]
 gi|218710949|ref|YP_002418570.1| porphobilinogen deaminase [Vibrio splendidus LGP32]
 gi|254800262|sp|B7VMD9|HEM3_VIBSL RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|85834014|gb|EAQ52174.1| porphobilinogen deaminase [Vibrio sp. MED222]
 gi|218323968|emb|CAV20330.1| Porphobilinogen deaminase [Vibrio splendidus LGP32]
          Length = 312

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 112/306 (36%), Positives = 173/306 (56%), Gaps = 3/306 (0%)

Query: 1   MEKK-PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M    P RI TR SPLAL  A+  R +L   H  P   + ++ + TKGD I +  L ++G
Sbjct: 1   MTNSAPIRIATRKSPLALWQAYFVRDALQAAH--PGLEVELVTMVTKGDIILDTPLAKVG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T  ++ 
Sbjct: 59  GKGLFVKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYNNID 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           +L   +V+GT SLRR+  LL +R D+ + + RG + TRL KL++ +  AI+LA AG+KRL
Sbjct: 119 ELPQGAVVGTCSLRRQCQLLEYRPDLIIKELRGNVGTRLGKLDDGQYDAIVLAAAGLKRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
           + E+ I+  +  E   P+ GQGA+ IE  +++ +  +L++ +NH+DT D V CERA    
Sbjct: 179 ELEERIRSFIEPEQSLPAVGQGAVGIECRLDDERLIKLLEPLNHKDTADRVLCERAMNLT 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I  ++   G  ++   +V   DG        +G R DA  +G   A  +   
Sbjct: 239 LEGGCQVPIGSYSLLDGDNIWLRALVGEPDGSKMVRGEISGLRKDAEALGVTLANQLLDD 298

Query: 300 SNKNVF 305
             + + 
Sbjct: 299 GAREIL 304


>gi|193065671|ref|ZP_03046736.1| porphobilinogen deaminase [Escherichia coli E22]
 gi|194429243|ref|ZP_03061771.1| porphobilinogen deaminase [Escherichia coli B171]
 gi|192926638|gb|EDV81267.1| porphobilinogen deaminase [Escherichia coli E22]
 gi|194412755|gb|EDX29049.1| porphobilinogen deaminase [Escherichia coli B171]
 gi|320198489|gb|EFW73090.1| Porphobilinogen deaminase [Escherichia coli EC4100B]
          Length = 318

 Score =  285 bits (728), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 6   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 63

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 64  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 123

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 124 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 183

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 184 LESRIRAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRL 243

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   +A  +G   A+ +    
Sbjct: 244 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQNAEQMGISLAEELLNNG 303

Query: 301 NKNVF 305
            + + 
Sbjct: 304 AREIL 308


>gi|200388118|ref|ZP_03214730.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|199605216|gb|EDZ03761.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
          Length = 320

 Score =  285 bits (728), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 161/305 (52%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   + +LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 8   MLDNVLRIATRQSPLALWQAHYVKDALMATH--PGLTVELVPMVTRGDVILDTPLAKVGG 65

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P     GL +     RED RD F+S+   SL D
Sbjct: 66  KGLFVKELEIALLEKRADIAVHSMKDVPVAFPDGLGLVTICEREDPRDAFVSNKYHSLDD 125

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL KL+N    AI+LA AG+KRL 
Sbjct: 126 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLGKLDNGDYDAIILAVAGLKRLG 185

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  +   P+ GQGA+ IE  +++ + Q L+  +NH  T   V  ERA    L
Sbjct: 186 LESRIRTALPPDVSLPAVGQGAVGIECRLDDARTQALLAPLNHSQTALRVTAERAMNTRL 245

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG +     R G+   A  +G   A+ +    
Sbjct: 246 EGGCQVPIGSYAEIINGEIWLRALVGAPDGSVIVRGERRGSPEQAEQMGISLAEELLENG 305

Query: 301 NKNVF 305
            + + 
Sbjct: 306 ARAIL 310


>gi|209921277|ref|YP_002295361.1| porphobilinogen deaminase [Escherichia coli SE11]
 gi|218556364|ref|YP_002389278.1| porphobilinogen deaminase [Escherichia coli IAI1]
 gi|218697519|ref|YP_002405186.1| porphobilinogen deaminase [Escherichia coli 55989]
 gi|256021454|ref|ZP_05435319.1| porphobilinogen deaminase [Shigella sp. D9]
 gi|260846422|ref|YP_003224200.1| hydroxymethylbilane synthase HemC [Escherichia coli O103:H2 str.
           12009]
 gi|260857792|ref|YP_003231683.1| hydroxymethylbilane synthase HemC [Escherichia coli O26:H11 str.
           11368]
 gi|260870527|ref|YP_003236929.1| hydroxymethylbilane synthase HemC [Escherichia coli O111:H- str.
           11128]
 gi|293417268|ref|ZP_06659893.1| porphobilinogen deaminase [Escherichia coli B185]
 gi|293468119|ref|ZP_06664531.1| porphobilinogen deaminase [Escherichia coli B088]
 gi|331670648|ref|ZP_08371485.1| hydroxymethylbilane synthase [Escherichia coli TA271]
 gi|226706285|sp|B6I4E0|HEM3_ECOSE RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|226740635|sp|B7M603|HEM3_ECO8A RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|254800249|sp|B7L959|HEM3_ECO55 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|209914536|dbj|BAG79610.1| porphobilinogen deaminase [Escherichia coli SE11]
 gi|218354251|emb|CAV00923.1| hydroxymethylbilane synthase [Escherichia coli 55989]
 gi|218363133|emb|CAR00774.1| hydroxymethylbilane synthase [Escherichia coli IAI1]
 gi|257756441|dbj|BAI27943.1| hydroxymethylbilane synthase HemC [Escherichia coli O26:H11 str.
           11368]
 gi|257761569|dbj|BAI33066.1| hydroxymethylbilane synthase HemC [Escherichia coli O103:H2 str.
           12009]
 gi|257766883|dbj|BAI38378.1| hydroxymethylbilane synthase HemC [Escherichia coli O111:H- str.
           11128]
 gi|291321497|gb|EFE60935.1| porphobilinogen deaminase [Escherichia coli B088]
 gi|291431036|gb|EFF04031.1| porphobilinogen deaminase [Escherichia coli B185]
 gi|323155206|gb|EFZ41390.1| porphobilinogen deaminase [Escherichia coli EPECa14]
 gi|323182576|gb|EFZ67980.1| porphobilinogen deaminase [Escherichia coli 1357]
 gi|323380839|gb|ADX53107.1| porphobilinogen deaminase [Escherichia coli KO11]
 gi|323943796|gb|EGB39891.1| porphobilinogen deaminase [Escherichia coli H120]
 gi|324115735|gb|EGC09670.1| porphobilinogen deaminase [Escherichia coli E1167]
 gi|331062121|gb|EGI34043.1| hydroxymethylbilane synthase [Escherichia coli TA271]
          Length = 313

 Score =  285 bits (728), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 59  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 179 LESRIRAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   +A  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQNAEQMGISLAEELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|119776386|ref|YP_929126.1| porphobilinogen deaminase [Shewanella amazonensis SB2B]
 gi|119768886|gb|ABM01457.1| Hydroxymethylbilane synthase [Shewanella amazonensis SB2B]
          Length = 326

 Score =  285 bits (728), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 115/306 (37%), Positives = 172/306 (56%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLA+  A   ++ L  +H  P   + ++P+STKGD I +  L ++GG
Sbjct: 17  MSQNLIRIATRKSPLAMWQAEFVKAELERIH--PDLTVELLPMSTKGDVILDTPLAKVGG 74

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T +S+ +
Sbjct: 75  KGLFVKELEVAMLEGRADIAVHSMKDVPVDFPEGLGLEVICEREDPRDAFVSNTYKSIDE 134

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L   R D+ + D RG + TRL KL++ +  AI+LA AG+ RLK
Sbjct: 135 LPQGAVVGTSSLRRQCQLRARRPDLIIKDLRGNVGTRLAKLDSGEYDAIILAAAGLIRLK 194

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I   ++ E+  P+ GQGA+ IE   N+ + + L+  + H++T   V  ERA    L
Sbjct: 195 LAERIAGFISTEESLPANGQGAVGIECRTNDERVKALLAPLEHKETRLRVLAERAMNTRL 254

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  FA  +  TL   G+V   DG      S  G+  DAI +G   A  +    
Sbjct: 255 EGGCQVPIGAFAEIEADTLTLRGLVGNPDGSEVITGSVTGSTADAIALGHQLADDLLSRG 314

Query: 301 NKNVFN 306
            K + +
Sbjct: 315 AKTILD 320


>gi|218560868|ref|YP_002393781.1| porphobilinogen deaminase [Escherichia coli S88]
 gi|218692081|ref|YP_002400293.1| porphobilinogen deaminase [Escherichia coli ED1a]
 gi|226740633|sp|B7MH66|HEM3_ECO45 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|254800250|sp|B7N295|HEM3_ECO81 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|218367637|emb|CAR05420.1| hydroxymethylbilane synthase [Escherichia coli S88]
 gi|218429645|emb|CAR10466.1| hydroxymethylbilane synthase [Escherichia coli ED1a]
 gi|323949314|gb|EGB45204.1| porphobilinogen deaminase [Escherichia coli H252]
 gi|323954009|gb|EGB49807.1| porphobilinogen deaminase [Escherichia coli H263]
          Length = 313

 Score =  285 bits (728), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 114/305 (37%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+T  SL  
Sbjct: 59  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICKREDPRDAFVSNTYDSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 179 LESRIRAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|215489131|ref|YP_002331562.1| porphobilinogen deaminase [Escherichia coli O127:H6 str. E2348/69]
 gi|215267203|emb|CAS11651.1| hydroxymethylbilane synthase HemC [Escherichia coli O127:H6 str.
           E2348/69]
          Length = 320

 Score =  285 bits (728), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 114/305 (37%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 8   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 65

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+T  SL  
Sbjct: 66  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNTYDSLDA 125

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 126 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 185

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 186 LESRIRAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRL 245

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 246 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 305

Query: 301 NKNVF 305
            + + 
Sbjct: 306 AREIL 310


>gi|161505549|ref|YP_001572661.1| porphobilinogen deaminase [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|189028154|sp|A9MJ10|HEM3_SALAR RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|160866896|gb|ABX23519.1| hypothetical protein SARI_03714 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 313

 Score =  285 bits (728), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 111/305 (36%), Positives = 159/305 (52%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     +I TR SPLAL  A   + +LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLKIATRQSPLALWQAHYVKDALMATH--PGLTVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P     GL +     RED RD F+S+   SL D
Sbjct: 59  KGLFVKELEIALLEKRADIAVHSMKDVPVAFPDGLGLVTICEREDPRDAFVSNQYHSLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL KL+N    AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLGKLDNGDYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I+  L  E   P+ GQGAI IE  +++ +   L+  +NH  T   V  ERA    L
Sbjct: 179 LASRIRTALPPEVSLPAVGQGAIGIECRLDDARTHALLAPLNHPQTALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG +     R G+   A  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAEIFNGEIWLRALVGAPDGSVMVRGERRGSPEQAEQMGISLAEELLENG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 ARAIL 303


>gi|85711585|ref|ZP_01042643.1| Porphobilinogen deaminase [Idiomarina baltica OS145]
 gi|85694737|gb|EAQ32677.1| Porphobilinogen deaminase [Idiomarina baltica OS145]
          Length = 310

 Score =  285 bits (728), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 103/305 (33%), Positives = 158/305 (51%), Gaps = 3/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR S LA+  A   ++ L  ++  P   I ++P+ST+GD I +  L +IGG
Sbjct: 1   MS-KTVRIATRKSKLAMWQAEHIQARLASLY--PELTIELVPMSTRGDIILDTPLAKIGG 57

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +   GL++      ED RD F+S+  QSL +
Sbjct: 58  KGLFVKELEAAMLEGRADLAVHSMKDLPVEFPPGLELHTICESEDPRDAFVSNHYQSLNE 117

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GT SLRR+  +      + + D RG ++TRL KL+  +  AI+LA +G+ RL+
Sbjct: 118 LPEGAVVGTCSLRRRCQVKERFPHLIINDLRGNVQTRLRKLDEGQFDAIILAASGLIRLE 177

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I   + +ED  P+ GQG + IE   ++ + + L++ +    T   V  ERA    L
Sbjct: 178 LGERITSFIPVEDSLPANGQGVLGIEVRSDDDEIKALLEPLQCPTTRFRVLAERAMNRRL 237

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  FA   G  L   G+V   DG         G    A  +G + A+ +    
Sbjct: 238 QGGCQVPIGAFAVVDGDHLSLRGLVGDPDGVEVIREEIQGPVEQAEALGIELAEKLLARG 297

Query: 301 NKNVF 305
              + 
Sbjct: 298 AGEIL 302


>gi|148204|gb|AAA67601.1| porphobilinogen deaminase [Escherichia coli str. K-12 substr.
           MG1655]
          Length = 320

 Score =  285 bits (728), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 163/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 8   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDXPLAKVGG 65

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 66  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 125

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 126 LPAGSIVGTSSLRRQCQLGERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 185

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 186 LESRIRAGLPPEISLPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAMNTRL 245

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V   DG       R G   DA  +G   A+ +    
Sbjct: 246 EGGCQVPIGSYAELIDGEIWLRALVGRPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 305

Query: 301 NKNVF 305
            + + 
Sbjct: 306 AREIL 310


>gi|59727198|gb|AAW92125.1| hydroxymethylbilane synthase [Enterobacter asburiae]
          Length = 313

 Score =  285 bits (728), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 161/305 (52%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  L   H      + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKQRLEACHS--GLRVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 59  KGLFVKELELALLENRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNHYDSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+ +   RG + TRL KL+N    AI+LA AG+KRL 
Sbjct: 119 LPKGSVVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLGKLDNGDYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH++T   V  ERA    L
Sbjct: 179 LESRIRVALPPELSLPAVGQGAVGIECRLDDARTRELLAPLNHDETAIRVKAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      L+   +V A DG       R G   DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELTEGELWLRALVGAPDGSQMVRGERRGKAQDAEQLGVSLAEELLDNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|82546156|ref|YP_410103.1| porphobilinogen deaminase [Shigella boydii Sb227]
 gi|300904058|ref|ZP_07121938.1| porphobilinogen deaminase [Escherichia coli MS 84-1]
 gi|301303699|ref|ZP_07209820.1| porphobilinogen deaminase [Escherichia coli MS 124-1]
 gi|81247567|gb|ABB68275.1| porphobilinogen deaminase [Shigella boydii Sb227]
 gi|300403938|gb|EFJ87476.1| porphobilinogen deaminase [Escherichia coli MS 84-1]
 gi|300840999|gb|EFK68759.1| porphobilinogen deaminase [Escherichia coli MS 124-1]
 gi|315254168|gb|EFU34136.1| porphobilinogen deaminase [Escherichia coli MS 85-1]
 gi|315296783|gb|EFU56075.1| porphobilinogen deaminase [Escherichia coli MS 16-3]
          Length = 320

 Score =  285 bits (728), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 8   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 65

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 66  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 125

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 126 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 185

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 186 LESRIRAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRL 245

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 246 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 305

Query: 301 NKNVF 305
            + + 
Sbjct: 306 AREIL 310


>gi|288550563|ref|ZP_06391088.1| hydroxymethylbilane synthase [Enterobacter cancerogenus ATCC 35316]
 gi|288314627|gb|EFC53565.1| hydroxymethylbilane synthase [Enterobacter cancerogenus ATCC 35316]
          Length = 318

 Score =  285 bits (728), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 111/305 (36%), Positives = 162/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  L   H      + ++P+ T+GD I +  L ++GG
Sbjct: 6   MLDNVLRIATRQSPLALWQAHYVKQRLEACHS--GLRVELVPMVTRGDVILDTPLAKVGG 63

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     R+D RD F+S+   SL  
Sbjct: 64  KGLFVKELELALLENRADIAVHSMKDVPVEFPQGLGLVTICERDDPRDAFVSNHYDSLDA 123

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           + + SV+GTSSLRR+  L   R D+ +   RG + TRL KL+N +  AI+LA AG+KRL 
Sbjct: 124 MPVGSVVGTSSLRRQCQLAERRPDLVIRSLRGNVGTRLGKLDNGEYDAIILAVAGLKRLD 183

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + + L+  +NH+DT   V  ERA    L
Sbjct: 184 LESRIRVALPPEFSLPAVGQGAVGIECRLDDDRTRALLAPLNHDDTAIRVKAERAMNTRL 243

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      L+   +V A DG       R G   DA  +G   A+ +    
Sbjct: 244 EGGCQVPIGSYAELSNGELWLRALVGAPDGSQMVRGERRGKPQDAEALGVSLAEELLNNG 303

Query: 301 NKNVF 305
            + + 
Sbjct: 304 AREIL 308


>gi|191166073|ref|ZP_03027908.1| porphobilinogen deaminase [Escherichia coli B7A]
 gi|190903849|gb|EDV63563.1| porphobilinogen deaminase [Escherichia coli B7A]
          Length = 313

 Score =  285 bits (728), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 163/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 59  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH  T   V  ERA    L
Sbjct: 179 LESRIRAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHKTALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   +A  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQNAEQMGISLAEELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|332534414|ref|ZP_08410254.1| porphobilinogen deaminase [Pseudoalteromonas haloplanktis ANT/505]
 gi|332036148|gb|EGI72623.1| porphobilinogen deaminase [Pseudoalteromonas haloplanktis ANT/505]
          Length = 312

 Score =  284 bits (727), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 108/307 (35%), Positives = 166/307 (54%), Gaps = 4/307 (1%)

Query: 1   MEKKP--FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEI 58
           M +K    RI TR S LAL  A   ++ L   H      + ++P+ST+GD I +  L +I
Sbjct: 1   MTEKTKLVRIATRKSALALWQAEFVKAELERFHA--DVRVELVPMSTQGDIILDTPLAKI 58

Query: 59  GGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSL 118
           GGKGLF +E+E+ ++ G  D AVHS KD+P +  +GL +     RED RD F+S+   +L
Sbjct: 59  GGKGLFVKELEQAMLDGRADIAVHSMKDVPVEFPQGLALHTICEREDPRDAFVSNNFANL 118

Query: 119 KDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR 178
             L   +++GTSSLRR+  +   R D+ + D RG + TRL KL++ +  AI+LA AG+ R
Sbjct: 119 SALPQGAIVGTSSLRRQCQIKALRPDLDIRDLRGNVNTRLGKLDDGQYDAIILAAAGLIR 178

Query: 179 LKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLA 238
           L+ E  I + +  E   P+ GQGA+ IE  +++   + L+  + H  T   VN ER+   
Sbjct: 179 LEMESRIADYIEPEVSLPANGQGAVGIECRIDDEVTKALLAPLEHTQTRIRVNAERSMNR 238

Query: 239 ELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRF 298
            L+G C+  I  +A   G  ++  G+V A DG         G+  DA  IG + A+ +  
Sbjct: 239 YLEGGCQVPIGAYALVDGEQVHLRGLVGAVDGSEILRDEVTGHVNDAEKIGIELAKKLLA 298

Query: 299 ISNKNVF 305
                + 
Sbjct: 299 QGADKIL 305


>gi|26250543|ref|NP_756583.1| porphobilinogen deaminase [Escherichia coli CFT073]
 gi|110644128|ref|YP_671858.1| porphobilinogen deaminase [Escherichia coli 536]
 gi|227888613|ref|ZP_04006418.1| hydroxymethylbilane synthase [Escherichia coli 83972]
 gi|300979364|ref|ZP_07174522.1| porphobilinogen deaminase [Escherichia coli MS 200-1]
 gi|300985714|ref|ZP_07177569.1| porphobilinogen deaminase [Escherichia coli MS 45-1]
 gi|301047316|ref|ZP_07194402.1| porphobilinogen deaminase [Escherichia coli MS 185-1]
 gi|26110973|gb|AAN83157.1|AE016769_272 Porphobilinogen deaminase [Escherichia coli CFT073]
 gi|110345720|gb|ABG71957.1| porphobilinogen deaminase [Escherichia coli 536]
 gi|227834452|gb|EEJ44918.1| hydroxymethylbilane synthase [Escherichia coli 83972]
 gi|300300835|gb|EFJ57220.1| porphobilinogen deaminase [Escherichia coli MS 185-1]
 gi|300308036|gb|EFJ62556.1| porphobilinogen deaminase [Escherichia coli MS 200-1]
 gi|300407988|gb|EFJ91526.1| porphobilinogen deaminase [Escherichia coli MS 45-1]
 gi|307555929|gb|ADN48704.1| porphobilinogen deaminase [Escherichia coli ABU 83972]
 gi|315293155|gb|EFU52507.1| porphobilinogen deaminase [Escherichia coli MS 153-1]
 gi|324007476|gb|EGB76695.1| porphobilinogen deaminase [Escherichia coli MS 57-2]
 gi|324014708|gb|EGB83927.1| porphobilinogen deaminase [Escherichia coli MS 60-1]
          Length = 320

 Score =  284 bits (727), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 114/305 (37%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 8   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 65

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+T  SL  
Sbjct: 66  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNTYDSLDA 125

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 126 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 185

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 186 LESRIRAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRL 245

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 246 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 305

Query: 301 NKNVF 305
            + + 
Sbjct: 306 AREIL 310


>gi|315178740|gb|ADT85654.1| porphobilinogen deaminase [Vibrio furnissii NCTC 11218]
          Length = 312

 Score =  284 bits (727), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 110/304 (36%), Positives = 167/304 (54%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
              P RI TR SPLAL  A   + +L   H  P   + ++ + T+GD I +  L ++GGK
Sbjct: 3   STTPIRIATRQSPLALWQAHFVKDALQAAH--PGLEVELVTMVTRGDVILDTPLAKVGGK 60

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T  SL +L
Sbjct: 61  GLFVKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYASLDEL 120

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +++GT SLRR+  L   R D+ + + RG + TRL KL+  +  AI+LA AG+KRLK 
Sbjct: 121 PHGAIVGTCSLRRQCQLKEARPDLVIKELRGNVGTRLGKLDAGEYDAIILAAAGLKRLKL 180

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E+ I+ ++  E   P+ GQGA+ IE  +++ + + L+  ++  DT D V CERA    L+
Sbjct: 181 EQRIRSLIEPEQSLPAVGQGAVGIECRLDDARLRALLAPLSDADTTDRVLCERAMNLTLE 240

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I  +A   G  L+   +V   DG         G R DA  +G + A  +     
Sbjct: 241 GGCQVPIGSYALLDGDDLWLRALVGEPDGSHIVRGEIRGPRQDAERLGVELANQLLADGA 300

Query: 302 KNVF 305
           +++ 
Sbjct: 301 RDIL 304


>gi|160877198|ref|YP_001556514.1| porphobilinogen deaminase [Shewanella baltica OS195]
 gi|189028155|sp|A9L5G0|HEM3_SHEB9 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|160862720|gb|ABX51254.1| porphobilinogen deaminase [Shewanella baltica OS195]
 gi|315269402|gb|ADT96255.1| porphobilinogen deaminase [Shewanella baltica OS678]
          Length = 310

 Score =  284 bits (727), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 111/306 (36%), Positives = 170/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLA+  A   ++ L  +H  P   + ++P+STKGD I +  L ++GG
Sbjct: 1   MSENRIRIATRKSPLAMWQAEFVKAELERIH--PGIVVELLPMSTKGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++    D AVHS KD+P    +GL +     RED RD F+S+  +S+ +
Sbjct: 59  KGLFVKELEVAMLDDLADIAVHSMKDVPVDFPEGLGLEVICEREDPRDAFVSNLYKSISE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L L + +GTSSLRR+  +   R D+ + D RG + TRL KL+N +  AI+LA AG+ RLK
Sbjct: 119 LPLGATVGTSSLRRQCQIRASRPDLIIKDLRGNVGTRLAKLDNGEYDAIILAAAGLIRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I   ++ E+  P+ GQGA+ IE  +N+ + + L+  + H +T   V  ERA    L
Sbjct: 179 LSERIASFISAEESLPANGQGAVGIECRINDERVKALLAPLEHLETRYRVLAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  FA   G  +   G+V   DG    E    G + DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGAFAEIDGDEMTLRGLVGNPDGSEIIEGVITGPKTDATQLGVALAEELLSKG 298

Query: 301 NKNVFN 306
            K++ +
Sbjct: 299 AKSILD 304


>gi|157156845|ref|YP_001465286.1| porphobilinogen deaminase [Escherichia coli E24377A]
 gi|300818726|ref|ZP_07098933.1| porphobilinogen deaminase [Escherichia coli MS 107-1]
 gi|300823336|ref|ZP_07103467.1| porphobilinogen deaminase [Escherichia coli MS 119-7]
 gi|300921486|ref|ZP_07137834.1| porphobilinogen deaminase [Escherichia coli MS 115-1]
 gi|300923304|ref|ZP_07139352.1| porphobilinogen deaminase [Escherichia coli MS 182-1]
 gi|301328438|ref|ZP_07221519.1| porphobilinogen deaminase [Escherichia coli MS 78-1]
 gi|307313621|ref|ZP_07593241.1| porphobilinogen deaminase [Escherichia coli W]
 gi|331679912|ref|ZP_08380575.1| hydroxymethylbilane synthase [Escherichia coli H591]
 gi|332282690|ref|ZP_08395103.1| porphobilinogen deaminase [Shigella sp. D9]
 gi|157078875|gb|ABV18583.1| porphobilinogen deaminase [Escherichia coli E24377A]
 gi|300411603|gb|EFJ94913.1| porphobilinogen deaminase [Escherichia coli MS 115-1]
 gi|300420390|gb|EFK03701.1| porphobilinogen deaminase [Escherichia coli MS 182-1]
 gi|300524122|gb|EFK45191.1| porphobilinogen deaminase [Escherichia coli MS 119-7]
 gi|300528692|gb|EFK49754.1| porphobilinogen deaminase [Escherichia coli MS 107-1]
 gi|300845148|gb|EFK72908.1| porphobilinogen deaminase [Escherichia coli MS 78-1]
 gi|306906602|gb|EFN37114.1| porphobilinogen deaminase [Escherichia coli W]
 gi|315063097|gb|ADT77424.1| hydroxymethylbilane synthase [Escherichia coli W]
 gi|324016226|gb|EGB85445.1| porphobilinogen deaminase [Escherichia coli MS 117-3]
 gi|331072459|gb|EGI43791.1| hydroxymethylbilane synthase [Escherichia coli H591]
 gi|332105042|gb|EGJ08388.1| porphobilinogen deaminase [Shigella sp. D9]
          Length = 320

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 8   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 65

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 66  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 125

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 126 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 185

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 186 LESRIRAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRL 245

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   +A  +G   A+ +    
Sbjct: 246 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQNAEQMGISLAEELLNNG 305

Query: 301 NKNVF 305
            + + 
Sbjct: 306 AREIL 310


>gi|83643194|ref|YP_431629.1| porphobilinogen deaminase [Hahella chejuensis KCTC 2396]
 gi|123753698|sp|Q2SQ70|HEM3_HAHCH RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|83631237|gb|ABC27204.1| porphobilinogen deaminase [Hahella chejuensis KCTC 2396]
          Length = 311

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 110/306 (35%), Positives = 162/306 (52%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M K+   I TR S LAL  A   +  L  +H  P   + ++ L+TKGD I +  L ++GG
Sbjct: 1   MPKQHLVIATRQSALALWQAEHVKQRLEALH--PGLTVELLGLTTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +   GL + A L RE   D F+S+   SL +
Sbjct: 59  KGLFVKELETAMLEGRADIAVHSMKDVPMEFPPGLGLGAILERETPMDAFVSNQYASLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L   R D+ ++  RG + TRL KL+     AI+LA +G+KRL 
Sbjct: 119 LPEGAVVGTSSLRRQCQLSERRPDLKILSLRGNVNTRLAKLDAGDFDAIILAASGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I+E L  E   P+ GQGA+ IE  +++P+A  L+  +   +T   V+ ERA    L
Sbjct: 179 FSGRIREELTPEVSLPAVGQGALGIECRLDDPEAMALIAQLQDAETTARVSAERAMNHRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  IAG+A   G  +   G+V + DG         G    A  +G + A+ +    
Sbjct: 239 QGGCQVPIAGYAEITGDQMRLRGLVGSPDGAQVLRDEVEGPVAAAEALGTELAERLLQQG 298

Query: 301 NKNVFN 306
              +  
Sbjct: 299 AGKILE 304


>gi|157144433|ref|YP_001451752.1| porphobilinogen deaminase [Citrobacter koseri ATCC BAA-895]
 gi|157081638|gb|ABV11316.1| hypothetical protein CKO_00147 [Citrobacter koseri ATCC BAA-895]
          Length = 318

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 111/305 (36%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   + +L+  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 6   MLDNVLRIATRQSPLALWQAHYVKDALIAQH--PGLVVELVPMVTRGDVILDTPLAKVGG 63

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   +L +
Sbjct: 64  KGLFVKELEVALLEKRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNQYNNLDE 123

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N    AI+LA AG+KRL 
Sbjct: 124 LPAGSIVGTSSLRRQCQLAERRPDLVIRSLRGNVGTRLSKLDNGDYDAIILAVAGLKRLG 183

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I+  L  E   P+ GQGA+ IE  +++ + Q L+  +NHE+T   V  ERA    L
Sbjct: 184 LTSRIRTALPPEISLPAVGQGAVGIECRLDDARTQALLAPLNHEETALRVKAERAMNTRL 243

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 244 EGGCQVPIGSYAEIIDGEVWLRALVGAPDGSQMIRGERRGLPQDAAQMGISLAEELLANG 303

Query: 301 NKNVF 305
            + + 
Sbjct: 304 ARAIL 308


>gi|84393564|ref|ZP_00992318.1| porphobilinogen deaminase [Vibrio splendidus 12B01]
 gi|84375843|gb|EAP92736.1| porphobilinogen deaminase [Vibrio splendidus 12B01]
          Length = 312

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 112/306 (36%), Positives = 172/306 (56%), Gaps = 3/306 (0%)

Query: 1   MEKK-PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M    P RI TR SPLAL  A+  R +L   H  P   + ++ + TKGD I +  L ++G
Sbjct: 1   MTNSAPIRIATRKSPLALWQAYFVRDALQAAH--PGLEVELVTMVTKGDIILDTPLAKVG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  ++ G  D AVHS KD+P    KGL +     RED RD F+S+T  ++ 
Sbjct: 59  GKGLFVKELEVAMLEGRADLAVHSMKDVPVDFPKGLGLVTICEREDPRDAFVSNTYNNID 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           +L   + +GT SLRR+  LL +R D+ + + RG + TRL KL++ +  AI+LA AG+KRL
Sbjct: 119 ELPQGAAVGTCSLRRQCQLLEYRPDLIIKELRGNVGTRLGKLDDGQYDAIVLAAAGLKRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
           + E+ I+  +  E   P+ GQGA+ IE  +++ +  +L++ +NH+DT D V CERA    
Sbjct: 179 ELEERIRSFIEPEQSLPAVGQGAVGIECRLDDERLIKLLEPLNHKDTADRVLCERAMNLT 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I  ++   G  ++   +V   DG        +G R DA  +G   A  +   
Sbjct: 239 LEGGCQVPIGSYSLLDGDNIWLRALVGEPDGSKMVRGEISGLRKDAEALGVTLANQLLDD 298

Query: 300 SNKNVF 305
             + + 
Sbjct: 299 GAREIL 304


>gi|91227534|ref|ZP_01261871.1| porphobilinogen deaminase [Vibrio alginolyticus 12G01]
 gi|91188558|gb|EAS74850.1| porphobilinogen deaminase [Vibrio alginolyticus 12G01]
          Length = 312

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 112/306 (36%), Positives = 170/306 (55%), Gaps = 3/306 (0%)

Query: 1   MEK-KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M +  P RI TR SPLAL  A+  + +L   H  P   + ++ + TKGD I +  L ++G
Sbjct: 1   MTQSTPIRIATRKSPLALWQAYFVKDALQAAH--PSLEVELVTMVTKGDVILDTPLAKVG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T   + 
Sbjct: 59  GKGLFVKELEIAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYSHID 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           +L   +V+GT SLRR+  L  +R DI + + RG + TRL KL+  +  AI+LA AG+KRL
Sbjct: 119 ELPQGAVVGTCSLRRQCQLKEYRPDIIIKELRGNVGTRLGKLDAGEYDAIILAAAGLKRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
           K E+ I+  +  E   P+ GQGA+ IE  +++ +  +L++ +NH+DT D V CERA    
Sbjct: 179 KLEERIRSFIEPEQSLPAVGQGAVGIECRLDDERLLKLLEPLNHQDTVDRVLCERAMNLT 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I  +A   G  ++   +V   DG         G+R D   +G   A  +   
Sbjct: 239 LEGGCQVPIGSYALLDGDNIWLRALVGEPDGSEIVRGEIRGHRKDGEALGVQLANELLDN 298

Query: 300 SNKNVF 305
             + + 
Sbjct: 299 GAREIL 304


>gi|331685522|ref|ZP_08386106.1| hydroxymethylbilane synthase [Escherichia coli H299]
 gi|331077223|gb|EGI48437.1| hydroxymethylbilane synthase [Escherichia coli H299]
          Length = 313

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 59  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 179 LESRIRAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG +     R G   DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSLIIRGERRGAPQDAEQMGISLAEELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|91213326|ref|YP_543312.1| porphobilinogen deaminase [Escherichia coli UTI89]
 gi|117626062|ref|YP_859385.1| porphobilinogen deaminase [Escherichia coli APEC O1]
 gi|237702812|ref|ZP_04533293.1| porphobilinogen deaminase [Escherichia sp. 3_2_53FAA]
 gi|91074900|gb|ABE09781.1| porphobilinogen deaminase [Escherichia coli UTI89]
 gi|115515186|gb|ABJ03261.1| porphobilinogen deaminase [Escherichia coli APEC O1]
 gi|226902983|gb|EEH89242.1| porphobilinogen deaminase [Escherichia sp. 3_2_53FAA]
 gi|294490567|gb|ADE89323.1| porphobilinogen deaminase [Escherichia coli IHE3034]
 gi|307628866|gb|ADN73170.1| porphobilinogen deaminase [Escherichia coli UM146]
 gi|315284723|gb|EFU44168.1| porphobilinogen deaminase [Escherichia coli MS 110-3]
          Length = 320

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 114/305 (37%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 8   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 65

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+T  SL  
Sbjct: 66  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICKREDPRDAFVSNTYDSLDA 125

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 126 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 185

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 186 LESRIRAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRL 245

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 246 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 305

Query: 301 NKNVF 305
            + + 
Sbjct: 306 AREIL 310


>gi|260767548|ref|ZP_05876484.1| porphobilinogen deaminase [Vibrio furnissii CIP 102972]
 gi|260617448|gb|EEX42631.1| porphobilinogen deaminase [Vibrio furnissii CIP 102972]
          Length = 312

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 109/304 (35%), Positives = 167/304 (54%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
              P RI TR SPLAL  A   + +L   H  P   + ++ + T+GD I +  L ++GGK
Sbjct: 3   STTPIRIATRQSPLALWQAHFVKDALQAAH--PGLEVELVTMVTRGDVILDTPLAKVGGK 60

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T  SL +L
Sbjct: 61  GLFVKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYASLDEL 120

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +++GT SLRR+  L   R D+ + + RG + TRL KL+  +  AI+LA AG+KRL+ 
Sbjct: 121 PHGAIVGTCSLRRQCQLKEARPDLVIKELRGNVGTRLGKLDAGEYDAIILAAAGLKRLQL 180

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E+ I+ ++  E   P+ GQGA+ IE  +++ + + L+  ++  DT D V CERA    L+
Sbjct: 181 EQRIRSLIEPEQSLPAVGQGAVGIECRLDDARLRALLAPLSDADTTDRVLCERAMNLTLE 240

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I  +A   G  L+   +V   DG         G R DA  +G + A  +     
Sbjct: 241 GGCQVPIGSYALLDGDDLWLRALVGEPDGSHIVRGEIRGPRQDAERLGVELANQLLADGA 300

Query: 302 KNVF 305
           +++ 
Sbjct: 301 RDIL 304


>gi|24375795|ref|NP_719838.1| porphobilinogen deaminase [Shewanella oneidensis MR-1]
 gi|39931562|sp|Q8E9H0|HEM3_SHEON RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|24350743|gb|AAN57282.1|AE015863_11 porphobilinogen deaminase [Shewanella oneidensis MR-1]
          Length = 310

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 111/306 (36%), Positives = 170/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLA+  A   ++ L  +H  P   + ++P+STKGD I +  L ++GG
Sbjct: 1   MSENRIRIATRKSPLAMWQAEFVKAELERIH--PGIVVELLPMSTKGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++  + D AVHS KD+P    +GL +     RED RD F+S+  +S+ +
Sbjct: 59  KGLFVKELEVAMLEDQADIAVHSMKDVPVDFPEGLGLEVICEREDPRDAFVSNIYKSISE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L L + +GTSSLRR+  L   R D+ + D RG + TRL KL+N +  AI+LA AG+ RLK
Sbjct: 119 LPLGATVGTSSLRRQCQLRASRPDLIIKDLRGNVGTRLAKLDNGEYDAIILAAAGLIRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I   ++ E+  P+ GQGA+ IE   N+ + + L+  + H +T   V  ERA    L
Sbjct: 179 LSERIASFISAEESLPANGQGAVGIECRTNDERVKALLAPLEHLETRYRVIAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  FA   G  +   G+V   DG    E    G + +A  +G   A+ +    
Sbjct: 239 EGGCQVPIGAFAEIDGDEMTLRGLVGNPDGSEIIEGVITGPKTEATQLGVALAEELLSKG 298

Query: 301 NKNVFN 306
            K++ +
Sbjct: 299 AKSILD 304


>gi|157834325|pdb|1YPN|A Chain A, Reduced Form Hydroxymethylbilane Synthase (K59q Mutant)
           Crystal Structure After 2 Hours In A Flow Cell
           Determined By Time-Resolved Laue Diffraction
          Length = 313

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           +GLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 59  QGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 179 LESRIRAALPPEISLPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|330908104|gb|EGH36623.1| porphobilinogen deaminase [Escherichia coli AA86]
          Length = 318

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 6   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 63

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 64  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 123

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 124 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 183

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 184 LESRIRAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRL 243

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG +     R G   DA  +G   A+ +    
Sbjct: 244 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSLIIRGERRGAPQDAEQMGISLAEELLNNG 303

Query: 301 NKNVF 305
            + + 
Sbjct: 304 AREIL 308


>gi|242237686|ref|YP_002985867.1| porphobilinogen deaminase [Dickeya dadantii Ech703]
 gi|242129743|gb|ACS84045.1| porphobilinogen deaminase [Dickeya dadantii Ech703]
          Length = 313

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 108/305 (35%), Positives = 162/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  L   H  P   + ++P+ T+GD + +  L ++GG
Sbjct: 1   MVDNILRIATRQSPLALWQAHYVQQRLQACH--PGLRVELVPMVTRGDVLLDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +    L +     R+D RD F+S+   +L  
Sbjct: 59  KGLFVKELELALLEDRADIAVHSMKDVPVEFPAQLGLVTICERDDPRDAFVSNRYANLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L   R D+ + D RG + TRL KL+N    AI+LA AG+ RL 
Sbjct: 119 LPPGAVVGTSSLRRQCQLRARRPDLVIRDLRGNVGTRLGKLDNGDYDAIILAVAGLNRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L+ E   P+ GQGA+ +E  +++ + + L+  +NH+DT   V  ERA    L
Sbjct: 179 LEGRIRAALSPEQSLPAVGQGAVGVECRLDDTRTRALLAPLNHDDTAARVLAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +G  ++   +V + DG       R G R DA  +G   A  +    
Sbjct: 239 EGGCQVPIGSYAELQGDAIWLRALVGSPDGSRIIRGERTGRRQDAEQLGISLADELLAAG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|323167552|gb|EFZ53258.1| porphobilinogen deaminase [Shigella sonnei 53G]
          Length = 313

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 59  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 179 LESRIRAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   +A  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQNAKQMGISLAEELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|309796256|ref|ZP_07690666.1| porphobilinogen deaminase [Escherichia coli MS 145-7]
 gi|308120138|gb|EFO57400.1| porphobilinogen deaminase [Escherichia coli MS 145-7]
          Length = 320

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 163/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 8   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 65

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 66  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 125

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 126 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 185

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH  T   V  ERA    L
Sbjct: 186 LESRIRAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHKTALRVTAERAMNTRL 245

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   +A  +G   A+ +    
Sbjct: 246 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQNAEQMGISLAEELLNNG 305

Query: 301 NKNVF 305
            + + 
Sbjct: 306 AREIL 310


>gi|281180853|dbj|BAI57183.1| porphobilinogen deaminase [Escherichia coli SE15]
          Length = 313

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 59  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 179 LESRIRAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG +     R G   DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSLIIRGERRGAPQDAEQMGISLAEELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|50123108|ref|YP_052275.1| porphobilinogen deaminase [Pectobacterium atrosepticum SCRI1043]
 gi|55976381|sp|Q6CZG3|HEM3_ERWCT RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|49613634|emb|CAG77085.1| porphobilinogen deaminase [Pectobacterium atrosepticum SCRI1043]
          Length = 313

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 118/305 (38%), Positives = 171/305 (56%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  L   H  P  ++ ++P+ T+GD I +  L ++GG
Sbjct: 1   MLANIIRIATRQSPLALWQARYVQQCL--NHFYPDLHVELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P +   GL ++    R+D RD F+S+   SL+ 
Sbjct: 59  KGLFVKELELALLEGRADIAVHSMKDVPVEFPDGLGLTTICERDDPRDAFVSNRYDSLEQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S +GTSSLRR+  L   R D+ + D RG + TRL KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPEGSCVGTSSLRRQCQLRARRPDLVIRDLRGNVGTRLAKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I+  L+ E+  P+ GQGAI IE  +++ + ++L+  +NH DT   V  ERA    L
Sbjct: 179 LEERIRCALSPEESLPAVGQGAIGIECRLDDDRIRQLLAPLNHTDTAARVLAERAMNVRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +G TL+   +V A DG       R G+  DA  IG   A+ +    
Sbjct: 239 EGGCQVPIGSYAELEGDTLWLRALVGAPDGSQMIVGERKGSVSDAEKIGVALAEELLAKG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 ASAIL 303


>gi|296105312|ref|YP_003615458.1| hydroxymethylbilane synthase [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295059771|gb|ADF64509.1| hydroxymethylbilane synthase [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 313

 Score =  283 bits (725), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 161/305 (52%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  L   H      + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKQRLEACHS--GLRVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 59  KGLFVKELELALLENRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNQFDSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+ +   RG + TRL KL+N    AI+LA AG+KRL 
Sbjct: 119 LPKGSVVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLGKLDNGDYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH++T   V  ERA    L
Sbjct: 179 LESRIRVALPPELSLPAVGQGAVGIECRLDDRRTRELLAPLNHDETAIRVKAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      L+   +V A DG       R G   DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELINGELWLRALVGAPDGSQMVRGERRGKPQDAEQLGISLAEELLDNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|217975048|ref|YP_002359799.1| porphobilinogen deaminase [Shewanella baltica OS223]
 gi|304412540|ref|ZP_07394146.1| porphobilinogen deaminase [Shewanella baltica OS183]
 gi|307307199|ref|ZP_07586937.1| porphobilinogen deaminase [Shewanella baltica BA175]
 gi|254800258|sp|B8E879|HEM3_SHEB2 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|217500183|gb|ACK48376.1| porphobilinogen deaminase [Shewanella baltica OS223]
 gi|304349182|gb|EFM13594.1| porphobilinogen deaminase [Shewanella baltica OS183]
 gi|306910438|gb|EFN40869.1| porphobilinogen deaminase [Shewanella baltica BA175]
          Length = 310

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 110/306 (35%), Positives = 170/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLA+  A   ++ L  +H  P   + ++P+STKGD I +  L ++GG
Sbjct: 1   MSENRIRIATRKSPLAMWQAEFVKAELERIH--PGIVVELLPMSTKGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++    D AVHS KD+P    +GL +     RED RD F+S+  +S+ +
Sbjct: 59  KGLFVKELEVAMLDDLADIAVHSMKDVPVDFPEGLGLEVICEREDPRDAFVSNLYKSISE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L L + +GTSSLRR+  +   R D+ + D RG + TRL KL+N +  AI+LA AG+ RLK
Sbjct: 119 LPLGATVGTSSLRRQCQIRASRPDLIIKDLRGNVGTRLAKLDNGEYDAIILAAAGLIRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I   ++ E+  P+ GQGA+ IE  +N+ + + L+  + H +T   V  ERA    L
Sbjct: 179 LSERIASFISAEESLPANGQGAVGIECRINDERVKALLAPLEHLETRYRVLAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  FA   G  +   G+V   DG    E    G + +A  +G   A+ +    
Sbjct: 239 EGGCQVPIGAFAEIDGDEMTLRGLVGNPDGSEIIEGVITGPKTEATQLGVALAEELLSKG 298

Query: 301 NKNVFN 306
            K++ +
Sbjct: 299 AKSILD 304


>gi|227325802|ref|ZP_03829826.1| porphobilinogen deaminase [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 313

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 116/305 (38%), Positives = 169/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  L   H  P  ++ ++P+ T+GD I +  L ++GG
Sbjct: 1   MLANIIRIATRQSPLALWQARYVQQCL--NHLYPDLHVELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P +   GL ++    R+D RD F+S+   SL+ 
Sbjct: 59  KGLFVKELELALLEGRADIAVHSMKDVPVEFPDGLGLTTICERDDPRDAFVSNHYDSLEQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S +GTSSLRR+  L   R D+ + D RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPEGSCVGTSSLRRQCQLRARRPDLVIRDLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I+  L+ E+  P+ GQGAI IE  +++   ++L+  +NH  T   V  ERA    L
Sbjct: 179 LEERIRCALSPEESLPAVGQGAIGIECRLDDEHVRQLLAPLNHPATAARVLAERAMNVRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +G TL+   +V A DG       R G   DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELEGDTLWLRALVGAPDGSQMIVGERKGRVSDAEQLGIALAEELLAKG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 ASAIL 303


>gi|260774857|ref|ZP_05883759.1| porphobilinogen deaminase [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609282|gb|EEX35437.1| porphobilinogen deaminase [Vibrio coralliilyticus ATCC BAA-450]
          Length = 312

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 110/306 (35%), Positives = 173/306 (56%), Gaps = 3/306 (0%)

Query: 1   MEK-KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M +  P RI TR SPLAL  A+  R +L   H  P   + ++ + TKGD I +  L ++G
Sbjct: 1   MTQSTPIRIATRKSPLALWQAYYVRDALQAAH--PGLEVELVTMVTKGDVILDTPLAKVG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T  ++ 
Sbjct: 59  GKGLFVKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYANID 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           +L   +V+GT SLRR+  +  +R D+ + + RG + TRL KL+  +  AI+LA AG+KRL
Sbjct: 119 ELPQGAVVGTCSLRRQCQIKEYRPDLVIKELRGNVGTRLGKLDAGEYDAIILAAAGLKRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
           + E+ I+  +  E   P+ GQGA+ IE  +++ +  +L++ +NH+DT D V CERA    
Sbjct: 179 ELEERIRSFIEPEQSLPAVGQGAVGIECRLDDERLIKLLEPLNHKDTADRVLCERAMNLT 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I  ++   G  ++   +V   DG         G+R DA  +G   A  +   
Sbjct: 239 LEGGCQVPIGSYSLLDGDDIWLRALVGEPDGSKIVRGEIKGSRADAEKLGVTLANQLLDD 298

Query: 300 SNKNVF 305
             +++ 
Sbjct: 299 GARDIL 304


>gi|187733255|ref|YP_001882498.1| porphobilinogen deaminase [Shigella boydii CDC 3083-94]
 gi|187430247|gb|ACD09521.1| porphobilinogen deaminase [Shigella boydii CDC 3083-94]
          Length = 320

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 8   MLDNVLRIATRQSPLALWQAHYVKDKLMTSH--PGLVVELVPMVTRGDVILDTPLAKVGG 65

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 66  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 125

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 126 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 185

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 186 LESRIRAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRL 245

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 246 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 305

Query: 301 NKNVF 305
            + + 
Sbjct: 306 AREIL 310


>gi|237727921|ref|ZP_04558402.1| porphobilinogen deaminase [Citrobacter sp. 30_2]
 gi|226910370|gb|EEH96288.1| porphobilinogen deaminase [Citrobacter sp. 30_2]
          Length = 318

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   + +LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 6   MLDNVLRIATRQSPLALWQAHYVKDALMANH--PGLIVELVPMVTRGDVILDTPLAKVGG 63

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +   GL +     RED RD F+S+   SL +
Sbjct: 64  KGLFVKELEVALLEKRADIAVHSMKDVPVEFPDGLGLVTICEREDPRDAFVSNKYNSLDE 123

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L + R D+ +   RG + TRL+KL+N    AI+LA AG+KRL 
Sbjct: 124 LPAGSIVGTSSLRRQCQLAKRRPDLVIRSLRGNVGTRLSKLDNGDYDAIILAVAGLKRLG 183

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  ++  L  E   P+ GQGA+ IE  +++ + Q L+  +NHE+T   V  ERA    L
Sbjct: 184 LESRVRTALPPEVSLPAVGQGAVGIECRLDDMRTQALLAPLNHEETALRVKAERAMNTRL 243

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 244 EGGCQVPIGSYAEIIDGEIWLRALVGAPDGSQMVCGERRGATQDAEQMGISLAEELLENG 303

Query: 301 NKNVF 305
            + + 
Sbjct: 304 ARAIL 308


>gi|301029020|ref|ZP_07192174.1| porphobilinogen deaminase [Escherichia coli MS 196-1]
 gi|299878014|gb|EFI86225.1| porphobilinogen deaminase [Escherichia coli MS 196-1]
          Length = 320

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 163/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 8   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 65

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S    SL  
Sbjct: 66  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSDNYDSLDA 125

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 126 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 185

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 186 LESRIRAALPPEISLPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAMNTRL 245

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 246 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 305

Query: 301 NKNVF 305
            + + 
Sbjct: 306 AREIL 310


>gi|283834568|ref|ZP_06354309.1| hydroxymethylbilane synthase [Citrobacter youngae ATCC 29220]
 gi|291069698|gb|EFE07807.1| hydroxymethylbilane synthase [Citrobacter youngae ATCC 29220]
          Length = 313

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   + +LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDALMANH--PGLIVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +   GL +     RED RD F+S+   +L D
Sbjct: 59  KGLFVKELEVALLEKRADIAVHSMKDVPVEFPDGLGLVTICEREDPRDAFVSNKYNTLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L + R D+ +   RG + TRL KL+N    AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAKRRPDLIIRSLRGNVGTRLGKLDNGDYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  ++  L  E   P+ GQGA+ IE  +++ + + L+  +NHE+T   V  ERA    L
Sbjct: 179 LESRVRTALPPEVSLPAVGQGAVGIECRLDDMRTRALLAPLNHEETALRVKAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELINGEIWLRALVGAPDGSQMVCGERRGAVQDAEQMGISLAEELLENG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 ARAIL 303


>gi|82779017|ref|YP_405366.1| porphobilinogen deaminase [Shigella dysenteriae Sd197]
 gi|81243165|gb|ABB63875.1| porphobilinogen deaminase [Shigella dysenteriae Sd197]
          Length = 320

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 8   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 65

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 66  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 125

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 126 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 185

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 186 LESRIRAALPPEISLPAVGQGAVGIECRLDDARTRELLVALNHHETALRVTAERAMNTRL 245

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 246 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 305

Query: 301 NKNVF 305
            + + 
Sbjct: 306 AREIL 310


>gi|323500165|ref|ZP_08105110.1| porphobilinogen deaminase [Vibrio sinaloensis DSM 21326]
 gi|323314794|gb|EGA67860.1| porphobilinogen deaminase [Vibrio sinaloensis DSM 21326]
          Length = 312

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 111/306 (36%), Positives = 171/306 (55%), Gaps = 3/306 (0%)

Query: 1   MEKK-PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M +  P RI TR SPLAL  A+  R +L   H  P   + ++ + TKGD I +  L ++G
Sbjct: 1   MTQSSPIRIATRKSPLALWQAYFVRDALQAAH--PGLEVELVTMVTKGDVILDTPLAKVG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T  S+ 
Sbjct: 59  GKGLFVKELEVAMLEGRADLAVHSMKDVPVDFPSGLGLVTICEREDPRDAFVSNTYNSID 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           +L   +V+GT SLRR+  L  +R D+ + + RG + TRL KL+  +  AI+LA AG+KRL
Sbjct: 119 ELPQGAVVGTCSLRRQCQLKEYRPDLIIKELRGNVGTRLGKLDAGEYDAIILAAAGLKRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
           + E+ I+  +  E   P+ GQGA+ IE  +++ +  +L++ +NH+DT D V CERA    
Sbjct: 179 ELEERIRSFIEPEQSLPAVGQGAVGIECRLDDERLIKLLEPLNHQDTADRVLCERAMNLT 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I  +A  +G  ++   +V   DG         G R ++  +G   A  +   
Sbjct: 239 LEGGCQVPIGSYALLEGDDIWLRALVGEPDGSQIVRGEIKGPRSESEALGIKLANQLLDE 298

Query: 300 SNKNVF 305
             + + 
Sbjct: 299 GAREIL 304


>gi|320178095|gb|EFW53075.1| Porphobilinogen deaminase [Shigella boydii ATCC 9905]
          Length = 559

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 59  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 179 LESRIRAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|110835183|ref|YP_694042.1| porphobilinogen deaminase [Alcanivorax borkumensis SK2]
 gi|123345297|sp|Q0VM28|HEM3_ALCBS RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|110648294|emb|CAL17770.1| porphobilinogen deaminase [Alcanivorax borkumensis SK2]
          Length = 310

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 110/305 (36%), Positives = 163/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M ++  RI TR SPLA+  A   +  L  +H+     + ++ + T+GD+I +  L +IGG
Sbjct: 1   MSREILRIATRSSPLAIWQAEYVQQRLESLHE--GLRVELVRIKTQGDKILDTPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ ++ G  D AVHS KD+P +L  G  +     RED RD F+S+T   L  
Sbjct: 59  KGLFVKELEEAMMDGRADIAVHSMKDVPMELPPGFALPVICEREDPRDAFVSNTFDGLSS 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +GTSSLRR+A +   R D+ V   RG ++TRL KL+     AI+LA AG+KRL+
Sbjct: 119 LPHGACVGTSSLRRQAQVKANRPDLVVNSLRGNVQTRLGKLDAGNFDAIILAAAGLKRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I+  +  E+  P+ GQGA+ IE    +    EL+  ++  DTWD V  ERA    L
Sbjct: 179 MHDRIRYEMPPEESLPAVGQGAVGIECREGDESTIELLSPLSDVDTWDRVVAERAMNRRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IAGFA  +   L+  G+V   DG           R     +G D A+ +    
Sbjct: 239 EGGCQVPIAGFALLEDGQLWLRGLVAEEDGSRVLRAEGTAPRGQGAELGIDIAEQLLAQG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 ADEIL 303


>gi|74314316|ref|YP_312735.1| porphobilinogen deaminase [Shigella sonnei Ss046]
 gi|73857793|gb|AAZ90500.1| porphobilinogen deaminase [Shigella sonnei Ss046]
          Length = 320

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 8   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 65

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 66  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 125

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 126 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 185

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 186 LESRIRAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRL 245

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   +A  +G   A+ +    
Sbjct: 246 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQNAKQMGISLAEELLNNG 305

Query: 301 NKNVF 305
            + + 
Sbjct: 306 AREIL 310


>gi|312963804|ref|ZP_07778275.1| Porphobilinogen deaminase [Pseudomonas fluorescens WH6]
 gi|311281839|gb|EFQ60449.1| Porphobilinogen deaminase [Pseudomonas fluorescens WH6]
          Length = 313

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 168/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLELAH--PGLKVSLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  E D AVHS KD+P    +GL +     RED RD F+S+T  SL +
Sbjct: 59  KGLFVKELETALLENEADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTYTSLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPPGSIVGTSSLRRQAQLLTRRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   +++ED  P+ GQGA+ IE    + +   L+K ++H DT   V  ERA    L
Sbjct: 179 FEDRITSAISVEDSLPAGGQGAVGIECRTADSEIHALLKPLDHHDTEVRVTAERALNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  ++  G+V   DG         G + DA  +G   A+ +    
Sbjct: 239 NGGCQVPIACYAVLEGDNIWLRGLVGDPDGGTLLTAQARGPQADATALGIQVAEELLEKG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 AGAIL 303


>gi|331649629|ref|ZP_08350711.1| hydroxymethylbilane synthase [Escherichia coli M605]
 gi|331041499|gb|EGI13647.1| hydroxymethylbilane synthase [Escherichia coli M605]
          Length = 320

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 8   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 65

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 66  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 125

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 126 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 185

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 186 LESRIRAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRL 245

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG +     R G   DA  +G   A+ +    
Sbjct: 246 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSLIIRGERRGAPQDAEQMGISLAEELLNNG 305

Query: 301 NKNVF 305
            + + 
Sbjct: 306 AREIL 310


>gi|126176187|ref|YP_001052336.1| porphobilinogen deaminase [Shewanella baltica OS155]
 gi|153002481|ref|YP_001368162.1| porphobilinogen deaminase [Shewanella baltica OS185]
 gi|166217785|sp|A3D9Q4|HEM3_SHEB5 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|166217786|sp|A6WTG0|HEM3_SHEB8 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|125999392|gb|ABN63467.1| porphobilinogen deaminase [Shewanella baltica OS155]
 gi|151367099|gb|ABS10099.1| porphobilinogen deaminase [Shewanella baltica OS185]
          Length = 310

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 110/306 (35%), Positives = 169/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLA+  A   ++ L  +H  P   + ++P+STKGD I +  L ++GG
Sbjct: 1   MSENRIRIATRKSPLAMWQAEFVKAELERIH--PGIVVELLPMSTKGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++    D AVHS KD+P    +GL +     RED RD F+S+  +S+ +
Sbjct: 59  KGLFVKELEVAMLDDLADIAVHSMKDVPVDFPEGLGLEVICEREDPRDAFVSNLYKSISE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L L + +GTSSLRR+  +   R D+ + D RG + TRL KL+N +  AI+LA AG+ RLK
Sbjct: 119 LPLGATVGTSSLRRQCQIRASRPDLIIKDLRGNVGTRLAKLDNGEYDAIILAAAGLIRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I   ++ E+  P+ GQGA+ IE  +N+ + + L+  + H +T   V  ERA    L
Sbjct: 179 LSERIASFISAEESLPANGQGAVGIECRINDERVKALLAPLEHLETRYRVLAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  FA   G  +   G+V   DG    E    G + +A  +G   A+ +    
Sbjct: 239 EGGCQVPIGAFAEIDGDEMTLRGLVGNPDGSEIIEGVITGPKTEATQLGVALAEELLSKG 298

Query: 301 NKNVFN 306
            K + +
Sbjct: 299 AKTILD 304


>gi|317046390|ref|YP_004114038.1| porphobilinogen deaminase [Pantoea sp. At-9b]
 gi|316948007|gb|ADU67482.1| porphobilinogen deaminase [Pantoea sp. At-9b]
          Length = 313

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 115/305 (37%), Positives = 163/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K FRI TR SPLAL  A   +  LM  H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 1   MLDKIFRIATRQSPLALWQAQYVQQRLMAAH--PGLQVELVPMVTKGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++    D AVHS KD+P    +GL +     RED RD F+S+   S+  
Sbjct: 59  KGLFVKELELAMLENRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNHYDSIDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L   R D+ +   RG + TRL KL+  +  AI+LA AG+KRL 
Sbjct: 119 LPQGAVVGTSSLRRQCQLSARRPDLVIRSLRGNVGTRLGKLDAGEYDAIILAAAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ +   L++ +N  DT   V  ERA    L
Sbjct: 179 LEDRIRFALPAEISLPAVGQGAVGIECRLDDAELITLLQALNDGDTAVCVRAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  FA  +G  L+  G+V + DG       R G R  A  +G   A+ +    
Sbjct: 239 EGGCQVPIGSFAVLEGDQLWLRGLVGSPDGSQMITGERRGPRDQAEQMGISLAEELLDNG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 ASEIL 303


>gi|113968732|ref|YP_732525.1| porphobilinogen deaminase [Shewanella sp. MR-4]
 gi|114049125|ref|YP_739675.1| porphobilinogen deaminase [Shewanella sp. MR-7]
 gi|117918843|ref|YP_868035.1| porphobilinogen deaminase [Shewanella sp. ANA-3]
 gi|123131000|sp|Q0HQI7|HEM3_SHESR RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|123325438|sp|Q0HN99|HEM3_SHESM RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|158512312|sp|A0KS60|HEM3_SHESA RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|113883416|gb|ABI37468.1| porphobilinogen deaminase [Shewanella sp. MR-4]
 gi|113890567|gb|ABI44618.1| porphobilinogen deaminase [Shewanella sp. MR-7]
 gi|117611175|gb|ABK46629.1| porphobilinogen deaminase [Shewanella sp. ANA-3]
          Length = 310

 Score =  283 bits (723), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 112/306 (36%), Positives = 170/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLA+  A   ++ L  VH  P   + ++P+STKGD I +  L ++GG
Sbjct: 1   MSENRIRIATRKSPLAMWQAEFVKAELERVH--PGIVVELLPMSTKGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++  + D AVHS KD+P    +GL +     RED RD F+S+  +S+ +
Sbjct: 59  KGLFVKELEVAMLEDQADIAVHSMKDVPVDFPEGLGLEVICEREDPRDAFVSNLYKSISE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L L + +GTSSLRR+  L   R D+ + D RG + TRL KL+N +  AI+LA AG+ RLK
Sbjct: 119 LPLGATVGTSSLRRQCQLRASRPDLIIKDLRGNVGTRLAKLDNGEYDAIILAAAGLIRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I   ++ E+  P+ GQGA+ IE   N+ + + L+  + H +T   V  ERA    L
Sbjct: 179 LSERIASFISAEESLPANGQGAVGIECRTNDERVKALLAPLEHLETRYRVIAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  FA   G  +   G+V   DG    E    G + +A  +G   A+ +    
Sbjct: 239 EGGCQVPIGAFAEIHGDEMTLRGLVGNPDGSEIIEGVITGPKTEATKLGVALAEELLSKG 298

Query: 301 NKNVFN 306
            K++ +
Sbjct: 299 AKSILD 304


>gi|315125211|ref|YP_004067214.1| porphobilinogen deaminase [Pseudoalteromonas sp. SM9913]
 gi|315013724|gb|ADT67062.1| porphobilinogen deaminase [Pseudoalteromonas sp. SM9913]
          Length = 312

 Score =  283 bits (723), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 106/307 (34%), Positives = 168/307 (54%), Gaps = 4/307 (1%)

Query: 1   MEKKP--FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEI 58
           M +K    RI TR S LAL  A   ++ L   H      + ++P+ST+GD I +  L +I
Sbjct: 1   MTEKTKLVRIATRKSALALWQAEFVKAQLEHFHD--DVRVELVPMSTQGDIILDTPLAKI 58

Query: 59  GGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSL 118
           GGKGLF +E+E+ ++ G  D AVHS KD+P +    L++     RED RD F+S+   ++
Sbjct: 59  GGKGLFVKELEQAMLDGRADIAVHSMKDVPVEFPDDLELHVICEREDPRDAFVSNNFANI 118

Query: 119 KDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR 178
             L   +++GTSSLRR+  +   R D+ + D RG + TRL KL++ +  AI+LA AG+ R
Sbjct: 119 DALPQGAIVGTSSLRRQCQIRALRPDLEIRDLRGNVNTRLAKLDSGQYDAIILAAAGLIR 178

Query: 179 LKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLA 238
           L+  + I++ +  E   P+ GQGA+ IE  +N+   + L+  + H +T   VN ERA   
Sbjct: 179 LEMGERIRDFIEPEVSLPANGQGAVGIECRINDEVTKALLAPLEHSETRIRVNAERAMNR 238

Query: 239 ELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRF 298
            L+G C+  I  +A   G  ++  G+V A DG        +G+  DA  +G + A+ +  
Sbjct: 239 HLEGGCQVPIGAYALVDGEQVHLRGLVGAIDGSEILRDEISGHVDDAEKLGVELAKKLLA 298

Query: 299 ISNKNVF 305
                + 
Sbjct: 299 QGADKIL 305


>gi|91791755|ref|YP_561406.1| porphobilinogen deaminase [Shewanella denitrificans OS217]
 gi|91713757|gb|ABE53683.1| porphobilinogen deaminase [Shewanella denitrificans OS217]
          Length = 315

 Score =  283 bits (723), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 106/306 (34%), Positives = 166/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLAL  A   ++ L  +H  P  ++ ++P++TKGD + +  L ++GG
Sbjct: 6   MSQHLIRIATRKSPLALWQAEFVKAELERIH--PGLSVELVPMTTKGDVLLDTPLAKVGG 63

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++    D AVHS KD+P    +GL +     RED RD F+S+   +L +
Sbjct: 64  KGLFVKELEVAMLEDRADIAVHSMKDVPVDFPEGLGLEIICEREDPRDAFVSNNFANLAE 123

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  +   R D+ + D RG + TRL KL++    AI+LA AG+ RLK
Sbjct: 124 LPKGAVVGTSSLRRQCQIRAMRPDLIIKDLRGNVGTRLAKLDSGDYDAIILAAAGLIRLK 183

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I   ++ E+  P+ GQGA+ IE   ++ + + L+  + H +T   V  ERA    L
Sbjct: 184 LISRIASYISPEESLPANGQGAVGIECRTDDARVKALLAPLEHLETRYRVIAERAMNTRL 243

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +G  L   G+V   DG         G + +A  +G   A+ +    
Sbjct: 244 EGGCQVPIGAYAEIEGDELTLRGLVGNPDGSQIITGQVKGLKSEASQLGEQLAEILLAQG 303

Query: 301 NKNVFN 306
            K + +
Sbjct: 304 AKTILD 309


>gi|307132975|ref|YP_003884991.1| hydroxymethylbilane synthase [Dickeya dadantii 3937]
 gi|306530504|gb|ADN00435.1| hydroxymethylbilane synthase [Dickeya dadantii 3937]
          Length = 313

 Score =  283 bits (723), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 115/306 (37%), Positives = 169/306 (55%), Gaps = 3/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  L   H  P   + ++P+ T+GD + +  L ++GG
Sbjct: 1   MVDTILRIATRQSPLALWQAHFVQQRLKACH--PGLRVELVPMVTRGDVLLDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     R+D RD F+S+   SL D
Sbjct: 59  KGLFVKELELALLENRADIAVHSMKDVPVEFPEGLGLVTICERDDPRDAFVSNHYDSLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L + + +GTSSLRR+  L   R D++V D RG + TRL+KL+N    AI+LA AG+KRL 
Sbjct: 119 LPVGACVGTSSLRRQCQLRAHRPDLTVRDLRGNVGTRLSKLDNGDYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L+ E   P+ GQGA+ +E  +++ + + L+  +NH+DT   V  ERA    L
Sbjct: 179 LEDRIRTALSPEQSLPAVGQGAVGVECRLDDARTRALLAPLNHDDTATRVLAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYC-KGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           +G C+  I  +A    G TL+   +V A DG       R G R DA  +G   A  +   
Sbjct: 239 EGGCQVPIGSYAELQDGDTLWLRALVGAPDGSRIIYAERRGLRQDAEQLGIALADELLER 298

Query: 300 SNKNVF 305
             +++ 
Sbjct: 299 GARDIL 304


>gi|119469646|ref|ZP_01612515.1| porphobilinogen deaminase [Alteromonadales bacterium TW-7]
 gi|119446893|gb|EAW28164.1| porphobilinogen deaminase [Alteromonadales bacterium TW-7]
          Length = 312

 Score =  282 bits (722), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 107/307 (34%), Positives = 164/307 (53%), Gaps = 4/307 (1%)

Query: 1   MEKKP--FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEI 58
           M +K    RI TR S LAL  A   ++ L   H      + ++P+ST+GD I +  L +I
Sbjct: 1   MTEKTKLVRIATRKSALALWQAEFVKAQLEHFHD--DVRVELVPMSTQGDIILDTPLAKI 58

Query: 59  GGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSL 118
           GGKGLF +E+E+ ++ G  D AVHS KD+P +  +GL +     RED RD F+S+   +L
Sbjct: 59  GGKGLFVKELEQAMLDGRADIAVHSMKDVPVEFPEGLALHTICEREDPRDAFVSNHFANL 118

Query: 119 KDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR 178
            +L   +V+GTSSLRR+  +   R D+ + D RG + TRL KL+  +  AI+LA AG+ R
Sbjct: 119 NELPEGAVVGTSSLRRQCQIRALRPDLEIRDLRGNVNTRLAKLDAGQYDAIILAAAGLIR 178

Query: 179 LKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLA 238
           L+  + I + +  E   P+ GQGA+ IE  + +   + L+  + H  T   VN ERA   
Sbjct: 179 LEMGERIADYIEPEVSLPANGQGAVGIECRIEDEVTKALLAPLEHTHTRIRVNAERAMNR 238

Query: 239 ELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRF 298
            L+G C+  I  +A      ++  G+V A DG         G+  DA  +G + A+ +  
Sbjct: 239 RLEGGCQVPIGAYALVDSEQVHLRGLVGAIDGSEILRDEVAGHINDAEKLGIELAEKLLA 298

Query: 299 ISNKNVF 305
                + 
Sbjct: 299 QGADKIL 305


>gi|120600512|ref|YP_965086.1| porphobilinogen deaminase [Shewanella sp. W3-18-1]
 gi|146294670|ref|YP_001185094.1| porphobilinogen deaminase [Shewanella putrefaciens CN-32]
 gi|158512986|sp|A1RPD7|HEM3_SHESW RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|166217787|sp|A4YBG2|HEM3_SHEPC RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|120560605|gb|ABM26532.1| porphobilinogen deaminase [Shewanella sp. W3-18-1]
 gi|145566360|gb|ABP77295.1| porphobilinogen deaminase [Shewanella putrefaciens CN-32]
 gi|319427906|gb|ADV55980.1| porphobilinogen deaminase [Shewanella putrefaciens 200]
          Length = 310

 Score =  282 bits (722), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 110/306 (35%), Positives = 168/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLA+  A   ++ L  +H  P   + ++P+STKGD I +  L ++GG
Sbjct: 1   MSENRIRIATRKSPLAMWQAEFVKAELERIH--PGIVVELLPMSTKGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++  + D AVHS KD+P    +GL +     RED RD F+S+  +++ +
Sbjct: 59  KGLFVKELEVAILEDQADIAVHSMKDVPVDFPEGLGLEVICEREDPRDAFVSNIYKTISE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L L + +GTSSLRR+  L   R D+ + D RG + TRL KL+N +  AI+LA AG+ RLK
Sbjct: 119 LPLGATVGTSSLRRQCQLRASRPDLIIKDLRGNVGTRLAKLDNGEYDAIILAAAGLIRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I   ++ E   P+ GQGA+ IE   N+ + + L+  + H +T   V  ERA    L
Sbjct: 179 LSGRIASFISAEQSLPANGQGAVGIECRTNDERVKALLAPLEHLETRYRVIAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  FA   G  +   G+V   DG    E    G + +A  +G   A+ +    
Sbjct: 239 EGGCQVPIGAFAEINGDEMTLRGLVGNPDGSEIIEGIITGPKTEATQLGVALAEELLSKG 298

Query: 301 NKNVFN 306
            K++ +
Sbjct: 299 AKSILD 304


>gi|30064902|ref|NP_839073.1| porphobilinogen deaminase [Shigella flexneri 2a str. 2457T]
 gi|56480439|ref|NP_709607.2| porphobilinogen deaminase [Shigella flexneri 2a str. 301]
 gi|61213578|sp|Q83PH4|HEM3_SHIFL RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|30043162|gb|AAP18884.1| porphobilinogen deaminase, hydroxymethylbilane synthase [Shigella
           flexneri 2a str. 2457T]
 gi|56383990|gb|AAN45314.2| porphobilinogen deaminase, hydroxymethylbilane synthase [Shigella
           flexneri 2a str. 301]
 gi|313647157|gb|EFS11612.1| porphobilinogen deaminase [Shigella flexneri 2a str. 2457T]
 gi|332751946|gb|EGJ82341.1| porphobilinogen deaminase [Shigella flexneri 2747-71]
 gi|332996995|gb|EGK16613.1| porphobilinogen deaminase [Shigella flexneri VA-6]
 gi|332997894|gb|EGK17501.1| porphobilinogen deaminase [Shigella flexneri K-218]
 gi|333019501|gb|EGK38782.1| porphobilinogen deaminase [Shigella flexneri K-304]
          Length = 313

 Score =  282 bits (722), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 59  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 179 LESRIRAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELIDGEIWLCALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|53802806|ref|YP_115447.1| porphobilinogen deaminase [Methylococcus capsulatus str. Bath]
 gi|53756567|gb|AAU90858.1| porphobilinogen deaminase [Methylococcus capsulatus str. Bath]
          Length = 351

 Score =  282 bits (722), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 112/301 (37%), Positives = 163/301 (54%), Gaps = 2/301 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
             RI TR SPLAL  A    S L   H  P   + ++ ++T+GD++ +  L ++GGKGLF
Sbjct: 46  TLRIATRKSPLALWQAEYVASRLRAAH--PDLRVELVGMTTRGDKLLDAPLAKVGGKGLF 103

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +E+E+ L+ G  D AVHS KD+P +  +GL ++A L RED RD  +SH  +S  +L   
Sbjct: 104 VKELEQGLLEGRADIAVHSMKDVPVEFPEGLHLAAILEREDPRDALVSHRYRSFAELPAD 163

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           + IGTSSLRR+  +       S+ D RG + TRL KL+  +  AI+LA AG+KRL  ++ 
Sbjct: 164 ARIGTSSLRRQCQIKCRLPGCSLYDLRGNVNTRLAKLDAGEFDAIVLASAGLKRLGFQER 223

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I E L  E   P+ GQGAI +E    + +   L+  ++H  T   V  ERA    LDG C
Sbjct: 224 IAETLTPEQCLPAIGQGAIGVECRSTDTRTNALLVPLHHPPTAWCVLAERAMNRRLDGGC 283

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           +  IAGFA  +G TL   G+V   DG         G+      +G+  A+++       +
Sbjct: 284 QVPIAGFAQLEGDTLSLRGLVGNPDGSGIIRAEAVGHPSTFEALGKRVAEHLLDQGADEI 343

Query: 305 F 305
            
Sbjct: 344 L 344


>gi|61213332|sp|Q602K3|HEM3_METCA RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
          Length = 322

 Score =  282 bits (722), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 112/301 (37%), Positives = 163/301 (54%), Gaps = 2/301 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
             RI TR SPLAL  A    S L   H  P   + ++ ++T+GD++ +  L ++GGKGLF
Sbjct: 17  TLRIATRKSPLALWQAEYVASRLRAAH--PDLRVELVGMTTRGDKLLDAPLAKVGGKGLF 74

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +E+E+ L+ G  D AVHS KD+P +  +GL ++A L RED RD  +SH  +S  +L   
Sbjct: 75  VKELEQGLLEGRADIAVHSMKDVPVEFPEGLHLAAILEREDPRDALVSHRYRSFAELPAD 134

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           + IGTSSLRR+  +       S+ D RG + TRL KL+  +  AI+LA AG+KRL  ++ 
Sbjct: 135 ARIGTSSLRRQCQIKCRLPGCSLYDLRGNVNTRLAKLDAGEFDAIVLASAGLKRLGFQER 194

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I E L  E   P+ GQGAI +E    + +   L+  ++H  T   V  ERA    LDG C
Sbjct: 195 IAETLTPEQCLPAIGQGAIGVECRSTDTRTNALLVPLHHPPTAWCVLAERAMNRRLDGGC 254

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           +  IAGFA  +G TL   G+V   DG         G+      +G+  A+++       +
Sbjct: 255 QVPIAGFAQLEGDTLSLRGLVGNPDGSGIIRAEAVGHPSTFEALGKRVAEHLLDQGADEI 314

Query: 305 F 305
            
Sbjct: 315 L 315


>gi|194469126|ref|ZP_03075110.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|205358767|ref|ZP_02658924.2| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|194455490|gb|EDX44329.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|205332052|gb|EDZ18816.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
          Length = 313

 Score =  282 bits (721), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 111/305 (36%), Positives = 160/305 (52%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   + +LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDALMATH--PGLTVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P     GL +     RED RD F+S+   SL  
Sbjct: 59  KGLFVKELEIALLEKRADIAVHSMKDVPVAFPDGLGLVTICEREDPRDAFVSNKYHSLDV 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL KL+N    AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLGKLDNGDYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  +   P+ GQGA+ IE  +++ + Q L+  +NH  T   V  ERA    L
Sbjct: 179 LESRIRTALPPDVSLPAVGQGAVGIECRLDDARTQALLAPLNHSQTALRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG +     R G+   A  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAEIINGEIWLRALVGAPDGSVMVRGERRGSPEQAEQMGISLAEELLENG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 ARAIL 303


>gi|300714797|ref|YP_003739600.1| Porphobilinogen deaminase [Erwinia billingiae Eb661]
 gi|299060633|emb|CAX57740.1| Porphobilinogen deaminase [Erwinia billingiae Eb661]
          Length = 313

 Score =  282 bits (721), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  LM  H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 1   MLDKILRIATRQSPLALWQAHYVQQRLMACH--PGLRVELVPMVTKGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ ++    D AVHS KD+P    +GL +     RED  D F+S+   S+  
Sbjct: 59  KGLFVKELEQAMLEDRADIAVHSMKDVPIAFPEGLGLVTICEREDPLDAFVSNQYDSVDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L   R D+ +   RG + TRL KL+  +  AI+LA AG+KRL 
Sbjct: 119 LPQGAVVGTSSLRRQCQLSARRPDLIIRSLRGNVGTRLGKLDAGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I+  +  E+  P+ GQGA+ IE  +++ +A  L+  +N +DT   V  ERA    L
Sbjct: 179 LGDRIRYAMPAEESLPAVGQGAVGIECRLDDAQAIALLSALNDDDTAIRVKAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  FA  +G  L+  G+V + DG       R G R DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGSFALLQGDELWLRGLVGSPDGTAMIRGERRGPRADAEKMGISLAEELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|110807507|ref|YP_691027.1| porphobilinogen deaminase [Shigella flexneri 5 str. 8401]
 gi|110617055|gb|ABF05722.1| porphobilinogen deaminase [Shigella flexneri 5 str. 8401]
 gi|281603194|gb|ADA76178.1| Porphobilinogen deaminase [Shigella flexneri 2002017]
          Length = 320

 Score =  282 bits (720), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 8   MLDNVLRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGG 65

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 66  KGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 125

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 126 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 185

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 186 LESRIRAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRL 245

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA  +G   A+ +    
Sbjct: 246 EGGCQVPIGSYAELIDGEIWLCALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNG 305

Query: 301 NKNVF 305
            + + 
Sbjct: 306 AREIL 310


>gi|94501432|ref|ZP_01307951.1| porphobilinogen deaminase [Oceanobacter sp. RED65]
 gi|94426397|gb|EAT11386.1| porphobilinogen deaminase [Oceanobacter sp. RED65]
          Length = 310

 Score =  282 bits (720), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 106/300 (35%), Positives = 162/300 (54%), Gaps = 2/300 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            +I TR S LAL  A   +S L   H      + ++ + T+GD+I +  L +IGGKGLF 
Sbjct: 4   LKIATRSSKLALWQAEFVKSELEKFHS--DLQVELVKIKTQGDKILDTPLAKIGGKGLFV 61

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  +++G+ D AVHS KD+P +  +GL +S    RE   D F+S+  Q   DL   +
Sbjct: 62  KELETAMLNGDADIAVHSMKDVPMEFPEGLGLSVICEREMPTDAFVSNHYQRFLDLPQGA 121

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+  +L  R D+ V   RG ++TRL KL+  +  AI+LA AG+ RL+ E+ +
Sbjct: 122 HVGTSSLRRQCQVLAARPDLKVSSLRGNVQTRLGKLDAGEFDAIILASAGLLRLELEERV 181

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            E ++ E   P+ GQGA+ IE  +++   Q+L+  ++H DT   V  ERA    L G C+
Sbjct: 182 AEHMSDEISLPAGGQGAVGIECRMDDEVTQKLLAPLHHSDTASRVYAERALNKRLQGGCQ 241

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             IA +A      L+  G+V + DG         G    A  +G  AA+ +       + 
Sbjct: 242 VPIACYATLNDGELHLRGLVGSEDGSRIIRTEIRGPESQAEQLGIQAAEDLLAQGAGEIL 301


>gi|254238043|ref|ZP_04931366.1| porphobilinogen deaminase [Pseudomonas aeruginosa C3719]
 gi|126169974|gb|EAZ55485.1| porphobilinogen deaminase [Pseudomonas aeruginosa C3719]
          Length = 313

 Score =  282 bits (720), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 111/306 (36%), Positives = 167/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P++++GD++ +  L +IGG
Sbjct: 1   MSSREIRIATRQSALALWQAEYVKARLEQAH--PGLTVTLLPMTSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     RED RD F+S+T  SL+ 
Sbjct: 59  KGLFVKELETALLEGAADIAVHSMKDVPMDFPEGLGLYTICEREDPRDAFVSNTYASLEQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSVVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  ++++D  P+ GQGA+ IE    +     L++ ++H DT   V  ERA    L
Sbjct: 179 FESRIRSSISVDDSLPAGGQGAVGIECRTADSDLHALLEPLHHTDTALRVTAERALNKRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  L+  G+V   DG             +A  +G   A+ +    
Sbjct: 239 NGGCQVPIACYAIREGDQLWLRGLVGQPDGTQLLRAEGRAPLAEAEALGVRVAEDLLEQG 298

Query: 301 NKNVFN 306
            + +  
Sbjct: 299 AEAILE 304


>gi|116053408|ref|YP_793733.1| porphobilinogen deaminase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|122256573|sp|Q02EA3|HEM3_PSEAB RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|115588629|gb|ABJ14644.1| porphobilinogen deaminase [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 313

 Score =  282 bits (720), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 111/306 (36%), Positives = 167/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P++++GD++ +  L +IGG
Sbjct: 1   MSSREIRIATRQSALALWQAEYVKARLEQAH--PGLTVTLLPMTSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     RED RD F+S+T  SL+ 
Sbjct: 59  KGLFVKELETALLEGAADIAVHSMKDVPMDFPEGLGLYTICEREDPRDAFVSNTYASLEQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSVVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  ++++D  P+ GQGA+ IE    +     L++ ++H DT   V  ERA    L
Sbjct: 179 FESRIRSSISVDDSLPAGGQGAVGIECRTADSDLHALLEPLHHSDTALRVTAERALNKRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  L+  G+V   DG             +A  +G   A+ +    
Sbjct: 239 NGGCQVPIACYAIREGDQLWLRGLVGQPDGTQLLRAEGRAPLAEAEALGVRVAEDLLEQG 298

Query: 301 NKNVFN 306
            + +  
Sbjct: 299 AEAILE 304


>gi|77359075|ref|YP_338650.1| porphobilinogen deaminase [Pseudoalteromonas haloplanktis TAC125]
 gi|76873986|emb|CAI85207.1| hydroxymethylbilane synthase (porphobilinogen deaminase)
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 312

 Score =  282 bits (720), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 106/304 (34%), Positives = 166/304 (54%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
                RI TR S LAL  A   ++ L   H  P   + ++P+ST+GD I +  L +IGGK
Sbjct: 4   TTNIVRIATRKSALALWQAEFVKAQLE--HYHPGILVELVPMSTQGDIILDTPLAKIGGK 61

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E+ ++ G  D AVHS KDMP +  +GL +     RED RD F+S+   ++ +L
Sbjct: 62  GLFVKELEQAMLEGLADMAVHSMKDMPVEFPEGLTLHTICEREDPRDAFVSNNFANIDEL 121

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +++GTSSLRR+  +   R D+ + D RG + TRL KL++ +  AI+LA AG+ RL+ 
Sbjct: 122 PQGAIVGTSSLRRQCQIRASRPDLKIHDLRGNVNTRLAKLDSGQYDAIILAAAGLIRLEM 181

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           +  I+  +  E   P+ GQGA+ IE   ++   + L+  + H +T   VN ERA    L+
Sbjct: 182 KDRIRAYIEPEVSLPANGQGAVGIECRTDDEAIKALLAPLEHSETRIRVNAERAMNRHLE 241

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I  +A   G  ++  G+V A DG        +G+  DA  +G + A+ +     
Sbjct: 242 GGCQVPIGAYALVNGDQVHLRGLVGAIDGSEILRDEVSGHVNDAEKLGVELAKMLLAQGA 301

Query: 302 KNVF 305
             + 
Sbjct: 302 DRIL 305


>gi|327395980|dbj|BAK13402.1| porphobilinogen deaminase HemC [Pantoea ananatis AJ13355]
          Length = 317

 Score =  282 bits (720), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 167/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K FRI TR SPLAL  A   +  L+  H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 5   MLNKIFRIATRQSPLALWQAQYVQQRLISAH--PGLRVELVPMVTKGDIILDTPLAKVGG 62

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ ++    D AVHS KD+P    +GL +     R+D RD F+S+   S+ +
Sbjct: 63  KGLFVKELEQAMLENRADLAVHSMKDVPVAFPEGLGLVTICQRDDPRDAFVSNHYASIDE 122

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +VIGTSSLRR+  +   R D+ +   RG + TRL+KL+  +  AI+LA AG+ RL 
Sbjct: 123 LPQGAVIGTSSLRRQCQISARRPDLVIRSLRGNVGTRLSKLDAGEYDAIILAAAGLNRLG 182

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I++ L  +   P+ GQGA+ IE  +++     L++ +NH+DT   V  ERA    L
Sbjct: 183 LADRIRQPLPADISLPAVGQGAVGIECRLDDSTLIALLQALNHDDTAVCVRAERAMNTRL 242

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  FA  +G  L+  G+V A DG +     R G R  A  +G   A  +    
Sbjct: 243 EGGCQVPIGSFAVLEGDELWLRGLVGAPDGSVMVSGERRGPRDQAEQMGISLADELLNGG 302

Query: 301 NKNVF 305
            + + 
Sbjct: 303 AREIL 307


>gi|49085204|gb|AAT51260.1| PA5260 [synthetic construct]
          Length = 314

 Score =  282 bits (720), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 111/306 (36%), Positives = 167/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P++++GD++ +  L +IGG
Sbjct: 1   MSSREIRIATRQSALALWQAEYVKARLEQAH--PGLTVTLLPMTSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     RED RD F+S+T  SL+ 
Sbjct: 59  KGLFVKELETALLEGAADIAVHSMKDVPMDFPEGLGLYTICEREDPRDAFVSNTYASLEQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSVVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  ++++D  P+ GQGA+ IE    +     L++ ++H DT   V  ERA    L
Sbjct: 179 FESRIRSSISVDDSLPAGGQGAVGIECRTADSDLHALLEPLHHTDTALRVTAERALNKRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  L+  G+V   DG             +A  +G   A+ +    
Sbjct: 239 NGGCQVPIACYAIREGDQLWLRGLVGQPDGTQLLRAEGRAPLAEAEALGVRVAEDLLEQG 298

Query: 301 NKNVFN 306
            + +  
Sbjct: 299 AEAILE 304


>gi|15600453|ref|NP_253947.1| porphobilinogen deaminase [Pseudomonas aeruginosa PAO1]
 gi|107104362|ref|ZP_01368280.1| hypothetical protein PaerPA_01005437 [Pseudomonas aeruginosa PACS2]
 gi|218894362|ref|YP_002443232.1| porphobilinogen deaminase [Pseudomonas aeruginosa LESB58]
 gi|254243856|ref|ZP_04937178.1| porphobilinogen deaminase [Pseudomonas aeruginosa 2192]
 gi|12230932|sp|Q60169|HEM3_PSEAE RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|226740638|sp|B7V5F0|HEM3_PSEA8 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|9951571|gb|AAG08645.1|AE004938_7 porphobilinogen deaminase [Pseudomonas aeruginosa PAO1]
 gi|126197234|gb|EAZ61297.1| porphobilinogen deaminase [Pseudomonas aeruginosa 2192]
 gi|218774591|emb|CAW30408.1| porphobilinogen deaminase [Pseudomonas aeruginosa LESB58]
          Length = 313

 Score =  282 bits (720), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 111/306 (36%), Positives = 167/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P++++GD++ +  L +IGG
Sbjct: 1   MSSREIRIATRQSALALWQAEYVKARLEQAH--PGLTVTLLPMTSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     RED RD F+S+T  SL+ 
Sbjct: 59  KGLFVKELETALLEGAADIAVHSMKDVPMDFPEGLGLYTICEREDPRDAFVSNTYASLEQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSVVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  ++++D  P+ GQGA+ IE    +     L++ ++H DT   V  ERA    L
Sbjct: 179 FESRIRSSISVDDSLPAGGQGAVGIECRTADSDLHALLEPLHHTDTALRVTAERALNKRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  L+  G+V   DG             +A  +G   A+ +    
Sbjct: 239 NGGCQVPIACYAIREGDQLWLRGLVGQPDGTQLLRAEGRAPLAEAEALGVRVAEDLLEQG 298

Query: 301 NKNVFN 306
            + +  
Sbjct: 299 AEAILE 304


>gi|313110333|ref|ZP_07796223.1| porphobilinogen deaminase [Pseudomonas aeruginosa 39016]
 gi|310882725|gb|EFQ41319.1| porphobilinogen deaminase [Pseudomonas aeruginosa 39016]
          Length = 313

 Score =  281 bits (719), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 112/306 (36%), Positives = 167/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P++++GD++ +  L +IGG
Sbjct: 1   MSSREIRIATRQSALALWQAEYVKARLEQAH--PGLTVTLLPMTSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     RED RD F+S+T  SL+ 
Sbjct: 59  KGLFVKELETALLEGAADIAVHSMKDVPMDFPEGLGLYTICEREDPRDAFVSNTYASLEQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSVVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +N++D  P+ GQGA+ IE    +     L++ ++H DT   V  ERA    L
Sbjct: 179 FESRIRSSINVDDSLPAGGQGAVGIECRTADSDLHALLEPLHHTDTALRVTAERALNKRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  L+  G+V   DG             +A  +G   A+ +    
Sbjct: 239 NGGCQVPIACYAIREGDQLWLRGLVGQPDGTQLLRAEGRAPLAEAEALGVRVAEDLLEQG 298

Query: 301 NKNVFN 306
            + +  
Sbjct: 299 AEAILE 304


>gi|317494824|ref|ZP_07953235.1| porphobilinogen deaminase [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917149|gb|EFV38497.1| porphobilinogen deaminase [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 323

 Score =  281 bits (719), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 113/304 (37%), Positives = 164/304 (53%), Gaps = 2/304 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            +  RI TR SPLAL  A+  R  L      P   + ++P+ T+GD + +  L ++GGKG
Sbjct: 13  NQTLRIATRQSPLALWQAYYVRDHLQA--HWPDLTVELVPMVTRGDVLLDTPLAKVGGKG 70

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+ G  D AVHS KD+P    +GL +     RED RD F+S     L+DL 
Sbjct: 71  LFVKELELALLDGRADIAVHSMKDVPVAFPEGLGLVTICEREDPRDAFVSPKYARLEDLP 130

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             S++GTSSLRR+  L   R D+ V D RG + TRL KL+N    AI+LA AG+KRL+ E
Sbjct: 131 EGSIVGTSSLRRQCQLREIRPDLIVRDLRGNVGTRLAKLDNGDYDAIILAAAGLKRLELE 190

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I+  L  E   P+ GQGA+ IE  +N+ + Q L+  +N  DT   V+ ERA    L+G
Sbjct: 191 ERIRYALPPEQSLPAVGQGAVGIECRLNDTRTQALLAPLNDIDTATRVSAERAMNTRLEG 250

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  I  ++   G  ++   +V   DG +     R G R  A  +G   A+ +     +
Sbjct: 251 GCQVPIGSYSELNGDEIWLRALVGKPDGTLIIRGERRGPRAKAAELGVSLAEELLERGAR 310

Query: 303 NVFN 306
            +  
Sbjct: 311 EILE 314


>gi|260771623|ref|ZP_05880543.1| porphobilinogen deaminase [Vibrio metschnikovii CIP 69.14]
 gi|260613400|gb|EEX38599.1| porphobilinogen deaminase [Vibrio metschnikovii CIP 69.14]
          Length = 312

 Score =  281 bits (719), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 110/302 (36%), Positives = 166/302 (54%), Gaps = 2/302 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P RI TR SPLAL  A   + +L   H  P   + ++ + T+GD + +  L ++GGKGLF
Sbjct: 6   PIRIATRQSPLALWQAHFVKDALQAAH--PHLAVELVTMVTRGDVLLDTPLAKVGGKGLF 63

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T  SL+ L   
Sbjct: 64  VKELEVAMLEGRADLAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNTYHSLEALPHG 123

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           +++GT SLRR+  +   R DI + + RG + TRL KL+  +  AI+LA AG+KRLK E+ 
Sbjct: 124 AIVGTCSLRRQCQIKAARPDIIIKELRGNVGTRLAKLDAGEFDAIVLAAAGLKRLKLEQR 183

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I   ++ E   P+ GQGA+ IE  +++ +   L++ +NH DT+D V CERA    L G C
Sbjct: 184 IASFISPEQSLPAVGQGAVGIECRLDDQRLLTLLEPLNHADTYDRVICERAMNLTLQGGC 243

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           +  I  +    G  ++   +V   DG         G R  A  +G + AQ +     +++
Sbjct: 244 QVPIGSYTELDGEQIWLRALVGEPDGSRIIRGEIRGPRQQAERLGVELAQQLLDQGARDI 303

Query: 305 FN 306
            N
Sbjct: 304 LN 305


>gi|268592915|ref|ZP_06127136.1| hydroxymethylbilane synthase [Providencia rettgeri DSM 1131]
 gi|291311707|gb|EFE52160.1| hydroxymethylbilane synthase [Providencia rettgeri DSM 1131]
          Length = 314

 Score =  281 bits (719), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 113/304 (37%), Positives = 167/304 (54%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
                RI TR SPLAL  A   +  L  +H  P   + ++P+ TKGD I +  L ++GGK
Sbjct: 3   STNIVRIATRKSPLALWQAHFVKDKLEQLH--PGLLVELVPMVTKGDIILDTPLAKVGGK 60

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  L+ G  D AVHS KD+P +  +GL +     RED RD F+S+   +L+ L
Sbjct: 61  GLFVKELELALLEGRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNHYDNLEAL 120

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              S++GTSSLRR+  L   R D+ + D RG + TRL+KL+N +  AI+LA AG+KRL  
Sbjct: 121 PEGSIVGTSSLRRQCQLRELRPDLVIRDLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGL 180

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E  IK  L  E   P+ GQGA+ IE  +N+ K +EL+  +N++ T   V  ERA    L+
Sbjct: 181 ETRIKTALAPEQCLPAVGQGAVGIECRLNDSKTRELLAKLNNDATSTCVLAERAMNMRLE 240

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I  +A  +   ++   +V A DG +     R  +  +A   G   A+ +     
Sbjct: 241 GGCQVPIGSYAIWQDDKIWLRALVGAPDGSVIIRGERRVSPSEANQAGVSLAEELLERGA 300

Query: 302 KNVF 305
           + + 
Sbjct: 301 REIL 304


>gi|296392119|ref|ZP_06881594.1| porphobilinogen deaminase [Pseudomonas aeruginosa PAb1]
          Length = 313

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 111/306 (36%), Positives = 167/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P++++GD++ +  L +IGG
Sbjct: 1   MSSREIRIATRQSALALWQAEYVKARLEQAH--PGLTVTLLPMTSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     RED RD F+S+T  SL+ 
Sbjct: 59  KGLFVKELETALLEGAADIAVHSMKDVPMDFPEGLGLYTICEREDPRDAFVSNTYASLEQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSVVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  ++++D  P+ GQGA+ IE    +     L++ ++H DT   V  ERA    L
Sbjct: 179 FESRIRSSISVDDSLPAGGQGAVGIECRTADSALHALLEPLHHTDTALRVTAERALNKRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  L+  G+V   DG             +A  +G   A+ +    
Sbjct: 239 NGGCQVPIACYAIREGDQLWLRGLVGQPDGTQLLRAEGRAPLAEAEALGVRVAEDLLEQG 298

Query: 301 NKNVFN 306
            + +  
Sbjct: 299 AEAILE 304


>gi|239833011|ref|ZP_04681340.1| porphobilinogen deaminase [Ochrobactrum intermedium LMG 3301]
 gi|239825278|gb|EEQ96846.1| porphobilinogen deaminase [Ochrobactrum intermedium LMG 3301]
          Length = 314

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 149/305 (48%), Positives = 196/305 (64%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           +    +IGTR S LALA A+ETR  LM+ H +P   I I+P+ST GDRI +R L+EIGGK
Sbjct: 7   KNGTLKIGTRGSKLALAQAYETRRRLMEAHGLPEEAIEIVPMSTAGDRIQDRALSEIGGK 66

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLFTEEIE+ L  G ID AVHS KDMPT L  GL +S +L RED RD FI  TA  L DL
Sbjct: 67  GLFTEEIEQALTDGRIDLAVHSTKDMPTVLPDGLHLSVFLEREDPRDAFIGRTASRLLDL 126

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              + +G+SSLRR+AL+ R R DI V+ FRG ++TRL KL   +     LA AG++RL  
Sbjct: 127 PQGATVGSSSLRRQALIRRLRPDIQVVIFRGNVDTRLRKLEAGEVDGTFLACAGLRRLGL 186

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
             VI E+++ E F P+PGQGAI IET + + +   L+  + H +T  ++ CERAFLA LD
Sbjct: 187 GDVITELVDPESFLPAPGQGAIGIETRIGDTRIDALLAPLAHRETGIALACERAFLAALD 246

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           GSC++ IAG A   G  + F+G++L  DG   HE+   G   +A  +GR+AA+ IR  + 
Sbjct: 247 GSCRTPIAGLATVDGDRVSFHGMILKPDGSEAHEIRAEGPVSNAAALGREAAERIRAKAG 306

Query: 302 KNVFN 306
              F 
Sbjct: 307 PQFFE 311


>gi|283787518|ref|YP_003367383.1| porphobilinogen deaminase [Citrobacter rodentium ICC168]
 gi|282950972|emb|CBG90649.1| porphobilinogen deaminase [Citrobacter rodentium ICC168]
          Length = 313

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 163/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   + +LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDALMANH--PGLVVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +   GL +     RED RD F+S+   SL  
Sbjct: 59  KGLFVKELEVALLEKRADIAVHSMKDVPVEFPAGLGLVTICEREDPRDAFVSNNYPSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + Q L+  +N E T   V  ERA    L
Sbjct: 179 LESRIRAALPPEVSLPAVGQGAVGIECRLDDRRTQALLAPLNDEITALRVKAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      L+   +V A DG +     R G+   A  +G   A+ +    
Sbjct: 239 EGGCQVPIGSYAEMIDGELWLRALVGAPDGSLMVRGERRGSPEQAEQMGISLAEELLDNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 ARAIL 303


>gi|269137476|ref|YP_003294176.1| porphobilinogen deaminase [Edwardsiella tarda EIB202]
 gi|267983136|gb|ACY82965.1| porphobilinogen deaminase [Edwardsiella tarda EIB202]
 gi|304557549|gb|ADM40213.1| Porphobilinogen deaminase [Edwardsiella tarda FL6-60]
          Length = 317

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 113/302 (37%), Positives = 157/302 (51%), Gaps = 2/302 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
             RI TR SPLAL  A   R  L  +   P   I ++P+ T+GD + +  L ++GGKGLF
Sbjct: 11  TLRIATRQSPLALWQAHYVRDQL--LTHWPQLTIELVPMVTRGDVLLDTPLAKVGGKGLF 68

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +E+E  L+ G  D AVHS KD+P     GL +     RED RD F+S    SL+ L   
Sbjct: 69  VKELELALLEGRADIAVHSMKDVPVAFPDGLGLVTICQREDPRDAFVSPRFASLEQLPPG 128

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           SV+GTSSLRR+  L   R D+ + D RG + TRL KL+     AI+LA AG+KRL+ +  
Sbjct: 129 SVVGTSSLRRQCQLRAARPDLQIRDLRGNVGTRLAKLDAGDYDAIILAAAGLKRLQLDDR 188

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I+  L  E   P+ GQGA+ IE  + +   + L+  +NH DT   V  ERA    L+G C
Sbjct: 189 IRTPLTPEQSLPAVGQGAVGIECRLADDATRRLLAPLNHADTALRVCAERAMNTRLEGGC 248

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           +  I  +A   G  L+   +V A DG       R G    A  +G   A  +     + +
Sbjct: 249 QVPIGSYAEIDGDQLWLRALVGAPDGSRIIRGERRGPLTQAEAMGTALADELLARGARTI 308

Query: 305 FN 306
            +
Sbjct: 309 LD 310


>gi|300721444|ref|YP_003710719.1| hydroxymethylbilane synthase [Xenorhabdus nematophila ATCC 19061]
 gi|297627936|emb|CBJ88482.1| hydroxymethylbilane synthase (porphobilinogen deaminase)
           [Xenorhabdus nematophila ATCC 19061]
          Length = 313

 Score =  280 bits (717), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLA+  A   +  L   H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MTMKTIRIATRQSPLAMWQAHYVQKQLQHFH--PELKVELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +   GL +     R+D RD F+S    SL D
Sbjct: 59  KGLFVKELELALLEKRADIAVHSMKDVPVEFPNGLGLVTICERDDPRDAFVSVKYASLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L + R D+ + D RG + TRL+KL+N    AI+LA AG+KRL 
Sbjct: 119 LPTGSVVGTSSLRRQCQLRQLRPDLVIRDLRGNVGTRLSKLDNGDYDAIILATAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH  T   V  ERA    L
Sbjct: 179 LEERIRMPLAPELLLPAVGQGAVGIECRLDDQQTRELLAPLNHARTEICVLAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +   ++   +V A DG +     R  +  +A   G   A+ +    
Sbjct: 239 EGGCQVPIGSYAIWQEDKIWLRALVGAPDGTVSVRGERVVSPEEARQAGVALAEELLEKG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 ARQIL 303


>gi|152978040|ref|YP_001343669.1| porphobilinogen deaminase [Actinobacillus succinogenes 130Z]
 gi|189042873|sp|A6VL87|HEM3_ACTSZ RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|150839763|gb|ABR73734.1| porphobilinogen deaminase [Actinobacillus succinogenes 130Z]
          Length = 309

 Score =  280 bits (717), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 108/305 (35%), Positives = 168/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+++  +I TR SPLAL  A   +  L +++  P   + ++P+ TKGD I +  L +IGG
Sbjct: 1   MQQEILKIATRQSPLALWQANFVKDRLTEIY--PDLTVELVPMVTKGDVILDTPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L++G+ D AVHS KD+P +   GL +S    RED RD F+S+  ++L D
Sbjct: 59  KGLFVKELENALLNGDADIAVHSMKDVPMEFPAGLGLSVICKREDPRDAFVSNRYRTLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  L + R D+++   RG + TRL+KL+     AI+LA AG+ RL 
Sbjct: 119 LPPGAIVGTSSLRRQCQLKKRRPDLNIRSLRGNVGTRLSKLDQGDYDAIILASAGLIRLA 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I   +  E   P+ GQGA+ IE  +N+ + Q+L+  +   +T   V  ERA    L
Sbjct: 179 LPERIASFIETEISLPAAGQGAVGIECRINDQRVQKLLAPLADTETTACVLAERAMNNRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I G+A   G+ L+   +V A DG             +A  +G   A+ +    
Sbjct: 239 QGGCQVPIGGYAVLNGNELHLRALVGALDGSKIIRAEGKSAVENAEVLGIQIAESLLAQG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 ADKIL 303


>gi|254427203|ref|ZP_05040910.1| porphobilinogen deaminase [Alcanivorax sp. DG881]
 gi|196193372|gb|EDX88331.1| porphobilinogen deaminase [Alcanivorax sp. DG881]
          Length = 310

 Score =  280 bits (717), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 111/305 (36%), Positives = 168/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M ++  RI TR SPLA+  A   +  L  +H+     + ++ + T+GD+I +  L +IGG
Sbjct: 1   MSREILRIATRSSPLAIWQAEYVQQRLESLHE--GLAVELVRIKTQGDKILDTPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ ++ G  D AVHS KD+P +L +G  +     RED RD F+S+T  SL  
Sbjct: 59  KGLFVKELEEAMMDGRADIAVHSMKDVPMELPEGFALPVICEREDPRDAFVSNTFDSLSS 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +GTSSLRR+A +   R D+ V   RG ++TRL KL+  +  AI+LA AG+KRL+
Sbjct: 119 LPHGACVGTSSLRRQAQVKANRPDLVVKSLRGNVQTRLGKLDAGEFDAIILAAAGLKRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I+  +  E+  P+ GQGA+ IE    + +  +L+  ++  DTWD V  ERA    L
Sbjct: 179 MHDRIRYEMPPEESLPAVGQGAVGIECREADTRTIDLLSPLSDVDTWDRVVAERAMNRRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DG C+  IAGFA  +   L+  G+V   DG        +  R     +G D A+ +    
Sbjct: 239 DGGCQVPIAGFALLEDGQLWLRGLVAEEDGSRVLRAEGSAPRAKGAELGIDIAEQLLAQG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 ADAIL 303


>gi|120553424|ref|YP_957775.1| porphobilinogen deaminase [Marinobacter aquaeolei VT8]
 gi|166217776|sp|A1TXW9|HEM3_MARAV RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|120323273|gb|ABM17588.1| hydroxymethylbilane synthase [Marinobacter aquaeolei VT8]
          Length = 313

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 114/306 (37%), Positives = 171/306 (55%), Gaps = 3/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M K+  RI TR S LAL  A   ++ L  +H     ++ +I + T+GD+I +  L +IGG
Sbjct: 1   MSKRTLRIATRSSALALWQAEFIKAELERLHD--NVDVELIKIKTQGDKILDVPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ ++ G  D AVHS KD+P +  +GL + A   RED  D F+S+  + +  
Sbjct: 59  KGLFVKELEEAMLDGRADLAVHSMKDVPMEFPEGLGLVAICEREDPTDAFVSNQYEHIDQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GT+SLRR+A L   R D+ +   RG + TRL KL+  +  AI+LA +G+KRL 
Sbjct: 119 LPEGAVVGTASLRREAQLRANRPDLQIKVLRGNVNTRLAKLDAGEYDAIVLASSGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I+  L      P+ GQGA+ IE  V + +  EL+  +NH DTWD V+ ERA    L
Sbjct: 179 FHDRIRYCLPDTFSLPAVGQGALGIECRVGDTELLELIDPLNHTDTWDRVSAERALNRRL 238

Query: 241 DGSCKSAIAGFAYCKGS-TLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           +G C+  IA +A  +   TL+  G+V A DG     V     R +   +GR+ A+ +  +
Sbjct: 239 EGGCQVPIAAYALLEDDNTLWLRGLVGAVDGTQIFRVEGRAPRAEGERLGRELAEQLLSM 298

Query: 300 SNKNVF 305
               V 
Sbjct: 299 GADKVL 304


>gi|146313619|ref|YP_001178693.1| porphobilinogen deaminase [Enterobacter sp. 638]
 gi|167008813|sp|A4WG12|HEM3_ENT38 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|145320495|gb|ABP62642.1| hydroxymethylbilane synthase [Enterobacter sp. 638]
          Length = 313

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 161/305 (52%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  L   H+     + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAQYVKQRLEACHQ--GLRVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL D
Sbjct: 59  KGLFVKELEIALLENRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNRYASLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+ +   RG + TRL KL+N    AI+LA AG+KRL 
Sbjct: 119 LPKGSVVGTSSLRRQCQLAERRPDLVIRSLRGNVGTRLGKLDNGDYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  +++ + + L+  +NH++T   V  ERA    L
Sbjct: 179 LESRIRVAMPPELCLPAVGQGAVGIECRLDDDRTRALLSPLNHDETAIRVQAERAMNMRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      L+   +V A DG       R G   DA  +G   A  +    
Sbjct: 239 EGGCQVPIGSYAELINGELWLRALVGAPDGSQMVRGERRGLPQDAEMLGISLADELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 ARAIL 303


>gi|293393888|ref|ZP_06638195.1| hydroxymethylbilane synthase [Serratia odorifera DSM 4582]
 gi|291423715|gb|EFE96937.1| hydroxymethylbilane synthase [Serratia odorifera DSM 4582]
          Length = 313

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 118/305 (38%), Positives = 171/305 (56%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQQRLMASH--PDLQVELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P +   GL +     R+D RD F+S+   SL  
Sbjct: 59  KGLFVKELELALLEGRADIAVHSMKDVPVEFPAGLGLVTICERDDPRDAFVSNRFASLDQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L + R D+ V D RG + TRL KL+N    AI+LA AG+KRL 
Sbjct: 119 LPQGSVVGTSSLRRQCQLRQRRPDLLVRDLRGNVGTRLAKLDNGDYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I+  ++ E+  P+ GQGA+ IE  +++   + L+  +NHE T   V  ERA    L
Sbjct: 179 LEQRIRSPMSPEESLPAVGQGAVGIECRLDDAVTRALLAPLNHELTATRVRAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A   G TL+   +V A DG +     R G    A ++G + A+ +    
Sbjct: 239 EGGCQVPIGSYAELDGDTLWLRALVGAPDGSLMVRGERRGPAAQAEHMGIELAEELLAKG 298

Query: 301 NKNVF 305
            +++ 
Sbjct: 299 ARDIL 303


>gi|157829875|pdb|1AH5|A Chain A, Reduced Form Selenomethionine-Labelled Hydroxymethylbilane
           Synthase Determined By Mad
          Length = 313

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 161/305 (52%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   +  L   H  P   + ++P  T+GD I +  L ++GG
Sbjct: 1   MLDNVLRIATRQSPLALWQAHYVKDKLXASH--PGLVVELVPXVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 59  KGLFVKELEVALLENRADIAVHSXKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L
Sbjct: 179 LESRIRAALPPEISLPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAXNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A      ++   +V A DG       R G   DA   G   A+ +    
Sbjct: 239 EGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQXGISLAEELLNNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|148262442|ref|YP_001229148.1| porphobilinogen deaminase [Geobacter uraniireducens Rf4]
 gi|189028092|sp|A5GCW2|HEM3_GEOUR RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|146395942|gb|ABQ24575.1| porphobilinogen deaminase [Geobacter uraniireducens Rf4]
          Length = 318

 Score =  280 bits (715), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 166/305 (54%), Gaps = 3/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RIGTR S LAL  A   +S L   +  P   + ++ + T GD+I +  L ++GG
Sbjct: 1   MALKTLRIGTRASQLALWQANWVKSELEKRY--PGLEVSLLKIKTIGDKILDVPLAQVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE+ ++ G+ID AVHS KD+PT+  +GL +     RED RD  IS   +   D
Sbjct: 59  KGLFVKEIEEAMLRGDIDIAVHSMKDVPTEFPEGLGLHCITEREDPRDAVISRGIKFA-D 117

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + IGTS+LRR+A LL+ R D+ ++  RG +ETR+NKL      A++LA AG+KRL 
Sbjct: 118 LPKGAKIGTSALRRQAQLLKIRPDMEMVIIRGNVETRINKLEAENLDAVILAAAGLKRLG 177

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               + E L  +   P+ GQGA+ IE  ++N + +  +   NH  T  +V  ERA L   
Sbjct: 178 FTDKVAEYLPTDLSIPAIGQGALGIECRLDNEEVKSAIDFFNHPATAYAVRAERALLWRC 237

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA F   +G  L   G + + DGK   + S +G   +   +G   A+ +    
Sbjct: 238 EGGCQVPIAAFGEVEGDQLKLTGFIASVDGKTSVKGSVSGPAEECEKLGITLAEQLLKDG 297

Query: 301 NKNVF 305
              + 
Sbjct: 298 GHEIL 302


>gi|311693131|gb|ADP96004.1| porphobilinogen deaminase [marine bacterium HP15]
          Length = 313

 Score =  280 bits (715), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 109/306 (35%), Positives = 170/306 (55%), Gaps = 3/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M K+  RI TR S LAL  A   ++ L  +H      + ++ + T+GD+I +  L +IGG
Sbjct: 1   MSKRTLRIATRSSALALWQAEFIKAELERLHD--NITVELVKIKTQGDKILDVPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ ++ G  D AVHS KD+P +  +GL + A   RED  D F+S+   ++  
Sbjct: 59  KGLFVKELEEAMLDGRADLAVHSMKDVPMEFPEGLGLVAICEREDPTDAFVSNHYDNVDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GT+SLRR+A L  +R D+ +   RG + TRL KL+  +  AI+LA +G+KRL 
Sbjct: 119 LPHGAVVGTASLRREAQLRAYRPDLEIRVLRGNVNTRLAKLDAGEYEAIVLASSGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I+  L      P+ GQGA+ IE  V++     +++ + H+DTWD V  ERA    L
Sbjct: 179 FHERIRYCLPDTLSLPAVGQGALGIECRVDDQDLLAMLEPLKHKDTWDRVTAERALNRRL 238

Query: 241 DGSCKSAIAGFAYC-KGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           +G C+  IA +A      T++  G+V A DG     V     R +   +GR+ A+ +  +
Sbjct: 239 EGGCQVPIAAYALLEDDDTIWLRGLVGAVDGTQIFRVEGRAPRAEGERLGRELAEDLLAL 298

Query: 300 SNKNVF 305
               V 
Sbjct: 299 GADKVL 304


>gi|78484457|ref|YP_390382.1| porphobilinogen deaminase [Thiomicrospira crunogena XCL-2]
 gi|123728099|sp|Q31JG5|HEM3_THICR RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|78362743|gb|ABB40708.1| hydroxymethylbilane synthase [Thiomicrospira crunogena XCL-2]
          Length = 309

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 114/304 (37%), Positives = 172/304 (56%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            KK  RI TR SPLA+  A   ++ L   H+     + ++P+STKGD+I +  L +IGGK
Sbjct: 1   MKKTLRIATRKSPLAMWQAEFVKAELEKHHE--GLTVELLPMSTKGDKILDVPLAKIGGK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLFT+E+E ++++GE D AVHS KD+P  L +G  + A L R +  D F+S+     ++L
Sbjct: 59  GLFTKELEDRMLAGEADIAVHSMKDVPMVLPEGFALGAILERHEPTDAFVSNDYAHFEEL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GTSSLRRKA L+  R D+ V D RG + TRL KL+     AI+LA +G+KRL+ 
Sbjct: 119 PQGAVLGTSSLRRKAQLMAARPDLVVKDLRGNVGTRLGKLDAGDYDAIVLATSGLKRLEL 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           ++ I+  L+ E   P+  QG + IE    +P+  EL++V+NH DT      ERA    L+
Sbjct: 179 DERIRHELSPETCLPAVSQGTLGIEYFEKDPEVLELIQVLNHRDTEIRTLAERAMNHRLE 238

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I  +A  +   +Y  G+V A DG         G++ D   +G   A+ +     
Sbjct: 239 GGCQVPIGVYAELEDDQIYLRGLVGALDGSEILRSEARGSQKDPETLGVYVAEQLLEQGA 298

Query: 302 KNVF 305
             + 
Sbjct: 299 GEIL 302


>gi|71278494|ref|YP_266842.1| porphobilinogen deaminase [Colwellia psychrerythraea 34H]
 gi|123733846|sp|Q48AW8|HEM3_COLP3 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|71144234|gb|AAZ24707.1| porphobilinogen deaminase [Colwellia psychrerythraea 34H]
          Length = 317

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 107/307 (34%), Positives = 159/307 (51%), Gaps = 4/307 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR S LAL  A   ++ L   H     N+ ++P++TKGD I +  L ++GG
Sbjct: 1   MNNTTVRIATRKSALALWQAEYVKAQLEHFHD--GINVELVPMTTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++    D AVHS KD+P    +GL +    PRED RD F+S+T +SL D
Sbjct: 59  KGLFVKELEVAMLEDRADIAVHSMKDVPVDFPEGLGLEVICPREDPRDAFVSNTIKSLSD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ + D RG + TRL KL+  +  AI+LA AG+ RL+
Sbjct: 119 LPQGSIVGTSSLRRQCQLKASRPDLDIRDLRGNVNTRLRKLDEGQYDAIILAAAGLIRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I + +  E+  P+ GQGA+ IE   ++   + L+  +    T   V  ERA    L
Sbjct: 179 MSERIAQFIEPEEMLPANGQGAVGIECRNDDATIKALLAPLECATTRIRVLAERAMNRAL 238

Query: 241 DGSCKSAIAGFAYC--KGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRF 298
            G C+  I  +      G  ++  G+V + DG    E    G   +   +G   AQ +  
Sbjct: 239 QGGCQVPIGSYGVISADGKNIHLRGLVGSVDGSEMIESEITGPVEEGEALGNKLAQELLS 298

Query: 299 ISNKNVF 305
                + 
Sbjct: 299 RGADKIL 305


>gi|260914569|ref|ZP_05921037.1| hydroxymethylbilane synthase [Pasteurella dagmatis ATCC 43325]
 gi|260631360|gb|EEX49543.1| hydroxymethylbilane synthase [Pasteurella dagmatis ATCC 43325]
          Length = 311

 Score =  279 bits (713), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 116/305 (38%), Positives = 172/305 (56%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     +I TR SPLAL  A   +  L   +  P  N+V++P+ TKGD I +  L +IGG
Sbjct: 1   MTNNTLKIATRQSPLALWQANYVKQRLESFY--PDLNVVLVPMVTKGDVILDTPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+SGE D AVHS KD+P +  +GL +S   PRED  D  +S+T ++L++
Sbjct: 59  KGLFVKELEIALLSGEADIAVHSMKDVPMQFPEGLGLSVICPREDPHDALVSNTYRTLEE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  L + R D+ +   RG + TRL+KL+     AI+LA AG+ RL 
Sbjct: 119 LPQGAIVGTSSLRRQCQLKQLRPDLKIESLRGNVGTRLSKLDCGDYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I   ++I+D  P+ GQGA+ IE   N+ + Q+L+  +   +T D V  ERA    L
Sbjct: 179 LTERIASFIDIQDMLPAAGQGAVGIECRKNDSRVQQLLAPLADIETTDCVLAERAMNTHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  IAG+A  +   +Y  G+V A DG             +A N+G   A+ +    
Sbjct: 239 QGGCQVPIAGYAIIENDQIYLRGLVGALDGSAILRAEAKSAVKNAENLGIQVAEMLLQQG 298

Query: 301 NKNVF 305
             N+ 
Sbjct: 299 AGNIL 303


>gi|126208484|ref|YP_001053709.1| porphobilinogen deaminase [Actinobacillus pleuropneumoniae L20]
 gi|126097276|gb|ABN74104.1| porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
          Length = 309

 Score =  279 bits (713), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 111/304 (36%), Positives = 163/304 (53%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            K   RI TR SPLAL  A   +  L    + P  ++ ++ + TKGD I +  L +IGGK
Sbjct: 1   MKDTLRIATRQSPLALWQANFVKDELEK--RFPELSVELVTMVTKGDVILDTPLAKIGGK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  L+    D AVHS KD+P    +GL ++    RED RD F+S+  Q+L +L
Sbjct: 59  GLFVKELELALLENRADIAVHSMKDVPMTFPEGLGLAVICEREDPRDAFVSNKYQNLDEL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GTSSLRR+  L+     + V   RG + TRL+KL+N +  AI+LA AG+ RL  
Sbjct: 119 PAGAVVGTSSLRRQCQLMAKYPHLEVKSLRGNVGTRLSKLDNGEYDAIILASAGLIRLGM 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
            + I+  +++E   P+ GQGA+ IET VN+ +    +  +NH  T   V  ERA    L 
Sbjct: 179 PERIRSFISVEQSLPAAGQGAVGIETRVNDERVLNYLATLNHNPTACCVIAERAMNTRLQ 238

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I GFA   G+ +    +V A DG      S   +R +A  +G   A+ +     
Sbjct: 239 GGCQVPIGGFATLNGNEITLNALVGALDGSNIIRASGVADRENAEQLGISVAEQLLAQGA 298

Query: 302 KNVF 305
             + 
Sbjct: 299 DKIL 302


>gi|332995105|gb|AEF05160.1| porphobilinogen deaminase [Alteromonas sp. SN2]
          Length = 311

 Score =  279 bits (713), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 108/304 (35%), Positives = 167/304 (54%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           + +  RI TR S LAL  A   ++ L++ H      + ++P+ST+GDRI +  L +IGGK
Sbjct: 5   KNRTIRIATRKSALALWQAEYVKAKLLEHHD--GIAVELVPMSTQGDRILDTPLAKIGGK 62

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  ++ G  D AVHS KD+P +  +G  + A   RE+  D F+S+   +L  L
Sbjct: 63  GLFIKELEVAMLEGRADIAVHSMKDLPVEFPEGFGLHAICERENPFDAFVSNHFDNLDAL 122

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GTSSLRR+  + + R D+ + D RG + TRL KL+  +  AI+LA AG+ RL  
Sbjct: 123 PEGAVVGTSSLRRQCQIRKHRPDLKIKDLRGNVNTRLAKLDAGEYDAIILASAGLIRLGM 182

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E+ IK  L      P+ GQGA+ IE   ++ +   L++ +NH +T   V+ ERA    L+
Sbjct: 183 EERIKTGLPASVSLPAVGQGAVGIECRNDDAELIALLQALNHGETQTRVSAERAMNERLE 242

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I  FA   G ++   G+V   DG      S  G   +A +IG + A+ +     
Sbjct: 243 GGCQVPIGSFATLDGDSITLTGMVGQPDGSTLLFASATGPTKNAKSIGVEVAEALLEQGA 302

Query: 302 KNVF 305
             + 
Sbjct: 303 GEIL 306


>gi|329297028|ref|ZP_08254364.1| porphobilinogen deaminase [Plautia stali symbiont]
          Length = 313

 Score =  279 bits (713), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 115/305 (37%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K FRI TR SPLAL  A   +  LM  H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 1   MLNKIFRIATRQSPLALWQAQYVQQRLMAAH--PGLQVELMPMVTKGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++    D AVHS KD+P     GL +     RED RD F+S+   S+  
Sbjct: 59  KGLFVKELELAMLENRADMAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNHYSSIDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  +   R D+ +   RG + TRL+KL+  +  AI+LA AG+KRL 
Sbjct: 119 LPQGAVVGTSSLRRQCQISARRPDLVIHSLRGNVGTRLSKLDAGEYDAIILAAAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I++ L  E   P+ GQGA+ IE  +++     L++ +NH DT   V  ERA    L
Sbjct: 179 LEDRIRQALPAEFSLPAVGQGAVGIECRLDDQPLITLLQALNHSDTAVCVRAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  FA  +   L+  G+V A DG       R G R  A  +G   A+ +    
Sbjct: 239 EGGCQVPIGSFAVLEDDQLWLRGLVGAPDGSQMVVGERRGPREQAEQMGISLAEELLDGG 298

Query: 301 NKNVF 305
            +++ 
Sbjct: 299 ARDIL 303


>gi|32033974|ref|ZP_00134230.1| COG0181: Porphobilinogen deaminase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
          Length = 314

 Score =  279 bits (713), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 111/304 (36%), Positives = 163/304 (53%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            K   RI TR SPLAL  A   +  L    + P  ++ ++ + TKGD I +  L +IGGK
Sbjct: 6   MKDTLRIATRQSPLALWQANFVKDELEK--RFPELSVELVTMVTKGDVILDTPLAKIGGK 63

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  L+    D AVHS KD+P    +GL ++    RED RD F+S+  Q+L +L
Sbjct: 64  GLFVKELELALLENRADIAVHSMKDVPMTFPEGLGLAVICEREDPRDAFVSNKYQNLDEL 123

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GTSSLRR+  L+     + V   RG + TRL+KL+N +  AI+LA AG+ RL  
Sbjct: 124 PAGAVVGTSSLRRQCQLMAKYPHLEVKSLRGNVGTRLSKLDNGEYDAIILASAGLIRLGM 183

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
            + I+  +++E   P+ GQGA+ IET VN+ +    +  +NH  T   V  ERA    L 
Sbjct: 184 PERIRSFISVEQSLPAAGQGAVGIETRVNDERVLNYLATLNHNPTACCVIAERAMNTRLQ 243

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I GFA   G+ +    +V A DG      S   +R +A  +G   A+ +     
Sbjct: 244 GGCQVPIGGFATLNGNEITLNALVGALDGSNIIRASGVADRENAEQLGISVAEQLLAQGA 303

Query: 302 KNVF 305
             + 
Sbjct: 304 DKIL 307


>gi|254360510|ref|ZP_04976659.1| hydroxymethylbilane synthase [Mannheimia haemolytica PHL213]
 gi|261493197|ref|ZP_05989725.1| hydroxymethylbilane synthase [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261495982|ref|ZP_05992397.1| hydroxymethylbilane synthase [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|153091050|gb|EDN73055.1| hydroxymethylbilane synthase [Mannheimia haemolytica PHL213]
 gi|261308358|gb|EEY09646.1| hydroxymethylbilane synthase [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261311145|gb|EEY12320.1| hydroxymethylbilane synthase [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 311

 Score =  279 bits (713), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 111/304 (36%), Positives = 164/304 (53%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            K   RI TR SPLAL  A   +S L      P  ++ ++ + TKGD I +  L +IGGK
Sbjct: 1   MKDILRIATRQSPLALWQANFVKSELEK--HFPQLSVELVTMVTKGDIILDTPLAKIGGK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  L+    D AVHS KD+P    +GL ++    RED RD F+S+   SL+DL
Sbjct: 59  GLFVKELELALLENRADIAVHSMKDVPMSFPEGLGLAVICEREDPRDAFVSNNYHSLEDL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GTSSLRR+  L+     + V   RG + TRL+KL+N +  AI+LA AG+ RL  
Sbjct: 119 PKGAVVGTSSLRRQCQLMAKYPHLEVKSLRGNVGTRLSKLDNGEYDAIILASAGLIRLGL 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           ++ I+  +++E   P+ GQGA+ IET  N+ +    +  +NH  T   V  ERA    L 
Sbjct: 179 QERIRSYISVEQSLPAAGQGAVGIETRANDERILNYIAKLNHSSTACCVMAERAMNTRLQ 238

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I G+A  +G  L    +V + DG      S  G++ +A  +G   A+ +     
Sbjct: 239 GGCQVPIGGYATLEGDELTLNALVGSLDGSQIIRASAKGHKQEAEQLGILVAEQLLAQGA 298

Query: 302 KNVF 305
             + 
Sbjct: 299 DKIL 302


>gi|149376990|ref|ZP_01894744.1| porphobilinogen deaminase [Marinobacter algicola DG893]
 gi|149358767|gb|EDM47237.1| porphobilinogen deaminase [Marinobacter algicola DG893]
          Length = 313

 Score =  278 bits (712), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 107/306 (34%), Positives = 168/306 (54%), Gaps = 3/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M K+  RI TR S LAL  A   +S L  +H      + ++ + T+GD+I +  L +IGG
Sbjct: 1   MSKRTLRIATRSSALALWQAEFIKSELERLHD--NVTVELVKIKTQGDKILDVPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ +++G  D AVHS KD+P +  +GL + A   RED  D F+S+   ++  
Sbjct: 59  KGLFVKELEEAMLAGSADLAVHSMKDVPMEFPEGLGLVAICEREDPTDAFVSNDYDNVNA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GT+SLRR+A L  +R D+ +   RG + TRL KL+     AI+LA +G+KRL 
Sbjct: 119 LPHGAVVGTASLRREAQLRAYRPDLEIRTLRGNVNTRLAKLDAGDYQAIVLASSGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I+  L      P+ GQGA+ IE  +++ +   +++ ++H D+ D V  ERA    L
Sbjct: 179 FHDRIRYCLPDSISLPAVGQGALGIECRLDDAELIAMLEPLDHRDSSDRVKAERALNRRL 238

Query: 241 DGSCKSAIAGFAYCKG-STLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
            G C+  IA +A  +    L+  G+V A DG     V     R +   +GR+ A+ +  +
Sbjct: 239 QGGCQVPIAAYALLEDNDMLWLRGLVGAVDGTQVFRVEGRAPRSEGERLGRELAEDLLAL 298

Query: 300 SNKNVF 305
               V 
Sbjct: 299 GADKVL 304


>gi|261867394|ref|YP_003255316.1| porphobilinogen deaminase [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261412726|gb|ACX82097.1| porphobilinogen deaminase [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 308

 Score =  278 bits (712), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 109/305 (35%), Positives = 167/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +K  +I TR SPLAL  A   +  L  ++  P  N+ ++P+ TKGD I +  L +IGG
Sbjct: 1   MTQKSLKIATRQSPLALWQANYVKDLLQQLY--PDLNVELVPMVTKGDVILDSPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L++ E D AVHS KD+P +  +GL ++    RED RD F+S++ ++L +
Sbjct: 59  KGLFVKELENALLNKEADIAVHSMKDVPMQFPEGLGLAVICKREDPRDAFVSNSYRTLAE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L   R D+ +   RG + TRL+KL+N    AI+LA AG+ RL 
Sbjct: 119 LPQGAVVGTSSLRRQCQLKTLRPDLEIRSLRGNVGTRLSKLDNGDYDAIILASAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I   +++E   P+ GQGA+ IE   ++   Q+L+  +   +T   V  ERA    L
Sbjct: 179 LAERIASFIDVEQSLPAAGQGAVGIECRTDDVAVQQLLAPLADAETTSCVLAERAMNHHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I G+A  + S LY   +V + DG             +A  +G   A+ +    
Sbjct: 239 QGGCQVPIGGYAVLRDSELYLRALVGSVDGSTIIRAEGKSAVENADVLGVQIAEQLLAQG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 ADKIL 303


>gi|152983553|ref|YP_001351322.1| porphobilinogen deaminase [Pseudomonas aeruginosa PA7]
 gi|167008817|sp|A6VE37|HEM3_PSEA7 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|150958711|gb|ABR80736.1| porphobilinogen deaminase [Pseudomonas aeruginosa PA7]
          Length = 313

 Score =  278 bits (712), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 111/305 (36%), Positives = 163/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P++++GD++ +  L +IGG
Sbjct: 1   MSSREIRIATRQSALALWQAEYVKARLEQAH--PDLTVTLLPMTSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     RED RD F+S+T  SL  
Sbjct: 59  KGLFVKELETALLEGAADIAVHSMKDVPMDFPEGLGLYTICEREDPRDAFVSNTYASLDQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSVVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  ++++D  P+ GQGA+ IE    +     L+  ++H DT   V  ERA    L
Sbjct: 179 FESRIRSSISVDDSLPAGGQGAVGIECRTADADLHALLAPLHHADTALRVTAERALNKRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  L+  G+V   DG              A  +G   A  +    
Sbjct: 239 NGGCQVPIACYAIREGDQLWLRGLVGQPDGSQLLRAEGRAPLAQAEALGVQVADDLLAQG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AEAIL 303


>gi|165976435|ref|YP_001652028.1| porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|190150336|ref|YP_001968861.1| porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|303251057|ref|ZP_07337243.1| porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|303253601|ref|ZP_07339739.1| porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|307245920|ref|ZP_07528003.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|307248006|ref|ZP_07530035.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|307252646|ref|ZP_07534539.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|307257056|ref|ZP_07538831.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|307259334|ref|ZP_07541061.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|307261494|ref|ZP_07543163.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|307263677|ref|ZP_07545286.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|165876536|gb|ABY69584.1| porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|189915467|gb|ACE61719.1| porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|302647521|gb|EFL77739.1| porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|302650067|gb|EFL80237.1| porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306853139|gb|EFM85361.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|306855404|gb|EFM87578.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|306859891|gb|EFM91911.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306864427|gb|EFM96335.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|306866570|gb|EFM98431.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|306868777|gb|EFN00585.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|306870990|gb|EFN02725.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
          Length = 314

 Score =  278 bits (712), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 110/304 (36%), Positives = 163/304 (53%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            K   RI TR SPLAL  A   +  L    + P  ++ ++ + TKGD I +  L +IGGK
Sbjct: 6   MKDTLRIATRQSPLALWQANFVKDELEK--RFPELSVELVTMVTKGDVILDTPLAKIGGK 63

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  L+    D AVHS KD+P    +GL ++    RED RD F+S+  Q+L +L
Sbjct: 64  GLFVKELELALLENRADIAVHSMKDVPMTFPEGLGLAVICEREDPRDAFVSNKYQNLDEL 123

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GTSSLRR+  L+     + V   RG + TRL+KL+N +  AI+LA AG+ RL  
Sbjct: 124 PAGAVVGTSSLRRQCQLMAKYPHLEVKSLRGNVGTRLSKLDNGEYDAIILASAGLIRLGM 183

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
            + I+  +++E   P+ GQGA+ IET V++ +    +  +NH  T   V  ERA    L 
Sbjct: 184 PERIRSFISVEQSLPAAGQGAVGIETRVDDERVLNYLATLNHNPTACCVIAERAMNTRLQ 243

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I GFA   G+ +    +V A DG      S   +R +A  +G   A+ +     
Sbjct: 244 GGCQVPIGGFATLNGNEITLNALVGALDGSNIIRASGVADRENAEQLGISVAEQLLAQGA 303

Query: 302 KNVF 305
             + 
Sbjct: 304 DKIL 307


>gi|306844857|ref|ZP_07477440.1| porphobilinogen deaminase [Brucella sp. BO1]
 gi|306274789|gb|EFM56570.1| porphobilinogen deaminase [Brucella sp. BO1]
          Length = 314

 Score =  278 bits (712), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 143/305 (46%), Positives = 198/305 (64%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           +    +IGTR S LALA A+ TR  L + H +P   I I+P+ST GDRI +R L+E+GGK
Sbjct: 7   KNGTLKIGTRGSKLALAQAYLTRRLLQEAHGLPEDAIEILPMSTAGDRIQDRPLSEVGGK 66

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLFTEEIE+ L  G ID AVHS KDMPT L +GL +S +L RED RD FI  +A+   DL
Sbjct: 67  GLFTEEIEQALKDGRIDIAVHSTKDMPTVLPEGLHLSVFLEREDPRDAFIGRSARRFMDL 126

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              + +G+SSLRR+AL+ R R DI V+ +RG ++TRL KL+  +     LA AG++RL  
Sbjct: 127 PQGATVGSSSLRRQALIRRLRPDIEVVMYRGNVDTRLRKLDAGEVDGTFLACAGLRRLGL 186

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
             VI ++L+   FPP+PGQGAI IE+ + + +   L+  + H +T  ++ CERAFL  LD
Sbjct: 187 ADVITDLLDPSVFPPAPGQGAIGIESRIGDERIDALLAPLAHRETQIALACERAFLGSLD 246

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           GSC++ IAG A  +G  L F G++L  DG+  HEV+  G   DA  +G DAA  +R ++ 
Sbjct: 247 GSCRTPIAGLATVEGDRLSFRGMILTPDGRQAHEVTAEGAVSDAAALGTDAANRVRAMAG 306

Query: 302 KNVFN 306
            + F+
Sbjct: 307 PHFFD 311


>gi|308188851|ref|YP_003932982.1| Porphobilinogen deaminase [Pantoea vagans C9-1]
 gi|308059361|gb|ADO11533.1| Porphobilinogen deaminase [Pantoea vagans C9-1]
          Length = 317

 Score =  278 bits (712), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 116/305 (38%), Positives = 168/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K FRI TR SPLAL  A   +  LM  H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 5   MLDKIFRIATRQSPLALWQAHYVQQRLMSAH--PGLRVELVPMVTKGDIILDTPLAKVGG 62

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  +  G  D AVHS KD+P    +GL +     R+D RD F+SH   S+  
Sbjct: 63  KGLFVKELELAMQDGRADMAVHSMKDVPVSFPEGLGLVTICERDDPRDAFVSHHYDSIDA 122

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  +   R D+ +   RG + TRL KL+  +  AI+LA AG+KRL 
Sbjct: 123 LPQGAVVGTSSLRRQCQISARRPDLVIRSLRGNVGTRLGKLDAGEYDAIILAVAGLKRLG 182

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I++ +  E   P+ GQGA+ IE  +N+    +L++ +NH+DT   V  ERA    L
Sbjct: 183 MQDRIRQAMPAEVSLPAVGQGAVGIECRLNDSVLIDLLRALNHDDTEVCVRAERAMNTRL 242

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  FA  +G  L+  G+V A DG++     R G R  A  +G   A  +    
Sbjct: 243 EGGCQVPIGSFAVLEGDELWLRGMVGAPDGRVMVSGERRGPRAQAEQMGISLADELLNGG 302

Query: 301 NKNVF 305
            + + 
Sbjct: 303 AREIL 307


>gi|293390862|ref|ZP_06635196.1| porphobilinogen deaminase [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|290951396|gb|EFE01515.1| porphobilinogen deaminase [Aggregatibacter actinomycetemcomitans
           D7S-1]
          Length = 308

 Score =  278 bits (711), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 109/305 (35%), Positives = 167/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +K  +I TR SPLAL  A   +  L  ++  P  N+ ++P+ TKGD I +  L +IGG
Sbjct: 1   MTQKSLKIATRQSPLALWQANYVKDRLQQLY--PDLNVELVPMVTKGDVILDSPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L++ E D AVHS KD+P +  +GL ++    RED RD F+S++ ++L +
Sbjct: 59  KGLFVKELENALLNKEADIAVHSMKDVPMQFPEGLGLAVICKREDPRDAFVSNSYRTLAE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L + R D+ +   RG + TRL+KL+N    AI+LA AG+ RL 
Sbjct: 119 LPQGAVVGTSSLRRQCQLKKLRPDLEIRSLRGNVGTRLSKLDNGDYDAIILASAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I   +++E   P+ GQGA+ IE   ++   Q+L+  +   +T   V  ERA    L
Sbjct: 179 LAERIASFIDVEQSLPAAGQGAVGIECRTDDVAVQQLLAPLADAETTSCVLAERAMNHHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I G+A  + S LY   +V + DG             +A  +G   A  +    
Sbjct: 239 QGGCQVPIGGYAVLRDSELYLRALVGSVDGSTIIRAEGKSAVENADVLGVQIADQLLAQG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 ADKIL 303


>gi|332290269|ref|YP_004421121.1| porphobilinogen deaminase [Gallibacterium anatis UMN179]
 gi|330433165|gb|AEC18224.1| porphobilinogen deaminase [Gallibacterium anatis UMN179]
          Length = 309

 Score =  278 bits (711), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 114/305 (37%), Positives = 169/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+K   RI TR SPLAL  A   +  L  ++  P   + ++ + TKGD + +  L +IGG
Sbjct: 1   MQKDVLRIATRQSPLALWQANYIKHKLQVLY--PQLTVELVTMVTKGDVLLDTPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P +  +GL +S    RED RD F+S+   SL +
Sbjct: 59  KGLFVKELELALLEGRADIAVHSMKDVPMQFPQGLHLSVICEREDPRDAFVSNRYASLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L  ++V+GTSSLRR+  L   R DI +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPQNAVVGTSSLRRQCQLKALRPDIELKTLRGNVGTRLRKLDEGEYDAIILASAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           +++ I+  +  E   P+ GQGA+ +E   ++    +L+K + H+DTWD V  ERA    L
Sbjct: 179 EQQRIRSFIAPEVSLPAVGQGAVGVECRQDDEWVNQLLKPLLHQDTWDRVIAERAMNNRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  IAG+A   G  L+   +V A DG           R  A  +G   A+ +    
Sbjct: 239 QGGCQVPIAGYAILDGEQLFLRALVGAVDGSKVLRAEATAVRSQAEQLGIQVAEMLLAQG 298

Query: 301 NKNVF 305
            +++ 
Sbjct: 299 AQDLL 303


>gi|288940050|ref|YP_003442290.1| porphobilinogen deaminase [Allochromatium vinosum DSM 180]
 gi|288895422|gb|ADC61258.1| porphobilinogen deaminase [Allochromatium vinosum DSM 180]
          Length = 308

 Score =  278 bits (711), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 170/305 (55%), Gaps = 3/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLA+  A    + L  +H  P   + II ++TKGD++ +  L+++GG
Sbjct: 1   MSN-SIRIATRKSPLAMWQAEHVTARLKALH--PGLTVEIIGMTTKGDQLLDSPLSKVGG 57

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ +++GE D AVHS KD+P +  +GL ++  + RE+  D F+S+T  +L +
Sbjct: 58  KGLFVKELEQGMLAGEADIAVHSMKDVPVEFPEGLHLAVIMERENPYDAFVSNTYANLAE 117

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +GTSSLRR+  L   R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 118 LPEGACVGTSSLRRQCQLADRRPDLRIEPLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 177

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I++ ++  D  P+ GQGAI IE  V++ +  +L+  +   DT D V  ERA  A L
Sbjct: 178 FESRIRDCIDPVDSLPAIGQGAIGIECRVDDERVHQLIAPLADRDTTDRVLAERAMNARL 237

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I G A   G  L   G+V  +DG        +G R +A  IG   A  +    
Sbjct: 238 NGGCQVPIGGHAVLDGDRLILKGLVGTTDGSRILRAEASGPRAEAEAIGVRVADDLLGQG 297

Query: 301 NKNVF 305
              + 
Sbjct: 298 ADAIL 302


>gi|227357162|ref|ZP_03841531.1| porphobilinogen deaminase (hydroxymethylbilane synthase) [Proteus
           mirabilis ATCC 29906]
 gi|227162694|gb|EEI47661.1| porphobilinogen deaminase (hydroxymethylbilane synthase) [Proteus
           mirabilis ATCC 29906]
          Length = 313

 Score =  278 bits (711), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 116/305 (38%), Positives = 166/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M K   RI TR SPLA+  A   +  L   H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 1   MPKSTIRIATRQSPLAMWQALYVKEQLQIAH--PSLVVELVPMVTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+S   D AVHS KD+P    +GL +     RED RD F+S+   SL+ 
Sbjct: 59  KGLFVKELELALLSSRADIAVHSMKDVPIDFPEGLGLVTICEREDPRDAFVSNHYDSLEQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+ + D RG + TRL+KL+N    AI+LA AG+KRLK
Sbjct: 119 LPAGSVVGTSSLRRQCQLKALRPDLIIRDLRGNVGTRLSKLDNGDYDAIILAVAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I+  L+ E   P+ GQGA+ IE  +++   Q L+  +NH DT   V  ERA    L
Sbjct: 179 LTERIRSSLSAEQSLPAVGQGAVGIECRLDDHDTQALLAALNHADTATCVKAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +   ++   +V + DGK      R  +  DA   G   A+ +    
Sbjct: 239 EGGCQVPIGSYAIWQNDKIWLRALVGSPDGKTILRGERLVSPEDAEQAGISLAEELLDKG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|330890195|gb|EGH22856.1| porphobilinogen deaminase [Pseudomonas syringae pv. mori str.
           301020]
          Length = 313

 Score =  278 bits (711), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 106/305 (34%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLLVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     RED RD F+S+T  SL +
Sbjct: 59  KGLFVKELETALLEDNADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTFASLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++HED    V  ER+    L
Sbjct: 179 FENRITSAISVDDSLPAGGQGAVGIECRSVDAEIHALLAPLHHEDPAVRVIAERSLNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  ++  G+V    G +         +  A  +G   A+ +    
Sbjct: 239 NGGCQVPIACYAVLEGDDVWLRGLVGDPAGSVLLHAEARAPQTSAQALGVQVAEALLAQG 298

Query: 301 NKNVF 305
             ++ 
Sbjct: 299 GADIL 303


>gi|330957337|gb|EGH57597.1| porphobilinogen deaminase [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 313

 Score =  278 bits (710), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 108/305 (35%), Positives = 166/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLIVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P     GL +     RED RD F+S+T  SL+ 
Sbjct: 59  KGLFVKELETALLENNADIAVHSMKDVPMDFPPGLGLFCICEREDPRDAFVSNTFDSLET 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSVVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++HEDT   V  ER+    L
Sbjct: 179 FEDRITSSISVDDSLPAGGQGAVGIECRSVDAEIHALLAPLHHEDTAVRVIAERSLNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  ++  G+V    G +         +  A  +G + A+ +    
Sbjct: 239 NGGCQVPIACYAVLEGDNVWLRGLVGDPSGSLLLHAEARAPQTAAQALGVEVAEALLAQG 298

Query: 301 NKNVF 305
             ++ 
Sbjct: 299 AADIL 303


>gi|197287145|ref|YP_002153017.1| porphobilinogen deaminase [Proteus mirabilis HI4320]
 gi|238058999|sp|B4F1X3|HEM3_PROMH RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|194684632|emb|CAR46538.1| porphobilinogen deaminase [Proteus mirabilis HI4320]
          Length = 313

 Score =  278 bits (710), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 115/305 (37%), Positives = 166/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M K   RI TR SPLA+  A   +  L   H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 1   MSKSTIRIATRQSPLAMWQALYVKEQLQIAH--PSLVVELVPMVTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+S   D AVHS KD+P    +GL +     RED RD F+S+   SL+ 
Sbjct: 59  KGLFVKELELALLSSRADIAVHSMKDVPIDFPEGLGLVTICEREDPRDAFVSNHYDSLEQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+ + D RG + TRL+KL+N    AI+LA AG+KRLK
Sbjct: 119 LPAGSVVGTSSLRRQCQLKALRPDLIIRDLRGNVGTRLSKLDNGDYDAIILAVAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I+  L+ E   P+ GQGA+ IE  +++   Q L+  +NH DT   V  ERA    L
Sbjct: 179 LTERIRSSLSAEQSLPAVGQGAVGIECRLDDHDTQALLAALNHADTATCVKAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +   ++   +V + DG+      R  +  DA   G   A+ +    
Sbjct: 239 EGGCQVPIGSYAIWQNGKIWLRALVGSPDGETILRGERLVSPEDAEQAGISLAEELLDKG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|315634981|ref|ZP_07890262.1| hydroxymethylbilane synthase [Aggregatibacter segnis ATCC 33393]
 gi|315476243|gb|EFU66994.1| hydroxymethylbilane synthase [Aggregatibacter segnis ATCC 33393]
          Length = 346

 Score =  278 bits (710), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 109/305 (35%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M KK  +I TR SPLAL  A   ++ L  ++  P  +I ++ + TKGD I +  L +IGG
Sbjct: 39  MFKKTLKIATRQSPLALWQANFVKARLQQLY--PDLSIELVTMVTKGDVILDSPLAKIGG 96

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L++ E D AVHS KD+P +  +GL +S    RED RD F+S+T ++L +
Sbjct: 97  KGLFVKELENALLNNEADIAVHSMKDVPMQFPEGLGLSVICKREDPRDAFVSNTYRTLAE 156

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  L   R D+ +   RG + TRL+KL+N    AI+LA AG+ RL 
Sbjct: 157 LPPGAIVGTSSLRRQCQLKALRPDLEIRSLRGNVGTRLSKLDNGDFDAIILASAGLIRLG 216

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I   + +E   P+ GQGA+ IE   N+ + ++L+  +   +T   V  ERA    L
Sbjct: 217 LADRITSFIEVEQSLPAAGQGAVGIECRTNDEQVKQLLAPLADVETTYCVLAERAMNNRL 276

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I G+A  + S L    +V + DG             +A  +G   A+ +    
Sbjct: 277 QGGCQVPIGGYAVLRESMLNLRALVGSVDGSTIIRAEGQSAVENAEILGVQIAEQLLAQG 336

Query: 301 NKNVF 305
              + 
Sbjct: 337 ADKIL 341


>gi|306842959|ref|ZP_07475593.1| porphobilinogen deaminase [Brucella sp. BO2]
 gi|306286887|gb|EFM58412.1| porphobilinogen deaminase [Brucella sp. BO2]
          Length = 314

 Score =  278 bits (710), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 143/305 (46%), Positives = 198/305 (64%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           +    +IGTR S LALA A+ TR  L + H +P   I I+P+ST GDRI +R L+E+GGK
Sbjct: 7   KNGTLKIGTRGSKLALAQAYLTRRLLQEAHGLPEDAIEILPMSTAGDRIQDRPLSEVGGK 66

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLFTEEIE+ L  G ID AVHS KDMPT L +GL +S +L RED RD FI  +A+   DL
Sbjct: 67  GLFTEEIEQALKDGRIDIAVHSTKDMPTVLPEGLHLSVFLEREDPRDAFIGRSARRFMDL 126

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              + +G+SSLRR+AL+ R R DI V+ +RG ++TRL KL+  +     LA AG++RL  
Sbjct: 127 PQGATVGSSSLRRQALIRRLRPDIEVVMYRGNVDTRLRKLDAGEVDGTFLACAGLRRLGL 186

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
             VI ++L+   FPP+PGQGAI IE+ + + +   L+  + H +T  ++ CERAFL  LD
Sbjct: 187 ADVITDLLDPSVFPPAPGQGAIGIESRIGDERIDALLAPLAHRETQIALACERAFLGALD 246

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           GSC++ IAG A  +G  L F G++L  DG+  HEV+  G   DA  +G DAA  +R ++ 
Sbjct: 247 GSCRTPIAGLATVEGDRLSFRGMILTPDGRQAHEVTAEGVVSDAAALGTDAANRVRAMAG 306

Query: 302 KNVFN 306
            + F+
Sbjct: 307 PHFFD 311


>gi|296046581|gb|ADG86432.1| hydroxymethylbilane synthase [Francisella novicida]
          Length = 317

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 107/307 (34%), Positives = 161/307 (52%), Gaps = 4/307 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M++   RI TR S LAL  A   ++ L   H     N+ ++P++TKGD I +  L ++GG
Sbjct: 1   MKQTTVRIATRKSALALWQAEYVKAQLEHFHD--GINVELVPMTTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++    D AVHS KD+P    +GL +    PRED RD F+S+T +SL D
Sbjct: 59  KGLFVKELEVAMLEDRADIAVHSMKDVPVDFPEGLGLEVICPREDPRDAFVSNTIKSLSD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ + D RG + TRL KL+  +  AI+LA AG+ RL+
Sbjct: 119 LPQGSIVGTSSLRRQCQLKASRPDLDIRDLRGNVNTRLRKLDEGQYDAIILAAAGLIRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I + +  E+  P+ GQGA+ IE   ++   + L+  +    T   V  ERA    L
Sbjct: 179 MSERIAQFIEPEEMLPANGQGAVGIECRNDDATIKALLAPLECATTRIRVLAERAMNRAL 238

Query: 241 DGSCKSAIAGFAYC--KGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRF 298
            G C+  I  +      G  ++  G+V + DG    E    G   +   +G   AQ +  
Sbjct: 239 QGGCQVPIGSYGVISADGKNIHLRGLVGSVDGSEMIESEITGPVEEGEALGNKLAQELLS 298

Query: 299 ISNKNVF 305
                + 
Sbjct: 299 RGADKIL 305


>gi|240949414|ref|ZP_04753755.1| porphobilinogen deaminase [Actinobacillus minor NM305]
 gi|240296163|gb|EER46819.1| porphobilinogen deaminase [Actinobacillus minor NM305]
          Length = 308

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 108/304 (35%), Positives = 160/304 (52%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            K   RI TR SPLAL  A   ++ L      P   I ++ + TKGD I +  L +IGGK
Sbjct: 1   MKDTLRIATRQSPLALWQANFVKAELEK--HFPELQIELVTMVTKGDIILDTPLAKIGGK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  L+    D AVHS KD+P    +GL ++    RED RD F+S+  Q+L +L
Sbjct: 59  GLFVKELELALLENRADIAVHSMKDVPMTFPEGLGLAVICEREDPRDAFVSNQYQNLDEL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GTSSLRR+  L+     + +   RG + TRL+KL+N +  AI+LA AG+ RL  
Sbjct: 119 PKGAVVGTSSLRRQCQLMAAYPHLEIKSLRGNVGTRLSKLDNGEYDAIILASAGLIRLGM 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
            + I+  +++E   P+ GQGA+ IET +++ +    +  +NH+ T   V  ERA  A L 
Sbjct: 179 PERIRSFISVEQSLPAAGQGAVGIETRLDDQRVLSYLAKLNHQPTAYRVIAERAMNAHLQ 238

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I GFA  +   L    +V + DG      S       A  +G + A  +     
Sbjct: 239 GGCQVPIGGFATLENDELTLNALVGSLDGSTIIRASGVAPVDKAEQLGIEVATKLLAQGA 298

Query: 302 KNVF 305
             + 
Sbjct: 299 DKIL 302


>gi|327479188|gb|AEA82498.1| porphobilinogen deaminase [Pseudomonas stutzeri DSM 4166]
          Length = 312

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 108/305 (35%), Positives = 164/305 (53%), Gaps = 3/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L +IGG
Sbjct: 1   MS-REIRIATRKSALALWQAEYVKARLEASH--PGLKVSLVPMVSRGDKLLDAPLAKIGG 57

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  E D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 58  KGLFVKELETALLENEADIAVHSMKDVPMEFPEGLGLYCICEREDPRDAFVSNRFDSLDA 117

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 118 LPPGSVVGTSSLRRQAQLLARRPDLKIQFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 177

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I+  + +++  P+ GQGA+ IE    + +   L+  +NH  T   V  ERA    L
Sbjct: 178 FGERIRSSIGVDESLPAGGQGAVGIECRTGDSEVHALLACLNHAPTATRVVAERALNKRL 237

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  L+  G+V   DG +           +A  +G   A+ +    
Sbjct: 238 NGGCQVPIACYAVLEGEQLWLRGLVGQPDGTLLLRAEGRAPAAEAEALGVQVAEELLDQG 297

Query: 301 NKNVF 305
            + + 
Sbjct: 298 AEQIL 302


>gi|146280919|ref|YP_001171072.1| porphobilinogen deaminase [Pseudomonas stutzeri A1501]
 gi|145569124|gb|ABP78230.1| porphobilinogen deaminase [Pseudomonas stutzeri A1501]
          Length = 314

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 108/305 (35%), Positives = 164/305 (53%), Gaps = 3/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L +IGG
Sbjct: 3   MS-REIRIATRKSALALWQAEYVKARLEASH--PGLKVSLVPMVSRGDKLLDAPLAKIGG 59

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  E D AVHS KD+P +  +GL +     RED RD F+S+   SL  
Sbjct: 60  KGLFVKELETALLENEADIAVHSMKDVPMEFPEGLGLYCICEREDPRDAFVSNRFDSLDA 119

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 120 LPPGSVVGTSSLRRQAQLLARRPDLKIQFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 179

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I+  + +++  P+ GQGA+ IE    + +   L+  +NH  T   V  ERA    L
Sbjct: 180 FGERIRSSIGVDESLPAGGQGAVGIECRTGDSEVHALLACLNHAPTATRVVAERALNKRL 239

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  L+  G+V   DG +           +A  +G   A+ +    
Sbjct: 240 NGGCQVPIACYAVLEGEQLWLRGLVGQPDGTLLLRAEGRAPAAEAEALGVQVAEELLDQG 299

Query: 301 NKNVF 305
            + + 
Sbjct: 300 AEQIL 304


>gi|71738146|ref|YP_272379.1| porphobilinogen deaminase [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|71558699|gb|AAZ37910.1| porphobilinogen deaminase [Pseudomonas syringae pv. phaseolicola
           1448A]
          Length = 328

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 107/305 (35%), Positives = 166/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 16  MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLLVTLVPMVSRGDKLLDSPLSKIGG 73

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     RED RD F+S+T  SL +
Sbjct: 74  KGLFVKELETALLEDNADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTFASLDE 133

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 134 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 193

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++HEDT   V  ER+    L
Sbjct: 194 FENRITSAISVDDSLPAGGQGAVGIECRSVDAEIHALLAPLHHEDTAVRVIAERSLNKHL 253

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  ++  G+V    G +         +  A  +G   A+ +    
Sbjct: 254 NGGCQVPIACYAVLEGDDVWLRGLVGDPAGSVLLHAEARAPQTSAQALGVQVAEALLAQG 313

Query: 301 NKNVF 305
             ++ 
Sbjct: 314 AADIL 318


>gi|325124236|gb|ADY83759.1| porphobilinogen deaminase [Acinetobacter calcoaceticus PHEA-2]
          Length = 309

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 110/303 (36%), Positives = 169/303 (55%), Gaps = 2/303 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            K  +I TR SPLAL  A   R+ L ++H  P   + ++   T+GD+I +  L +IGGKG
Sbjct: 5   MKTLKIATRQSPLALWQAEHIRARLEELH--PDLTVELVKFVTQGDKILDTPLAKIGGKG 62

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+  ++  DL 
Sbjct: 63  LFVKELEAALLDGRADLAVHSMKDVPMALPEGLTLAVICEREDPLDAFVSNRFETFADLP 122

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRRK+ +L+ R D+ +ID RG + TRL KL+  +  AI+LA AG+KRL   
Sbjct: 123 QGAKVGTSSLRRKSQILKQRPDLQIIDLRGNVGTRLAKLDEGQYDAIILASAGLKRLGLS 182

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I+  L  +   P+ GQGA+ +E    +     L++ + HE+T   V  ERAF A L+G
Sbjct: 183 ERIRHCLTPDISLPAVGQGALGLECRAVDQDVLALIQPLLHEETDVCVRAERAFNAYLEG 242

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  IAG+A  +   ++  G V + DG+            +A  +G + A+ +      
Sbjct: 243 GCQVPIAGYATLQNGQIHIEGRVGSPDGQTLLRAELTDEANNAQQLGENLARNLLDQGAG 302

Query: 303 NVF 305
            + 
Sbjct: 303 ELL 305


>gi|62290744|ref|YP_222537.1| porphobilinogen deaminase [Brucella abortus bv. 1 str. 9-941]
 gi|82700655|ref|YP_415229.1| porphobilinogen deaminase [Brucella melitensis biovar Abortus 2308]
 gi|189024957|ref|YP_001935725.1| porphobilinogen deaminase [Brucella abortus S19]
 gi|225853324|ref|YP_002733557.1| porphobilinogen deaminase [Brucella melitensis ATCC 23457]
 gi|254690032|ref|ZP_05153286.1| porphobilinogen deaminase [Brucella abortus bv. 6 str. 870]
 gi|254694521|ref|ZP_05156349.1| porphobilinogen deaminase [Brucella abortus bv. 3 str. Tulya]
 gi|254696146|ref|ZP_05157974.1| porphobilinogen deaminase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254731064|ref|ZP_05189642.1| porphobilinogen deaminase [Brucella abortus bv. 4 str. 292]
 gi|256045496|ref|ZP_05448379.1| porphobilinogen deaminase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256112222|ref|ZP_05453143.1| porphobilinogen deaminase [Brucella melitensis bv. 3 str. Ether]
 gi|256258286|ref|ZP_05463822.1| porphobilinogen deaminase [Brucella abortus bv. 9 str. C68]
 gi|256263189|ref|ZP_05465721.1| porphobilinogen deaminase [Brucella melitensis bv. 2 str. 63/9]
 gi|260546007|ref|ZP_05821747.1| porphobilinogen deaminase [Brucella abortus NCTC 8038]
 gi|260562805|ref|ZP_05833291.1| porphobilinogen deaminase [Brucella melitensis bv. 1 str. 16M]
 gi|260755568|ref|ZP_05867916.1| porphobilinogen deaminase [Brucella abortus bv. 6 str. 870]
 gi|260758791|ref|ZP_05871139.1| porphobilinogen deaminase [Brucella abortus bv. 4 str. 292]
 gi|260760515|ref|ZP_05872858.1| porphobilinogen deaminase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884592|ref|ZP_05896206.1| porphobilinogen deaminase [Brucella abortus bv. 9 str. C68]
 gi|261214839|ref|ZP_05929120.1| porphobilinogen deaminase [Brucella abortus bv. 3 str. Tulya]
 gi|265991918|ref|ZP_06104475.1| porphobilinogen deaminase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265993649|ref|ZP_06106206.1| porphobilinogen deaminase [Brucella melitensis bv. 3 str. Ether]
 gi|297247130|ref|ZP_06930848.1| porphobilinogen deaminase [Brucella abortus bv. 5 str. B3196]
 gi|23821695|sp|Q8YJB0|HEM3_BRUME RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|75496218|sp|Q57B08|HEM3_BRUAB RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|123768401|sp|Q2YLM5|HEM3_BRUA2 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|238058730|sp|B2S842|HEM3_BRUA1 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|254800235|sp|C0RFD1|HEM3_BRUMB RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|62196876|gb|AAX75176.1| HemC, porphobilinogen deaminase [Brucella abortus bv. 1 str. 9-941]
 gi|82616756|emb|CAJ11843.1| Porphobilinogen deaminase [Brucella melitensis biovar Abortus 2308]
 gi|189020529|gb|ACD73251.1| Porphobilinogen deaminase [Brucella abortus S19]
 gi|225641689|gb|ACO01603.1| porphobilinogen deaminase [Brucella melitensis ATCC 23457]
 gi|260096114|gb|EEW79990.1| porphobilinogen deaminase [Brucella abortus NCTC 8038]
 gi|260152821|gb|EEW87913.1| porphobilinogen deaminase [Brucella melitensis bv. 1 str. 16M]
 gi|260669109|gb|EEX56049.1| porphobilinogen deaminase [Brucella abortus bv. 4 str. 292]
 gi|260670947|gb|EEX57768.1| porphobilinogen deaminase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675676|gb|EEX62497.1| porphobilinogen deaminase [Brucella abortus bv. 6 str. 870]
 gi|260874120|gb|EEX81189.1| porphobilinogen deaminase [Brucella abortus bv. 9 str. C68]
 gi|260916446|gb|EEX83307.1| porphobilinogen deaminase [Brucella abortus bv. 3 str. Tulya]
 gi|262764630|gb|EEZ10551.1| porphobilinogen deaminase [Brucella melitensis bv. 3 str. Ether]
 gi|263002984|gb|EEZ15277.1| porphobilinogen deaminase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093111|gb|EEZ17246.1| porphobilinogen deaminase [Brucella melitensis bv. 2 str. 63/9]
 gi|297174299|gb|EFH33646.1| porphobilinogen deaminase [Brucella abortus bv. 5 str. B3196]
 gi|326539601|gb|ADZ87816.1| porphobilinogen deaminase [Brucella melitensis M5-90]
          Length = 314

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 143/305 (46%), Positives = 198/305 (64%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           +    +IGTR S LALA A+ TR  L + H +P   I I+P+ST GDRI +R L+E+GGK
Sbjct: 7   KNGTLKIGTRGSKLALAQAYLTRRLLQEAHGLPEDAIEILPMSTAGDRIQDRPLSEVGGK 66

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLFTEEIE+ L  G ID AVHS KDMPT L +GL +S +L RED RD FI  +A+   DL
Sbjct: 67  GLFTEEIEQALKDGRIDIAVHSTKDMPTALPEGLHLSVFLEREDPRDAFIGRSARRFMDL 126

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              + +G+SSLRR+AL+ R R DI V+ +RG ++TRL KL+  +     LA AG++RL  
Sbjct: 127 PQGATVGSSSLRRQALIRRLRPDIEVVMYRGNVDTRLRKLDAGEVDGTFLACAGLRRLGL 186

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
             VI ++L+   FPP+PGQGAI IE+ + + +   L+  + H +T  ++ CERAFL  LD
Sbjct: 187 ADVITDVLDPSVFPPAPGQGAIGIESRIGDERIDVLLAPLAHRETQIALACERAFLGALD 246

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           GSC++ IAG A  +G  L F G++L  DG+  HEV+  G   DA  +G DAA  +R ++ 
Sbjct: 247 GSCRTPIAGLATVEGDRLSFRGMILTPDGRQAHEVTAEGVVSDAAALGTDAANRVRAMAG 306

Query: 302 KNVFN 306
            + F+
Sbjct: 307 PHFFD 311


>gi|23502739|ref|NP_698866.1| porphobilinogen deaminase [Brucella suis 1330]
 gi|161619804|ref|YP_001593691.1| porphobilinogen deaminase [Brucella canis ATCC 23365]
 gi|163843911|ref|YP_001628315.1| porphobilinogen deaminase [Brucella suis ATCC 23445]
 gi|254704902|ref|ZP_05166730.1| porphobilinogen deaminase [Brucella suis bv. 3 str. 686]
 gi|254707583|ref|ZP_05169411.1| porphobilinogen deaminase [Brucella pinnipedialis M163/99/10]
 gi|254708880|ref|ZP_05170691.1| porphobilinogen deaminase [Brucella pinnipedialis B2/94]
 gi|256030406|ref|ZP_05444020.1| porphobilinogen deaminase [Brucella pinnipedialis M292/94/1]
 gi|256059864|ref|ZP_05450051.1| porphobilinogen deaminase [Brucella neotomae 5K33]
 gi|256158389|ref|ZP_05456287.1| porphobilinogen deaminase [Brucella ceti M490/95/1]
 gi|256253808|ref|ZP_05459344.1| porphobilinogen deaminase [Brucella ceti B1/94]
 gi|256370288|ref|YP_003107799.1| porphobilinogen deaminase [Brucella microti CCM 4915]
 gi|260169315|ref|ZP_05756126.1| porphobilinogen deaminase [Brucella sp. F5/99]
 gi|260567624|ref|ZP_05838094.1| porphobilinogen deaminase [Brucella suis bv. 4 str. 40]
 gi|261220941|ref|ZP_05935222.1| porphobilinogen deaminase [Brucella ceti B1/94]
 gi|261315070|ref|ZP_05954267.1| porphobilinogen deaminase [Brucella pinnipedialis M163/99/10]
 gi|261316373|ref|ZP_05955570.1| porphobilinogen deaminase [Brucella pinnipedialis B2/94]
 gi|261323834|ref|ZP_05963031.1| porphobilinogen deaminase [Brucella neotomae 5K33]
 gi|261755596|ref|ZP_05999305.1| porphobilinogen deaminase [Brucella suis bv. 3 str. 686]
 gi|261758828|ref|ZP_06002537.1| porphobilinogen deaminase [Brucella sp. F5/99]
 gi|265987445|ref|ZP_06100002.1| porphobilinogen deaminase [Brucella pinnipedialis M292/94/1]
 gi|265996901|ref|ZP_06109458.1| porphobilinogen deaminase [Brucella ceti M490/95/1]
 gi|38258150|sp|Q8FYI6|HEM3_BRUSU RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|189042875|sp|A9M8M2|HEM3_BRUC2 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|189042876|sp|B0CID9|HEM3_BRUSI RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|23348756|gb|AAN30781.1| porphobilinogen deaminase [Brucella suis 1330]
 gi|161336615|gb|ABX62920.1| porphobilinogen deaminase [Brucella canis ATCC 23365]
 gi|163674634|gb|ABY38745.1| porphobilinogen deaminase [Brucella suis ATCC 23445]
 gi|256000451|gb|ACU48850.1| porphobilinogen deaminase [Brucella microti CCM 4915]
 gi|260157142|gb|EEW92222.1| porphobilinogen deaminase [Brucella suis bv. 4 str. 40]
 gi|260919525|gb|EEX86178.1| porphobilinogen deaminase [Brucella ceti B1/94]
 gi|261295596|gb|EEX99092.1| porphobilinogen deaminase [Brucella pinnipedialis B2/94]
 gi|261299814|gb|EEY03311.1| porphobilinogen deaminase [Brucella neotomae 5K33]
 gi|261304096|gb|EEY07593.1| porphobilinogen deaminase [Brucella pinnipedialis M163/99/10]
 gi|261738812|gb|EEY26808.1| porphobilinogen deaminase [Brucella sp. F5/99]
 gi|261745349|gb|EEY33275.1| porphobilinogen deaminase [Brucella suis bv. 3 str. 686]
 gi|262551369|gb|EEZ07359.1| porphobilinogen deaminase [Brucella ceti M490/95/1]
 gi|264659642|gb|EEZ29903.1| porphobilinogen deaminase [Brucella pinnipedialis M292/94/1]
          Length = 314

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 143/305 (46%), Positives = 198/305 (64%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           +    +IGTR S LALA A+ TR  L + H +P   I I+P+ST GDRI +R L+E+GGK
Sbjct: 7   KNGTLKIGTRGSKLALAQAYLTRRLLQEAHGLPEDAIEILPMSTAGDRIQDRPLSEVGGK 66

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLFTEEIE+ L  G ID AVHS KDMPT L +GL +S +L RED RD FI  +A+   DL
Sbjct: 67  GLFTEEIEQALKDGRIDIAVHSTKDMPTVLPEGLHLSVFLEREDPRDAFIGRSARRFMDL 126

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              + +G+SSLRR+AL+ R R DI V+ +RG ++TRL KL+  +     LA AG++RL  
Sbjct: 127 PQGATVGSSSLRRQALIRRLRPDIEVVMYRGNVDTRLRKLDAGEVDGTFLACAGLRRLGL 186

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
             VI ++L+   FPP+PGQGAI IE+ + + +   L+  + H +T  ++ CERAFL  LD
Sbjct: 187 ADVITDLLDPSVFPPAPGQGAIGIESRIGDERIDVLLAPLAHRETQIALACERAFLGALD 246

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           GSC++ IAG A  +G  L F G++L  DG+  HEV+  G   DA  +G DAA  +R ++ 
Sbjct: 247 GSCRTPIAGLATVEGDRLSFRGMILTPDGRQAHEVTAEGVVSDAAALGTDAANRVRAMAG 306

Query: 302 KNVFN 306
            + F+
Sbjct: 307 PHFFD 311


>gi|159045244|ref|YP_001534038.1| porphobilinogen deaminase [Dinoroseobacter shibae DFL 12]
 gi|157913004|gb|ABV94437.1| porphobilinogen deaminase [Dinoroseobacter shibae DFL 12]
          Length = 347

 Score =  277 bits (708), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 127/303 (41%), Positives = 183/303 (60%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P +IGTR S LALA A ETR+ L     +P     I+ + T GDRI +R+L+EIGGKGLF
Sbjct: 40  PLKIGTRGSLLALAQAHETRARLSAAFDLPEEAFEIVVIKTTGDRIQDRSLSEIGGKGLF 99

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T EIE  ++ G ID AVHS KDMP     GL +  YLPRED+RD F++    +L DL   
Sbjct: 100 TREIEDAMLDGSIDIAVHSMKDMPVDTPAGLALDTYLPREDVRDAFVTLDGGTLADLPEG 159

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           +V+G+SSLRR+A L   R D+ +++FRG ++TR+ KL +  AHA  LA AG+ RL  ++V
Sbjct: 160 AVVGSSSLRRRAQLAHRRPDLQLVEFRGNVQTRMKKLGDGVAHATFLAMAGLNRLGMDEV 219

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
            +  +  ED  P+  QG I IE   ++P+A E++  I+   +   + CERA+L+ LDGSC
Sbjct: 220 PRSAIAPEDMLPAVAQGCIGIERRADDPRAAEMLAAIHDGPSGHRLACERAYLSALDGSC 279

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           ++ IAG A   G +++    +L  DG      S      DA  +GR+ A+ +R  +    
Sbjct: 280 QTPIAGLAELDGGSIHLRAEILRPDGSEVLSDSETAPVEDAAKMGREVAERLRARAPDGF 339

Query: 305 FNF 307
           F++
Sbjct: 340 FSW 342


>gi|88861269|ref|ZP_01135901.1| porphobilinogen deaminase [Pseudoalteromonas tunicata D2]
 gi|88816750|gb|EAR26573.1| porphobilinogen deaminase [Pseudoalteromonas tunicata D2]
          Length = 312

 Score =  277 bits (708), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 106/301 (35%), Positives = 165/301 (54%), Gaps = 2/301 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
             RI TR S LAL  A   ++ L   H  P   + ++P+ST+GD+I +  L +IGGKGLF
Sbjct: 7   TLRIATRKSALALWQAEFVKAQLEIHH--PGIQVELVPMSTQGDKILDTPLAKIGGKGLF 64

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +E+E+ ++ G  D AVHS KD+P +  +GL+++    RED RD F+S+  +++++L   
Sbjct: 65  VKELEQAMLEGRADIAVHSMKDVPVEFPEGLELNTICEREDPRDAFVSNRFKTIEELPQG 124

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           +V+GTSSLRR+  +   R D+ + D RG + TRL KL+  +  AI+LA AG+ RL+  + 
Sbjct: 125 AVVGTSSLRRQCQIRALRPDLEIRDLRGNVNTRLAKLDEGQYDAIILAAAGLIRLEMPQR 184

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I   +  E   P+ GQGA+ IE   ++   ++L+  + H +T   V  ERA    L+G C
Sbjct: 185 IASFIEPEQSLPANGQGAVGIECRSDDITTKQLLAALEHTETRIRVLAERAMNRRLEGGC 244

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           +  I  FA   G  +   G+V A DG         G   DA  +G + A  +       +
Sbjct: 245 QVPIGAFAQVSGEHITIRGLVGAIDGSEILRDQVQGLCADAEQLGVELANKLLAQGADKI 304

Query: 305 F 305
            
Sbjct: 305 L 305


>gi|289625848|ref|ZP_06458802.1| porphobilinogen deaminase [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289646420|ref|ZP_06477763.1| porphobilinogen deaminase [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|298484668|ref|ZP_07002771.1| Porphobilinogen deaminase [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|298160808|gb|EFI01826.1| Porphobilinogen deaminase [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|320326724|gb|EFW82769.1| porphobilinogen deaminase [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320331302|gb|EFW87245.1| porphobilinogen deaminase [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330867941|gb|EGH02650.1| porphobilinogen deaminase [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|330881670|gb|EGH15819.1| porphobilinogen deaminase [Pseudomonas syringae pv. glycinea str.
           race 4]
          Length = 313

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 107/305 (35%), Positives = 166/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLLVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     RED RD F+S+T  SL +
Sbjct: 59  KGLFVKELETALLEDNADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTFASLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++HEDT   V  ER+    L
Sbjct: 179 FENRITSAISVDDSLPAGGQGAVGIECRSVDAEIHALLAPLHHEDTAVRVIAERSLNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  ++  G+V    G +         +  A  +G   A+ +    
Sbjct: 239 NGGCQVPIACYAVLEGDDVWLRGLVGDPAGSVLLHAEARAPQTSAQALGVQVAEALLAQG 298

Query: 301 NKNVF 305
             ++ 
Sbjct: 299 AADIL 303


>gi|304398148|ref|ZP_07380023.1| porphobilinogen deaminase [Pantoea sp. aB]
 gi|304354434|gb|EFM18806.1| porphobilinogen deaminase [Pantoea sp. aB]
          Length = 317

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 115/305 (37%), Positives = 169/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K FRI TR SPLAL  A   +  LM  H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 5   MLDKIFRIATRQSPLALWQAHYVQQRLMSAH--PGLRVELVPMVTKGDIILDTPLAKVGG 62

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  +  G  D AVHS KD+P    +GL +     R+D RD F+SH   S+  
Sbjct: 63  KGLFVKELELAMQDGRADMAVHSMKDVPVSFPEGLGLVTICERDDPRDAFVSHHYDSIDA 122

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  +   R D+ +   RG + TRL KL+  +  AI+LA AG+KRL 
Sbjct: 123 LPQGAIVGTSSLRRQCQISARRPDLVIRSLRGNVGTRLGKLDAGEYDAIILAVAGLKRLG 182

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I++ +  E   P+ GQGA+ IE  +++    +L++ +NH+DT   V  ERA    L
Sbjct: 183 LEDRIRQAMPAEVSLPAVGQGAVGIECRLDDSVLIDLLRALNHDDTEVCVRAERAMNTRL 242

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  FA  +G+ L+  G+V A DG++     R G R  A  +G   A  +    
Sbjct: 243 EGGCQVPIGSFAVLEGNDLWLRGMVGAPDGRVMVSGERRGPRAQAEQMGISLADELLNGG 302

Query: 301 NKNVF 305
            + + 
Sbjct: 303 AREIL 307


>gi|37528461|ref|NP_931806.1| porphobilinogen deaminase [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|55976477|sp|Q7MYN1|HEM3_PHOLL RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|36787899|emb|CAE17016.1| porphobilinogen deaminase (PBG) (hydroxymethylbilane synthase)
           (HMBS) (pre-uroporphyrinogen synthase) [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 313

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 116/305 (38%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLA+  A   +  L   H  P   + ++P+ T+GD I +  L +IGG
Sbjct: 1   MSTKTIRIATRQSPLAMWQALYVQQKLQQCH--PDLEVQLVPMVTQGDVILDTPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     R+D RD F+S    SL +
Sbjct: 59  KGLFVKELELALLEGRADIAVHSMKDVPISFPEGLGLVTICERDDPRDAFVSVKYHSLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ V D RG + TRLNKL+N    AI+LA AG+KRLK
Sbjct: 119 LPTGSIVGTSSLRRQCQLRELRPDLIVRDLRGNVGTRLNKLDNGHYDAIILAVAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I+  L  E   P+ GQGA+ IE  +++ + Q L+  +NH DT   V  ERA    L
Sbjct: 179 LHERIRTPLTAEQSLPAVGQGAVGIECRLDDQQTQTLLAPLNHYDTEVCVLAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +   ++   +V A DG +     R     DA   G + A+ +    
Sbjct: 239 EGGCQVPIGSYAIWQDGKIWLRALVGAPDGSVIIRGERTALPKDACQAGVELAEELLERG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|78224425|ref|YP_386172.1| porphobilinogen deaminase [Geobacter metallireducens GS-15]
 gi|123742774|sp|Q39QM7|HEM3_GEOMG RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|78195680|gb|ABB33447.1| Porphobilinogen deaminase [Geobacter metallireducens GS-15]
          Length = 318

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 109/305 (35%), Positives = 164/305 (53%), Gaps = 3/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RIGTR S LAL  A   +  L   +  P   + ++ + T GD+I +  L ++GG
Sbjct: 1   MAPKQLRIGTRASQLALWQANWVKGELEKRY--PGMAVELVKIKTMGDKILDVPLAQVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE+ ++ GEID AVHS KD+PT+  +GL +     RED RD  IS   +   D
Sbjct: 59  KGLFVKEIEEAMLRGEIDIAVHSMKDVPTEFPEGLGLYCITEREDPRDAVISRGVKFA-D 117

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + IGTS+LRR+A +L+ R D+ ++  RG +ETR+ KL +    A++LA AG+ RL 
Sbjct: 118 LPQGARIGTSALRRQAQILKVRPDLQMVVIRGNVETRIRKLTDENLDAVILAAAGLNRLG 177

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               + E L +E   P+ GQGA+ IE  +++   ++ +   NH DT  +V  ERA L   
Sbjct: 178 FADQVSEYLPVELSLPAIGQGALGIECRLDDETIKDTIAFFNHPDTAHAVRAERALLWRC 237

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA      G TL   G V + DG    + + +G   +   +G   A+ +    
Sbjct: 238 EGGCQVPIAAHGQVSGDTLTLTGFVASVDGTRSVKDTISGPVTECEKLGIALAEKLLADG 297

Query: 301 NKNVF 305
              + 
Sbjct: 298 AHEIL 302


>gi|325294021|ref|YP_004279885.1| Porphobilinogen deaminase [Agrobacterium sp. H13-3]
 gi|325061874|gb|ADY65565.1| Porphobilinogen deaminase [Agrobacterium sp. H13-3]
          Length = 309

 Score =  277 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 172/306 (56%), Positives = 225/306 (73%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KPFRIGTR SPLALA A+ETR+ LM  H +P     I+ LSTKGDRIT+R L+EIGG
Sbjct: 1   MQTKPFRIGTRGSPLALAQAYETRNRLMSAHGLPEDMFEIVVLSTKGDRITDRALSEIGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFTEE+E +L+SGE+D AVHS+KDMPT L KGL +SA+LPRED+RD FI  TA  L +
Sbjct: 61  KGLFTEELESQLLSGELDIAVHSSKDMPTVLPKGLYLSAFLPREDMRDAFIGRTAPKLLE 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+G++SLRR+AL+ R R D+SVI FRG++ETRL KL   +A A LLA+AG+KRL 
Sbjct: 121 LPQGAVVGSASLRRQALIRRLRPDLSVIIFRGQVETRLRKLEEGQADATLLAFAGLKRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E V  +IL+ +DFPP+P QGAIC+E+ + + +  EL+  IN   T+D+V CERAFLA L
Sbjct: 181 MENVPTDILDPKDFPPAPAQGAICVESRIGDTRMDELLSPINDIPTYDAVTCERAFLAAL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAGFA C G  L+F G++L  DG+  H V  +G R DA ++GR A + +R  +
Sbjct: 241 DGSCRTPIAGFATCHGEELHFSGLILTPDGQTSHSVEISGARKDAEDLGRKAGEDVRARA 300

Query: 301 NKNVFN 306
             N F+
Sbjct: 301 GSNFFD 306


>gi|39998374|ref|NP_954325.1| porphobilinogen deaminase [Geobacter sulfurreducens PCA]
 gi|55976461|sp|Q747I1|HEM3_GEOSL RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|39985320|gb|AAR36675.1| porphobilinogen deaminase [Geobacter sulfurreducens PCA]
 gi|298507314|gb|ADI86037.1| hydroxymethylbilane synthase [Geobacter sulfurreducens KN400]
          Length = 318

 Score =  277 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 168/305 (55%), Gaps = 3/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RIGTR S LAL  A   +S L   +  P   + ++ + T GD+I +  L ++GG
Sbjct: 1   MALNRLRIGTRASQLALWQANWVKSELEKRY--PGMEVELVKIKTIGDKILDVPLAQVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE+ ++ GEID AVHS KD+PT+  +GL +     RED RD FIS+      +
Sbjct: 59  KGLFVKEIEEAMLRGEIDIAVHSMKDVPTEFPEGLGLVCITEREDPRDAFISNGVTFA-N 117

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + IGTS+LRR+A LL+ R D+ ++  RG +ETR+ KL  +K  A++LA AG+KRL 
Sbjct: 118 LPQGAKIGTSALRRQAQLLKVRPDLEMVIIRGNVETRIRKLTEDKLDAVILAAAGLKRLG 177

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
              V+ E L ++   P+ GQGA+ +E  +++   +E +   NH DT  +V  ERA L   
Sbjct: 178 FTDVVTEYLPVDLSLPAIGQGALGLECRLDDQAVRETIDFFNHPDTAHAVRAERALLWRC 237

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA      G +L   G + + DG    + S +G   D   +G   A+ +    
Sbjct: 238 EGGCQVPIAAHGQVSGDSLTLTGFIASVDGTRSVKESISGPVTDCEKLGIALAEKLLADG 297

Query: 301 NKNVF 305
              + 
Sbjct: 298 GHEIL 302


>gi|88813066|ref|ZP_01128308.1| porphobilinogen deaminase [Nitrococcus mobilis Nb-231]
 gi|88789699|gb|EAR20824.1| porphobilinogen deaminase [Nitrococcus mobilis Nb-231]
          Length = 309

 Score =  277 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 106/305 (34%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M ++  RI TR SPLAL  A    + L   +  P   + ++ ++T+GDRI +  L  IGG
Sbjct: 1   MSRRRLRIATRKSPLALWQAEHVAAELRRRY--PELEVELVAMTTRGDRILDTPLARIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           K LF +E+E+ +  G  D AVHS KD+P +L +G+ +   L RED  D F+++  Q L  
Sbjct: 59  KALFVKELERGIWEGRADIAVHSIKDVPAELPEGMHLPVVLEREDPCDAFVANLYQDLAA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L + + +GT+SLRR+  L   R D+ V   RG ++TRL KL + K  AI+LA AG++RL 
Sbjct: 119 LPIGARVGTASLRRECQLRAQRPDLRVGTLRGNVQTRLAKLESGKFDAIVLAAAGLRRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I+  L  E   P+ GQGA+ IE   ++ +  EL+  + H  ++  +  ERA  A L
Sbjct: 179 LAERIRCTLTPEQSLPAVGQGALGIECRSDDREINELIAPLTHSPSYLRITAERAVNARL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +GSC+  IA FA   GS ++   +V + DG         G     +++G   A+ +    
Sbjct: 239 EGSCQVPIAAFAVLDGSNIWLRALVGSRDGSCVLRGEIRGPAGTGVSLGGQLAEDLLSRG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 AAELL 303


>gi|257485539|ref|ZP_05639580.1| porphobilinogen deaminase [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|331011831|gb|EGH91887.1| porphobilinogen deaminase [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 313

 Score =  277 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 107/305 (35%), Positives = 166/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLLVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     RED RD F+S+T  SL +
Sbjct: 59  KGLFVKELETALLEDNADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTFASLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++HEDT   V  ER+    L
Sbjct: 179 FENRITSAISVDDSLPAGGQGAVGIECRSVDAEIHALLAPLHHEDTAVRVIAERSLNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  ++  G+V    G +         +  A  +G   A+ +    
Sbjct: 239 NGGCQVPIACYAVLEGDDVWLRGLVGDPAGSVLLHAEARAPQTSAQALGVQVAEALLAQG 298

Query: 301 NKNVF 305
             ++ 
Sbjct: 299 AADIL 303


>gi|299771850|ref|YP_003733876.1| porphobilinogen deaminase [Acinetobacter sp. DR1]
 gi|298701938|gb|ADI92503.1| porphobilinogen deaminase [Acinetobacter sp. DR1]
          Length = 309

 Score =  277 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 110/303 (36%), Positives = 169/303 (55%), Gaps = 2/303 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            K  +I TR SPLAL  A   R+ L ++H  P   + ++   T+GD+I +  L +IGGKG
Sbjct: 5   MKTLKIATRQSPLALWQAEHIRARLQELH--PDLTVELVKFVTQGDKILDTPLAKIGGKG 62

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+  +   DL 
Sbjct: 63  LFVKELEAALLDGRADLAVHSMKDVPMALPEGLSLAVICEREDPLDAFVSNQFEKFADLP 122

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRRK+ +L+ R D+ +ID RG + TRL KL++ +  AI+LA AG+KRL   
Sbjct: 123 QGAKVGTSSLRRKSQILKQRPDLQIIDLRGNVGTRLAKLDDGQYDAIILASAGLKRLGLS 182

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I+  L  +   P+ GQGA+ +E    +     L++ + HE+T   V  ERAF A L+G
Sbjct: 183 ERIRHCLTPDISLPAVGQGALGLECRAADQDVLALIQPLLHEETDVCVRAERAFNAYLEG 242

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  IAG+A  +   ++  G V + DG+            +A  +G + A+ +      
Sbjct: 243 GCQVPIAGYATLQNGQIHIEGRVGSPDGQTLLRAELTDEASNAHQLGENLARNLLDQGAG 302

Query: 303 NVF 305
            + 
Sbjct: 303 ELL 305


>gi|330812535|ref|YP_004356997.1| porphobilinogen deaminase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327380643|gb|AEA71993.1| porphobilinogen deaminase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 313

 Score =  277 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 167/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MCPREIRIATRKSALALWQAEYVKARLEAAH--PGLIVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  E D AVHS KD+P    +GL +     RED RD F+S+T  SL+ 
Sbjct: 59  KGLFVKELETALLDNEADIAVHSMKDVPMDFPEGLGLFCICEREDPRDAFVSNTFSSLEA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSVVGTSSLRRQAQLLTRRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    +     L+  ++HEDT   V  ERA    L
Sbjct: 179 FEDRITSAISVDDSLPAGGQGAVGIECRSADSDIHALLAPLHHEDTATRVFAERALNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  ++  G+V   +G           R DA  +G   A+ +    
Sbjct: 239 NGGCQVPIACYAVLEGEQVWLRGLVGDPNGGRLLSAEARAPRHDAEALGVRVAEDLLSQG 298

Query: 301 NKNVF 305
             ++ 
Sbjct: 299 AADIL 303


>gi|119947244|ref|YP_944924.1| porphobilinogen deaminase [Psychromonas ingrahamii 37]
 gi|166217780|sp|A1T0R0|HEM3_PSYIN RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|119865848|gb|ABM05325.1| porphobilinogen deaminase [Psychromonas ingrahamii 37]
          Length = 310

 Score =  276 bits (706), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 105/305 (34%), Positives = 167/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR SPLA+  A   +S L+  H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 1   MTAQKIRIATRHSPLAMWQANFIKSELLKYH--PNLIVELLPMKTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P    +GL ++    RED  D F+S+  + L +
Sbjct: 59  KGLFVKELEVAILEGRADIAVHSIKDVPVDFPEGLGLTTICKREDPHDAFVSNHYKQLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GT SLRR+  +L  R DI + + RG + TRL KL+  +  AI+LA AG+ RL+
Sbjct: 119 LPEGAIVGTCSLRRQCQILALRPDIIIKNLRGNVNTRLRKLDEGEYDAIILAAAGLMRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I  ++  E   P+ GQGA+ IE  +++ +   L+K +   +T   +  ERA   +L
Sbjct: 179 MQHRITSLIAPEVSLPAVGQGAVGIECRLDDEQTITLLKPLEDPETRIRITAERAMNLKL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  FA  +   L+  G+V + DGK        G++ DA  +G   A+ +    
Sbjct: 239 QGGCQVPIGSFAILENEQLFLRGLVGSVDGKQIIRKEITGHQNDAQQLGITLAEQLLACG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AEEIL 303


>gi|229593301|ref|YP_002875420.1| porphobilinogen deaminase [Pseudomonas fluorescens SBW25]
 gi|259646262|sp|C3K424|HEM3_PSEFS RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|229365167|emb|CAY53424.1| porphobilinogen deaminase [Pseudomonas fluorescens SBW25]
          Length = 313

 Score =  276 bits (706), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 116/305 (38%), Positives = 168/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLKVSLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  E D AVHS KD+P    +GL +     RED RD F+S+T  SL  
Sbjct: 59  KGLFVKELETALLENEADIAVHSMKDVPMDFPEGLGLFCICEREDPRDAFVSNTYASLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L L S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPLGSIVGTSSLRRQAQLLTRRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   +++ED  P+ GQGA+ IE    +     L+K ++H DT   V  ERA    L
Sbjct: 179 FEDRITSAISVEDSLPAGGQGAVGIECRTADSDIHALLKPLDHHDTEVRVTAERALNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  L+  G+V   +G         G +CDA  +G   AQ +    
Sbjct: 239 NGGCQVPIACYAVLEGENLWLRGLVGDPEGGNLLTAEVRGPQCDATALGIQVAQALLDKG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 AGAIL 303


>gi|260556364|ref|ZP_05828583.1| porphobilinogen deaminase [Acinetobacter baumannii ATCC 19606]
 gi|260410419|gb|EEX03718.1| porphobilinogen deaminase [Acinetobacter baumannii ATCC 19606]
          Length = 314

 Score =  276 bits (706), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 108/303 (35%), Positives = 170/303 (56%), Gaps = 2/303 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            K  +I TR SPLAL  A   R+ L ++H  P   + ++   T+GD+I +  L +IGGKG
Sbjct: 10  MKTLKIATRQSPLALWQAEHIRARLQELH--PDLTVELVKFVTQGDKILDTPLAKIGGKG 67

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+  +   DL 
Sbjct: 68  LFVKELEAALLDGRADLAVHSMKDVPMALPEGLTLAVICEREDPLDAFVSNQFEKFADLP 127

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRRK+ +L+ R D+ +ID RG + TRL KL++ +  AI+LA AG+KRL   
Sbjct: 128 QGAKVGTSSLRRKSQILKQRPDLQIIDLRGNVGTRLAKLDDGQYDAIILASAGLKRLGLA 187

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I+  +      P+ GQGA+ +E   ++ +   L++ + H +T   V  ERAF A L+G
Sbjct: 188 ERIRHCIEPSVSLPAVGQGALGLECRADDQEVLALIQPLLHPETDVCVRAERAFNAYLEG 247

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  IAG+A  +   ++  G V + DG+            +A  +G + A+ +      
Sbjct: 248 GCQVPIAGYATLQDGKIHIEGRVGSVDGQTLLRAELTDEANNAQQLGENLARNLLDQGAG 307

Query: 303 NVF 305
           ++ 
Sbjct: 308 DLL 310


>gi|17986460|ref|NP_539094.1| porphobilinogen deaminase [Brucella melitensis bv. 1 str. 16M]
 gi|237816250|ref|ZP_04595243.1| porphobilinogen deaminase [Brucella abortus str. 2308 A]
 gi|17982057|gb|AAL51358.1| porphobilinogen deaminase [Brucella melitensis bv. 1 str. 16M]
 gi|237788317|gb|EEP62532.1| porphobilinogen deaminase [Brucella abortus str. 2308 A]
          Length = 342

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 143/305 (46%), Positives = 198/305 (64%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           +    +IGTR S LALA A+ TR  L + H +P   I I+P+ST GDRI +R L+E+GGK
Sbjct: 35  KNGTLKIGTRGSKLALAQAYLTRRLLQEAHGLPEDAIEILPMSTAGDRIQDRPLSEVGGK 94

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLFTEEIE+ L  G ID AVHS KDMPT L +GL +S +L RED RD FI  +A+   DL
Sbjct: 95  GLFTEEIEQALKDGRIDIAVHSTKDMPTALPEGLHLSVFLEREDPRDAFIGRSARRFMDL 154

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              + +G+SSLRR+AL+ R R DI V+ +RG ++TRL KL+  +     LA AG++RL  
Sbjct: 155 PQGATVGSSSLRRQALIRRLRPDIEVVMYRGNVDTRLRKLDAGEVDGTFLACAGLRRLGL 214

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
             VI ++L+   FPP+PGQGAI IE+ + + +   L+  + H +T  ++ CERAFL  LD
Sbjct: 215 ADVITDVLDPSVFPPAPGQGAIGIESRIGDERIDVLLAPLAHRETQIALACERAFLGALD 274

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           GSC++ IAG A  +G  L F G++L  DG+  HEV+  G   DA  +G DAA  +R ++ 
Sbjct: 275 GSCRTPIAGLATVEGDRLSFRGMILTPDGRQAHEVTAEGVVSDAAALGTDAANRVRAMAG 334

Query: 302 KNVFN 306
            + F+
Sbjct: 335 PHFFD 339


>gi|225628089|ref|ZP_03786124.1| porphobilinogen deaminase [Brucella ceti str. Cudo]
 gi|225616914|gb|EEH13961.1| porphobilinogen deaminase [Brucella ceti str. Cudo]
          Length = 342

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 143/305 (46%), Positives = 198/305 (64%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           +    +IGTR S LALA A+ TR  L + H +P   I I+P+ST GDRI +R L+E+GGK
Sbjct: 35  KNGTLKIGTRGSKLALAQAYLTRRLLQEAHGLPEDAIEILPMSTAGDRIQDRPLSEVGGK 94

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLFTEEIE+ L  G ID AVHS KDMPT L +GL +S +L RED RD FI  +A+   DL
Sbjct: 95  GLFTEEIEQALKDGRIDIAVHSTKDMPTVLPEGLHLSVFLEREDPRDAFIGRSARRFMDL 154

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              + +G+SSLRR+AL+ R R DI V+ +RG ++TRL KL+  +     LA AG++RL  
Sbjct: 155 PQGATVGSSSLRRQALIRRLRPDIEVVMYRGNVDTRLRKLDAGEVDGTFLACAGLRRLGL 214

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
             VI ++L+   FPP+PGQGAI IE+ + + +   L+  + H +T  ++ CERAFL  LD
Sbjct: 215 ADVITDLLDPSVFPPAPGQGAIGIESRIGDERIDVLLAPLAHRETQIALACERAFLGALD 274

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           GSC++ IAG A  +G  L F G++L  DG+  HEV+  G   DA  +G DAA  +R ++ 
Sbjct: 275 GSCRTPIAGLATVEGDRLSFRGMILTPDGRQAHEVTAEGVVSDAAALGTDAANRVRAMAG 334

Query: 302 KNVFN 306
            + F+
Sbjct: 335 PHFFD 339


>gi|260551059|ref|ZP_05825263.1| porphobilinogen deaminase [Acinetobacter sp. RUH2624]
 gi|260405826|gb|EEW99314.1| porphobilinogen deaminase [Acinetobacter sp. RUH2624]
          Length = 314

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 108/303 (35%), Positives = 171/303 (56%), Gaps = 2/303 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            K  +I TR SPLAL  A   R+ L ++H  P   + ++   T+GD+I +  L +IGGKG
Sbjct: 10  MKTLKIATRQSPLALWQAEHIRARLQELH--PDLTVELVKFVTQGDKILDTPLAKIGGKG 67

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+  +   DL 
Sbjct: 68  LFVKELEAALLDGRADLAVHSMKDVPMALPEGLTLAVICEREDPLDAFVSNQFEKFADLP 127

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRRK+ +L+ R D+ ++D RG + TRL+KL++ +  AI+LA AG+KRL  E
Sbjct: 128 QGAKVGTSSLRRKSQILKQRPDLQIVDLRGNVGTRLSKLDDGQYDAIILASAGLKRLGLE 187

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I+  +      P+ GQGA+ +E   ++     L++ + H +T   V  ERAF A L+G
Sbjct: 188 ERIRHCIEPSVSLPAVGQGALGLECRADDQDVLALIQPLLHTETDVCVRAERAFNAYLEG 247

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  IAG+A  +   ++  G V + DG+            +A  +G + A+ +      
Sbjct: 248 GCQVPIAGYATLQDGKIHIEGRVGSPDGQTLLRAELTDEAHNAQQLGENLARNLLEQGAG 307

Query: 303 NVF 305
           ++ 
Sbjct: 308 DLL 310


>gi|330985679|gb|EGH83782.1| porphobilinogen deaminase [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 313

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 107/305 (35%), Positives = 167/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLLVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     RED RD F+S+T  SL +
Sbjct: 59  KGLFVKELETALLEDNADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTFASLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+ ++  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDASEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++HEDT   V  ER+    L
Sbjct: 179 FENRITSAISVDDSLPAGGQGAVGIECRSVDAEIHALLAPLHHEDTAVRVIAERSLNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  ++  G+V    G +         +  A  +G   A+ +    
Sbjct: 239 NGGCQVPIACYAVLEGDDVWLRGLVGDPSGSVLLHAEARAPQTSAQALGVQVAEALLAQG 298

Query: 301 NKNVF 305
             ++ 
Sbjct: 299 AADIL 303


>gi|15966832|ref|NP_387185.1| porphobilinogen deaminase [Sinorhizobium meliloti 1021]
 gi|307301660|ref|ZP_07581419.1| porphobilinogen deaminase [Sinorhizobium meliloti BL225C]
 gi|307316316|ref|ZP_07595760.1| porphobilinogen deaminase [Sinorhizobium meliloti AK83]
 gi|23821697|sp|Q92LH7|HEM3_RHIME RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|15076104|emb|CAC47658.1| Probable porphobilinogen deaminase [Sinorhizobium meliloti 1021]
 gi|306898156|gb|EFN28898.1| porphobilinogen deaminase [Sinorhizobium meliloti AK83]
 gi|306903358|gb|EFN33947.1| porphobilinogen deaminase [Sinorhizobium meliloti BL225C]
          Length = 309

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 156/305 (51%), Positives = 214/305 (70%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KPFRIGTR SPLA+A   ETR  L   H +PP    I+ LSTKGDRIT+R+L EIGG
Sbjct: 1   MQTKPFRIGTRGSPLAMAQTHETRDRLAAAHGLPPEMFEIVILSTKGDRITDRSLAEIGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFTEE+E++L+SG++D AVHS+KDMPTKL +GL +SA+LPREDIRD F+  +A+ L D
Sbjct: 61  KGLFTEELEQQLLSGDLDFAVHSSKDMPTKLPEGLFLSAFLPREDIRDAFVGRSAKRLVD 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +G+SSLRR+AL+ R R DI VI +RG++ETRL KL   +    LLAYAG++RL 
Sbjct: 121 LPQGATVGSSSLRRQALIRRLRPDIDVITYRGQVETRLRKLAEGQVDGTLLAYAGLRRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E V  E+L+ E+FPP+P QGAIC+E  + + +   L+  I+   T ++V+CER FLA L
Sbjct: 181 MEHVPTELLDPEEFPPAPAQGAICVEARIGDDRINTLLAAIDDPRTHEAVSCERGFLATL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG+A   G+ + F G++L  DG   H++  +G   DA  +G++A + IR  +
Sbjct: 241 DGSCRTPIAGYAQSDGTHIRFAGMILTPDGTTSHQIEIDGRAADAERLGQEAGERIRAKA 300

Query: 301 NKNVF 305
               F
Sbjct: 301 GPGFF 305


>gi|293610070|ref|ZP_06692371.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827302|gb|EFF85666.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 314

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 109/303 (35%), Positives = 167/303 (55%), Gaps = 2/303 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            K  +I TR SPLAL  A   R+ L ++H  P   + ++   T+GD+I +  L +IGGKG
Sbjct: 10  MKTLKIATRQSPLALWQAEHIRARLEELH--PDLTVELVKFVTQGDKILDTPLAKIGGKG 67

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+  +   DL 
Sbjct: 68  LFVKELEAALLDGRADLAVHSMKDVPMALPEGLTLAVICEREDPLDAFVSNQFEKFADLP 127

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRRK+ +L+ R D+ +ID RG + TRL KL+  +  AI+LA AG+KRL   
Sbjct: 128 QGAKVGTSSLRRKSQILKQRPDLQIIDLRGNVGTRLAKLDEGQYDAIILASAGLKRLGLS 187

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I+  L  +   P+ GQGA+ +E    +     L++ + H +T   V  ERAF A L+G
Sbjct: 188 ERIRHCLTPDISLPAVGQGALGLECRAADQDVLALIQPLLHAETDVCVRAERAFNAYLEG 247

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  IAG+A  +   ++  G V + DG+            +A  +G + A+ +      
Sbjct: 248 GCQVPIAGYATLQNGQIHIEGRVGSPDGQTLLRAELTDEANNAQQLGENLARNLLDQGAG 307

Query: 303 NVF 305
            + 
Sbjct: 308 ELL 310


>gi|255320960|ref|ZP_05362133.1| porphobilinogen deaminase [Acinetobacter radioresistens SK82]
 gi|262379948|ref|ZP_06073103.1| porphobilinogen deaminase [Acinetobacter radioresistens SH164]
 gi|255301924|gb|EET81168.1| porphobilinogen deaminase [Acinetobacter radioresistens SK82]
 gi|262298142|gb|EEY86056.1| porphobilinogen deaminase [Acinetobacter radioresistens SH164]
          Length = 307

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 110/301 (36%), Positives = 166/301 (55%), Gaps = 2/301 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
             +I TR SPLAL  A   R+ L ++H  P   + ++   T+GD+I +  L +IGGKGLF
Sbjct: 4   TLKIATRKSPLALWQAEHIRACLQELH--PGLTVELVTFVTQGDKILDTPLAKIGGKGLF 61

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +E+E  L+ G  D AVHS KD+P  L  GL +     RED  D F+S+  +  + L   
Sbjct: 62  VKELEAALLDGRADLAVHSMKDVPMHLPTGLSLPVICEREDPCDAFVSNRFEGFEQLPKG 121

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           + +GTSSLRRK  +L+ R D++++D RG + TRL+KL+  +  AI+LA AG+KRL   + 
Sbjct: 122 ATVGTSSLRRKTQILKARPDLNILDLRGNVGTRLSKLDAGEYDAIILASAGLKRLGLSER 181

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           IK  L+ E   P+ GQGA+ +E   ++    +L+  + HE T   V  ERAF + L+G C
Sbjct: 182 IKHTLSPELSLPAVGQGALGLECRTDDQAILDLISPLQHEQTSICVRAERAFNSHLEGGC 241

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           +  IA +A  +   L   G V + DG I      +G    A  +G + A+ +       +
Sbjct: 242 QVPIAAYATLENGQLQLEGRVGSVDGLILLSSQVSGQPEHAEQLGIELAENLLSQGAGEL 301

Query: 305 F 305
            
Sbjct: 302 L 302


>gi|193076128|gb|ABO10737.2| porphobilinogen deaminase [Acinetobacter baumannii ATCC 17978]
          Length = 309

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 108/303 (35%), Positives = 170/303 (56%), Gaps = 2/303 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            K  +I TR SPLAL  A   R+ L ++H  P   + ++   T+GD+I +  L +IGGKG
Sbjct: 5   MKTLKIATRQSPLALWQAEHIRARLQELH--PDLTVELVKFVTQGDKILDTPLAKIGGKG 62

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+  +   DL 
Sbjct: 63  LFVKELEAALLDGRADLAVHSMKDVPMALPEGLTLAVICEREDPLDAFVSNQFEKFADLP 122

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRRK+ +L+ R D+ +ID RG + TRL KL++ +  AI+LA AG+KRL   
Sbjct: 123 QGAKVGTSSLRRKSQILKQRPDLQIIDLRGNVGTRLAKLDDGQYDAIILASAGLKRLGLA 182

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I+  +      P+ GQGA+ +E   ++ +   L++ + H +T   V  ERAF A L+G
Sbjct: 183 ERIRHCIEPSVSLPAVGQGALGLECRADDQEVLALIQPLLHPETDVCVRAERAFNAYLEG 242

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  IAG+A  +   ++  G V + DG+            +A  +G + A+ +      
Sbjct: 243 GCQVPIAGYATLQDGKIHIEGRVGSVDGQTLLRAELTDEANNAQQLGENLARNLLDQGAG 302

Query: 303 NVF 305
           ++ 
Sbjct: 303 DLL 305


>gi|184156604|ref|YP_001844943.1| porphobilinogen deaminase [Acinetobacter baumannii ACICU]
 gi|332874912|ref|ZP_08442763.1| hydroxymethylbilane synthase [Acinetobacter baumannii 6014059]
 gi|183208198|gb|ACC55596.1| Porphobilinogen deaminase [Acinetobacter baumannii ACICU]
 gi|322506491|gb|ADX01945.1| hemC [Acinetobacter baumannii 1656-2]
 gi|323516370|gb|ADX90751.1| porphobilinogen deaminase [Acinetobacter baumannii TCDC-AB0715]
 gi|332736855|gb|EGJ67831.1| hydroxymethylbilane synthase [Acinetobacter baumannii 6014059]
          Length = 309

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 108/303 (35%), Positives = 170/303 (56%), Gaps = 2/303 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            K  +I TR SPLAL  A   R+ L ++H  P   + ++   T+GD+I +  L +IGGKG
Sbjct: 5   MKTLKIATRQSPLALWQAEHIRARLQELH--PDLTVELVKFVTQGDKILDTPLAKIGGKG 62

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+  +   DL 
Sbjct: 63  LFVKELEAALLDGRADLAVHSMKDVPMALPEGLTLAVICEREDPLDAFVSNQFEKFADLP 122

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRRK+ +L+ R D+ +ID RG + TRL KL++ +  AI+LA AG+KRL   
Sbjct: 123 QGAKVGTSSLRRKSQILKQRPDLQIIDLRGNVGTRLAKLDDGQYDAIILASAGLKRLGLA 182

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I+  +      P+ GQGA+ +E   ++ +   L++ + H +T   V  ERAF A L+G
Sbjct: 183 ERIRHCIEPSVSLPAVGQGALGLECRADDQEVLTLIQPLLHPETDVCVRAERAFNAYLEG 242

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  IAG+A  +   ++  G V + DG+            +A  +G + A+ +      
Sbjct: 243 GCQVPIAGYATLQDGKIHIEGRVGSVDGQTLLRAELTDEANNAQQLGENLARNLLDQGAG 302

Query: 303 NVF 305
           ++ 
Sbjct: 303 DLL 305


>gi|2495175|sp|Q59684|HEM3_PROMI RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|726359|gb|AAC44329.1| porphobilinogen deaminase [Proteus mirabilis]
          Length = 313

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 117/305 (38%), Positives = 166/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M K   RI TR SPLA+  A   +  L   H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 1   MPKSTIRIATRQSPLAMWQALYVKEQLQIAH--PSLVVELVPMVTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+S   D AVHS KD+P    +GL +     RED RD F+S+   SL+ 
Sbjct: 59  KGLFVKELELALLSSRADIAVHSMKDVPIDFPEGLGLVTICEREDPRDAFVSNHYDSLEQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+ + D RG + TRL+KL+N    AI+LA AG+KRLK
Sbjct: 119 LPAGSVVGTSSLRRQCQLKALRPDLIIRDLRGNVGTRLSKLDNGDYDAIILAVAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I+  L+ E   P+ GQGA+ IE  +++   Q L+  +NH DT   V  ERA    L
Sbjct: 179 LTERIRSSLSAEQSLPAVGQGAVGIECRLDDHDTQALLAALNHADTATCVKAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +   ++   +V A DGK      R  +  DA   G   A+ +    
Sbjct: 239 EGGCQVPIGSYAIWQNDKIWLRALVGAPDGKTILRGERLVSPEDAEQAGISLAEELLDKG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|238918086|ref|YP_002931600.1| porphobilinogen deaminase, [Edwardsiella ictaluri 93-146]
 gi|238867654|gb|ACR67365.1| porphobilinogen deaminase, putative [Edwardsiella ictaluri 93-146]
          Length = 317

 Score =  276 bits (705), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 113/302 (37%), Positives = 159/302 (52%), Gaps = 2/302 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
             RI TR SPLAL  A   R  L+   + P   I ++P+ T+GD + +  L ++GGKGLF
Sbjct: 11  TLRIATRQSPLALWQAHYVRDQLLA--QWPQLTIELVPMVTRGDVLLDTPLAKVGGKGLF 68

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +E+E  L+ G  D AVHS KD+P     GL +     RED RD F+S    SL+ L   
Sbjct: 69  VKELELALLEGRADIAVHSMKDVPVAFPDGLGLVTICQREDPRDAFVSPRFASLEQLPPG 128

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           SV+GTSSLRR+  L   R D+ + D RG + TRL KL+     AI+LA AG+KRL+ E  
Sbjct: 129 SVVGTSSLRRQCQLRAARPDLQIRDLRGNVGTRLAKLDAGDYDAIILAAAGLKRLQLEDR 188

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I+  L  E   P+ GQGA+ IE  + +   + L+  +NH +T   V  ERA    L+G C
Sbjct: 189 IRTPLTPEQSLPAVGQGAVGIECRLADDATRRLLAPLNHAETALRVCAERAMNTRLEGGC 248

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           +  I  +A   G  L+   +V A DG +     R G    A  +G   A  +     + +
Sbjct: 249 QVPIGSYAEIDGDRLWLRALVGAPDGSLMICGERRGPLAQAEAMGTALADELLARGARAI 308

Query: 305 FN 306
            +
Sbjct: 309 LD 310


>gi|330720492|gb|EGG98789.1| Porphobilinogen deaminase [gamma proteobacterium IMCC2047]
          Length = 312

 Score =  276 bits (705), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 111/307 (36%), Positives = 162/307 (52%), Gaps = 3/307 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR S LAL  A   ++ L   H+     + +  + T+GD+I +  L ++GG
Sbjct: 1   MTNKLLRIATRGSQLALWQAEYVKARLEAAHE--NLQVELDIMKTRGDKILDVPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL ++    RE   D F+S+   S   
Sbjct: 59  KGLFVKELETALLEKRADIAVHSMKDVPMEFPEGLGLAVICEREQPTDAFVSNHFASFDS 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  +   R DI++   RG + TRL KL++ +  AI+LA AG+ RL 
Sbjct: 119 LPQGAVVGTSSLRRQCHIRALRPDINIEFLRGNVNTRLAKLDDGQFDAIILASAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I E L+IE   P+ GQGA+ +E  V++     L+ V++ EDT   V  ERA    L
Sbjct: 179 MGDRITEQLSIEQSLPAAGQGAVGVECRVDDKDTLALLSVLHDEDTSICVTAERAMNRHL 238

Query: 241 DGSCKSAIAGFAYC-KGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           +G C+  IAGFA   +G  +Y  G+V   DG         G   DA  IG   A  +   
Sbjct: 239 NGGCQVPIAGFAVLEEGGQVYLQGMVANPDGDEVLRAELRGPVADAEQIGIRVADDLLSQ 298

Query: 300 SNKNVFN 306
             + + +
Sbjct: 299 GAQAILD 305


>gi|294851125|ref|ZP_06791798.1| porphobilinogen deaminase [Brucella sp. NVSL 07-0026]
 gi|294819714|gb|EFG36713.1| porphobilinogen deaminase [Brucella sp. NVSL 07-0026]
          Length = 314

 Score =  276 bits (705), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 143/305 (46%), Positives = 198/305 (64%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           +    +IGTR S LALA A+ TR  L + H +P   I I+P+ST GDRI +R L+E+GGK
Sbjct: 7   KNGTLKIGTRGSKLALAQAYLTRRLLQEAHGLPEDAIEILPMSTAGDRIQDRPLSEVGGK 66

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLFTEEIE+ L  G ID AVHS KDMPT L +GL +S +L RED RD FI  +A+   DL
Sbjct: 67  GLFTEEIEQALKDGRIDIAVHSTKDMPTVLPEGLHLSVFLEREDPRDAFIGRSARRFMDL 126

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              + +G+SSLRR+AL+ R R DI V+ +RG ++TRL KL+  +     LA AG++RL  
Sbjct: 127 PQGATVGSSSLRRQALIRRLRPDIEVVMYRGNVDTRLRKLDAGEVDGTFLACAGLRRLGL 186

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
             VI ++L+   FPP+PGQGAI IE+ + + +   L+  + H +T  ++ CERAFL  LD
Sbjct: 187 ADVITDLLDPSVFPPAPGQGAIGIESRIGDERIDVLLAPLAHRETQIALACERAFLGALD 246

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           GSC++ IAG A  +G  L F G++L  DG+  HEV+  G   DA  +G DAA  +R ++ 
Sbjct: 247 GSCRTPIAGLATVEGDRLSFRGMILTPDGRQAHEVTAEGVVSDAAALGTDAANRVRAMAG 306

Query: 302 KNVFN 306
            + F+
Sbjct: 307 SHFFD 311


>gi|254713697|ref|ZP_05175508.1| porphobilinogen deaminase [Brucella ceti M644/93/1]
 gi|254715953|ref|ZP_05177764.1| porphobilinogen deaminase [Brucella ceti M13/05/1]
 gi|261217716|ref|ZP_05931997.1| porphobilinogen deaminase [Brucella ceti M13/05/1]
 gi|261321437|ref|ZP_05960634.1| porphobilinogen deaminase [Brucella ceti M644/93/1]
 gi|260922805|gb|EEX89373.1| porphobilinogen deaminase [Brucella ceti M13/05/1]
 gi|261294127|gb|EEX97623.1| porphobilinogen deaminase [Brucella ceti M644/93/1]
          Length = 314

 Score =  276 bits (705), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 143/305 (46%), Positives = 198/305 (64%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           +    +IGTR S LALA A+ TR  L + H +P   I I+P+ST GDRI +R L+E+GGK
Sbjct: 7   KNGTLKIGTRGSKLALAQAYLTRRLLQEAHGLPEDAIEILPMSTAGDRIQDRPLSEVGGK 66

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLFTEEIE+ L  G ID AVHS KDMPT L +GL +S +L RED RD FI  +A+   DL
Sbjct: 67  GLFTEEIEQALKDGRIDIAVHSTKDMPTVLPEGLHLSVFLEREDPRDAFIGRSARRFMDL 126

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              + +G+SSLRR+AL+ R R DI V+ +RG ++TRL KL+  +     LA AG++RL  
Sbjct: 127 PQGATVGSSSLRRQALIRRLRPDIEVVMYRGNVDTRLRKLDAGEVDGTFLACAGLRRLGL 186

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
             VI ++L+   FPP+PGQGAI IE+ + + +   L+  + H +T  ++ CERAFL  LD
Sbjct: 187 ADVITDLLDPSVFPPAPGQGAIGIESRIGDERIDVLLAPLAHRETQIALACERAFLGALD 246

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           GSC++ IAG A  +G  L F G++L  DG+  HEV+  G   DA  +G DAA  +R ++ 
Sbjct: 247 GSCRTPIAGLATVEGDRLSFQGMILTPDGRQAHEVTAEGVVSDAAALGTDAANRVRAMAG 306

Query: 302 KNVFN 306
            + F+
Sbjct: 307 PHFFD 311


>gi|153008310|ref|YP_001369525.1| porphobilinogen deaminase [Ochrobactrum anthropi ATCC 49188]
 gi|166217778|sp|A6WXJ2|HEM3_OCHA4 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|151560198|gb|ABS13696.1| porphobilinogen deaminase [Ochrobactrum anthropi ATCC 49188]
          Length = 314

 Score =  276 bits (705), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 150/305 (49%), Positives = 197/305 (64%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           +    +IGTR S LALA A+ETR  LM+ H +P   I IIP+ST GDRI +R L+EIGGK
Sbjct: 7   KNGTLKIGTRGSKLALAQAYETRRRLMEAHGLPEEAIEIIPMSTAGDRIQDRALSEIGGK 66

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLFTEEIE+ L  G ID AVHS KDMPT L  GL +S +L RED RD FI  TA  L DL
Sbjct: 67  GLFTEEIEQALTDGRIDLAVHSTKDMPTVLPDGLHLSVFLEREDPRDAFIGRTASRLLDL 126

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              + +G+SSLRR+AL+ R R DI V+ FRG ++TRL KL   +     LA AG++RL  
Sbjct: 127 PQGATVGSSSLRRQALIRRLRPDIQVVIFRGNVDTRLRKLEAGEVDGTFLACAGLRRLGL 186

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
             VI ++ + E FPP+PGQGAI IET + + +   L+  + H +T  ++ CERAFLA LD
Sbjct: 187 GDVITDLADPESFPPAPGQGAIGIETRIGDTRIDTLLAPLAHRETGIALACERAFLAALD 246

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           GSC++ IAG A   G T+ F+G++L  DG   HE+   G   +A  IG +AA+++R  + 
Sbjct: 247 GSCRTPIAGLATVNGDTVSFHGMILKPDGSEAHEIKTEGPASNAAAIGTEAAEHLRAKAG 306

Query: 302 KNVFN 306
              F 
Sbjct: 307 PQFFE 311


>gi|262373963|ref|ZP_06067240.1| porphobilinogen deaminase [Acinetobacter junii SH205]
 gi|262310974|gb|EEY92061.1| porphobilinogen deaminase [Acinetobacter junii SH205]
          Length = 305

 Score =  276 bits (705), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 111/303 (36%), Positives = 168/303 (55%), Gaps = 2/303 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            K  +I TR SPLAL  A   R+ L +++  P   + ++   T+GD+I +  L +IGGKG
Sbjct: 1   MKTLKIATRQSPLALWQAEHIRARLNELY--PDLTVELVKFVTQGDKILDTPLAKIGGKG 58

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+      +L 
Sbjct: 59  LFVKELEAALLDGRADLAVHSMKDVPMHLPEGLTLAVICEREDPLDAFVSNQYAHFDELP 118

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRRK  +L+ R D+ +ID RG + TRL+KL++    AI+LA AG+KRL   
Sbjct: 119 HGAKVGTSSLRRKCQILQQRPDLEIIDLRGNVGTRLSKLDDGLYDAIILASAGLKRLGLA 178

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I+  L      P+ GQGA+ +E   ++ +  EL+  + HE T   V  ERAF A L+G
Sbjct: 179 ERIRHCLAPTLSLPAVGQGALGLECRADDQELLELISPLQHEVTSICVRAERAFNAYLEG 238

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  IAG+A    + L+  G V + DGK   +   +G   +   +G   A+ +      
Sbjct: 239 GCQVPIAGYATITQNQLHIEGRVGSVDGKTLLKEQLSGALDEGERLGVVLAEKLLAQGAG 298

Query: 303 NVF 305
            + 
Sbjct: 299 ELL 301


>gi|331005642|ref|ZP_08329011.1| Porphobilinogen deaminase [gamma proteobacterium IMCC1989]
 gi|330420567|gb|EGG94864.1| Porphobilinogen deaminase [gamma proteobacterium IMCC1989]
          Length = 324

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 114/305 (37%), Positives = 167/305 (54%), Gaps = 4/305 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K    I TR SPLAL  A   ++ L  +H  P   + ++P++++GD I +  L ++GGKG
Sbjct: 13  KNTITIATRKSPLALWQAEYVKARLEALH--PEVTVELLPMTSRGDHILDVPLAKVGGKG 70

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L++GE D AVHS KD+P +  +GL +S    RED RD F+S    S  DL 
Sbjct: 71  LFVKELEHALLNGEADIAVHSMKDVPMEFPEGLGLSVICEREDPRDAFVSEKYASFADLP 130

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +V+GTSSLRR+  LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RLK  
Sbjct: 131 QGAVVGTSSLRRQCQLLEQRPDLQITFLRGNVNTRLRKLDEGEYDAIILAAAGLMRLKMA 190

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I E L  E   P+ GQGA+ IE   ++ + +  +  +N   T + V  ERA    L+G
Sbjct: 191 DRITEYLTPELCLPAGGQGAVGIECRDDDEQVKTWLAPLNDPITHECVAAERAMNRRLEG 250

Query: 243 SCKSAIAGFA--YCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            C+  IA +A     G  L+  G+V + DGKI  E    G    A ++G   A+ +    
Sbjct: 251 GCQVPIASYAIHSADGKQLWLRGLVGSPDGKIMLEDEVTGAPDQADDLGVKLAERLLDKG 310

Query: 301 NKNVF 305
            + + 
Sbjct: 311 AETIL 315


>gi|104784255|ref|YP_610753.1| porphobilinogen deaminase [Pseudomonas entomophila L48]
 gi|123380753|sp|Q1I316|HEM3_PSEE4 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|95113242|emb|CAK17970.1| porphobilinogen deaminase [Pseudomonas entomophila L48]
          Length = 313

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 166/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L +IGG
Sbjct: 1   MSTREIRIATRKSALALWQAEYVKARLEQAH--PGLQVSLVPMVSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  E D AVHS KD+P    +GL +     RED RD F+S+T +SL+ 
Sbjct: 59  KGLFVKELETALLDNEADIAVHSMKDVPMDFPEGLGLYCICEREDPRDAFVSNTFKSLEA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSVVGTSSLRRQAQLLARRPDLEIRFLRGNVNTRLAKLDAGEYDAIILAAAGLVRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++H DT D V  ERA    L
Sbjct: 179 FEDRITSTISVDDSLPAGGQGAVGIECRSADSEIHALLAPLHHIDTADRVVAERALNKRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  L+  G+V    G           R  A  +G   A+ +    
Sbjct: 239 NGGCQVPIACYAVLEGDQLWLRGLVGQPSGGTLLVADARAPRASAEALGVQVAEDLLSQG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AEAIL 303


>gi|183600277|ref|ZP_02961770.1| hypothetical protein PROSTU_03837 [Providencia stuartii ATCC 25827]
 gi|188020068|gb|EDU58108.1| hypothetical protein PROSTU_03837 [Providencia stuartii ATCC 25827]
          Length = 314

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 110/304 (36%), Positives = 163/304 (53%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
                RI TR SPLAL  A+  +  L   H  P   + ++P+ TKGD I +  L ++GGK
Sbjct: 3   STNIVRIATRKSPLALWQAYFVKEKLEQFH--PGLQVELVPMVTKGDIILDTPLAKVGGK 60

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L
Sbjct: 61  GLFVKELELALLEKRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNQYDSLDAL 120

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              SV+GTSSLRR+  L   R D+ + D RG + TRL+KL+N +  AI+LA AG+KRL  
Sbjct: 121 PAGSVVGTSSLRRQCQLRELRPDLVIRDLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGL 180

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E  I+  L  E   P+ GQGA+ IE  +++ + ++L++ +N ++T   V  ERA    L+
Sbjct: 181 EARIRTALAPEQSLPAVGQGAVGIECRLDDERTRQLLEKLNDDNTSVCVLAERAMNMRLE 240

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I  +A  +   ++   +V A DG       R      A   G   A+ +     
Sbjct: 241 GGCQVPIGSYAIWQDGQIWLRALVGAPDGSQVIRGERLTTPEQATQAGISLAEELLDKGA 300

Query: 302 KNVF 305
           + + 
Sbjct: 301 REIL 304


>gi|118581775|ref|YP_903025.1| porphobilinogen deaminase [Pelobacter propionicus DSM 2379]
 gi|158512569|sp|A1AUE7|HEM3_PELPD RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|118504485|gb|ABL00968.1| porphobilinogen deaminase [Pelobacter propionicus DSM 2379]
          Length = 310

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 112/306 (36%), Positives = 167/306 (54%), Gaps = 3/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RIGTR S LAL  A   +S L   +  P   + +  + T GDRI +  L ++GG
Sbjct: 1   MPPRQLRIGTRASQLALWQANWVKSELEKRY--PAMEVTLTKIKTMGDRILDVPLAQVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE+ ++ GEID AVHS KD+PT+  +GL +     RED RD  +S  A+    
Sbjct: 59  KGLFVKEIEEAMLRGEIDIAVHSMKDVPTEFPEGLGLYCITEREDPRDAVVSRAARFSH- 117

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +GTS+LRR+A LL  R D+ ++  RG +ETR+ KL+     A++LA AG+KRL 
Sbjct: 118 LPPGARVGTSALRRQAQLLHARPDLEMVTIRGNVETRIRKLDEENLDAVILAAAGLKRLG 177

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + + E L++E   P+ GQGA+ IE  +++P   E +   NH DT  +V  ERA L   
Sbjct: 178 LTQRVAEYLDVEFSIPAIGQGALGIECRLSDPVVTEAIAFFNHPDTSHAVRAERALLRRC 237

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  IA     +G  L   G++ A DG+ F     +G      ++G + A  +    
Sbjct: 238 QGGCQVPIAAHGTIRGGELRLVGLIAAVDGREFVRDEISGPVDQCEHLGEELADRLLSRG 297

Query: 301 NKNVFN 306
            + +  
Sbjct: 298 GRAILE 303


>gi|290477117|ref|YP_003470030.1| hydroxymethylbilane synthase (porphobilinogen deaminase)
           [Xenorhabdus bovienii SS-2004]
 gi|289176463|emb|CBJ83272.1| hydroxymethylbilane synthase (porphobilinogen deaminase)
           [Xenorhabdus bovienii SS-2004]
          Length = 311

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 112/303 (36%), Positives = 165/303 (54%), Gaps = 2/303 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            K  RI TR SPLA+  A   +  L   H  P   + +IP+ T+GD I +  L ++GGKG
Sbjct: 1   MKIIRIATRQSPLAMWQAQYVQKQLEQFH--PELKVELIPMVTRGDVILDTPLAKVGGKG 58

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+    D AVHS KD+P +   GL +     R D RD F+S    SL +L 
Sbjct: 59  LFVKELELALLENRADIAVHSMKDVPVEFPDGLGLVTICERGDPRDAFVSVKYTSLDELP 118

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
           + S++GTSSLRR+  L + R D+ V D RG + TRL KL+N    AI+LA AG+KRL  E
Sbjct: 119 IGSIVGTSSLRRQCQLRQLRPDLVVRDLRGNVGTRLGKLDNGDYDAIILAAAGLKRLGLE 178

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH  T   V  ERA    L+G
Sbjct: 179 DRIRMPLEPELLLPAVGQGAVGIECRLDDKQTRELLAPLNHTGTEICVLAERAMNTHLEG 238

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  I  +A  +G+ ++   +V A DG I     +  +  +A   G + A+ +     +
Sbjct: 239 GCQVPIGSYAIWQGNNIWLRALVGAPDGSITVRGEKTVSPEEARRAGVELAEELLEKGAR 298

Query: 303 NVF 305
            + 
Sbjct: 299 QIL 301


>gi|254502424|ref|ZP_05114575.1| porphobilinogen deaminase [Labrenzia alexandrii DFL-11]
 gi|222438495|gb|EEE45174.1| porphobilinogen deaminase [Labrenzia alexandrii DFL-11]
          Length = 308

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 142/305 (46%), Positives = 199/305 (65%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+  P RIGTR S LALA A ETR+ LM  H +P     I+ + T GD+I +R L+E+GG
Sbjct: 1   MQSNPLRIGTRGSALALAQAHETRARLMAAHDLPEDAFEIVVIKTSGDQIQDRPLSEVGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ ++ G ID AVHS+KDMPT L  GL ++A+LPRED+RD F+S  A++L D
Sbjct: 61  KGLFTKEIEEAMLDGRIDLAVHSSKDMPTVLPDGLALTAFLPREDVRDAFLSPKAKTLMD 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+G+SSLRR+A++ R R DI V+ +RG ++TRL KL   +  A LLAYAG++RL 
Sbjct: 121 LPHGAVVGSSSLRRQAMIKRLRPDIEVVMYRGNLQTRLRKLAEGEVDATLLAYAGLRRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ +  +L  EDF P+ GQGAICIE+   + +  E+++ I+  +T   ++ ERAFLA L
Sbjct: 181 LEEEVTSLLETEDFLPAVGQGAICIESREGDERTLEMLQAIHDRETQIRLDAERAFLAVL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ I G A   G  L   G VL  DG   H+  R+G   DA+ IG+ A + ++   
Sbjct: 241 DGSCRTPIGGLALLNGDELTLKGTVLKPDGSEVHDEVRSGGAVDAVQIGQAAGEALKAKM 300

Query: 301 NKNVF 305
                
Sbjct: 301 GPGFL 305


>gi|239502040|ref|ZP_04661350.1| porphobilinogen deaminase [Acinetobacter baumannii AB900]
          Length = 309

 Score =  275 bits (704), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 109/303 (35%), Positives = 170/303 (56%), Gaps = 2/303 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            K  +I TR SPLAL  A   R+ L ++H  P   + ++   T+GD+I +  L +IGGKG
Sbjct: 5   MKTLKIATRQSPLALWQAEHIRARLQELH--PDLTVELVKFVTQGDKILDTPLAKIGGKG 62

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+  +   DL 
Sbjct: 63  LFVKELEAALLDGRADLAVHSMKDVPMALPEGLTLAVICEREDPLDAFVSNQFEKFADLP 122

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRRK+ +L+ R D+ +ID RG + TRL KL++ +  AI+LA AG+KRL   
Sbjct: 123 QGAKVGTSSLRRKSQILKQRPDLQIIDLRGNVGTRLAKLDDGQYDAIILASAGLKRLGLA 182

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I+  +      P+ GQGA+ +E   ++ +   L++ + H +T   V  ERAF A L+G
Sbjct: 183 ERIRHCIEPSVSLPAVGQGALGLECRADDQEVLALIQPLLHPETDVCVRAERAFNAYLEG 242

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  IAG+A  +   +Y  G V + DG+            +A  +G + A+ +      
Sbjct: 243 GCQVPIAGYATLQDGKIYIEGRVGSVDGQTLLRAELTDEANNAQQLGENLARNLLDQGAG 302

Query: 303 NVF 305
           ++ 
Sbjct: 303 DLL 305


>gi|219871198|ref|YP_002475573.1| porphobilinogen deaminase [Haemophilus parasuis SH0165]
 gi|219691402|gb|ACL32625.1| porphobilinogen deaminase [Haemophilus parasuis SH0165]
          Length = 309

 Score =  275 bits (704), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 108/304 (35%), Positives = 166/304 (54%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            K+  RI TR SPLAL  A   + +L    + P  ++ ++ + TKGD I +  L +IGGK
Sbjct: 1   MKEILRIATRQSPLALWQANFVKDALEQ--RFPQLSVELVTMVTKGDIILDTPLAKIGGK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  L+    D AVHS KD+P    +GL ++    RED RD F+S+   +L+ L
Sbjct: 59  GLFVKELELALLENRADIAVHSMKDVPMTFPEGLGLAVICEREDPRDAFVSNHYANLEAL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GTSSLRR+  L+     + +   RG + TRL+KL+N +  AI+LA AG+ RL  
Sbjct: 119 PAGAVVGTSSLRRQCQLMAKYPHLQIKSLRGNVGTRLSKLDNGEYDAIILASAGLIRLGL 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
            + I+  + +E   P+ GQGA+ IET +N+ +    +  +NH+ T   V  ERA  + L 
Sbjct: 179 SERIRTFIPVETSLPACGQGAVGIETRLNDERVLAYLAELNHQPTAYCVQAERAMNSRLQ 238

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I GFA   G  +    +V + DG      S  GN  +A  +G + A+ +     
Sbjct: 239 GGCQVPIGGFATLTGDEIELNALVGSLDGSTIVRASAKGNIKEAEKLGVEVAEALLAKGA 298

Query: 302 KNVF 305
            ++ 
Sbjct: 299 DHIL 302


>gi|239995985|ref|ZP_04716509.1| porphobilinogen deaminase [Alteromonas macleodii ATCC 27126]
          Length = 312

 Score =  275 bits (704), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 109/304 (35%), Positives = 168/304 (55%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
             +  RI TR S LAL  A   ++ L++ +  P   + ++P+ST+GD+I +  L +IGGK
Sbjct: 6   TTRTVRIATRKSALALWQAEYVKAKLLEHY--PSMTVELVPMSTQGDKILDTPLAKIGGK 63

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  ++ G  D AVHS KD+P +  +G  + A   RE+  D F+S+   SL  L
Sbjct: 64  GLFIKELEIAMLEGRADIAVHSMKDVPVEFPEGFGLHAICERENPFDAFVSNNHDSLDAL 123

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GTSSLRR+  + ++R D+ + D RG + TRL KL+  +  AI+LA AG+ RL+ 
Sbjct: 124 PQGAVVGTSSLRRQCQIRKYRPDLIIKDLRGNVNTRLAKLDAGEYDAIILASAGLIRLEM 183

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E  I+  L  +   P+ GQGA+ IE   ++ +  +L++ +NH DT   V  ERA    L+
Sbjct: 184 ESRIRMPLPADISLPAVGQGAVGIECRNDDEELIKLLQALNHTDTNTRVTAERAMNERLE 243

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I  FA   G  L   G+V   DG      S   +R  A +IG + A+ +     
Sbjct: 244 GGCQVPIGSFATLDGDVLTLTGMVGKPDGSELLFASATASREKAADIGVEVAESLLEQGA 303

Query: 302 KNVF 305
             + 
Sbjct: 304 GEIL 307


>gi|90406695|ref|ZP_01214888.1| porphobilinogen deaminase [Psychromonas sp. CNPT3]
 gi|90312148|gb|EAS40240.1| porphobilinogen deaminase [Psychromonas sp. CNPT3]
          Length = 311

 Score =  275 bits (704), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 163/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLA+  A   +S L+  H  P   + ++ + TKGD+I +  L ++GG
Sbjct: 1   MSNKIIRIATRHSPLAMWQANFVKSELLKWH--PELQVELLAMKTKGDKILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P    +GL ++    RED RD F+S+   ++  
Sbjct: 59  KGLFVKELEVAILEGRADIAVHSMKDVPVDFPEGLGLAVICEREDPRDAFVSNHFANIAA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R DI V D RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPQGSVVGTSSLRRQCQLRAQRPDIKVKDLRGNVNTRLAKLDAGEYDAIILASAGLIRLD 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I   +++E+  P+ GQGA+ IE  +++ +   L+K + H  T   V  ERA    L
Sbjct: 179 MHDRIASYMSVEESLPAVGQGAVGIECRLDDMQTLALLKPLEHRITRLRVTAERAMNLAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +   K  TL+  G+V + DG         G   DA  +G + AQ +    
Sbjct: 239 QGGCQVPIGSYCILKEDTLWLRGLVGSVDGTHIIRKEIRGKVADAEQMGLNLAQQLLESG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 ADKIL 303


>gi|169797472|ref|YP_001715265.1| porphobilinogen deaminase [Acinetobacter baumannii AYE]
 gi|213155714|ref|YP_002317759.1| porphobilinogen deaminase [Acinetobacter baumannii AB0057]
 gi|169150399|emb|CAM88296.1| porphobilinogen deaminase (PBG) (Hydroxymethylbilane synthase)
           (HMBS) (Pre-uroporphyrinogen synthase) [Acinetobacter
           baumannii AYE]
 gi|213054874|gb|ACJ39776.1| porphobilinogen deaminase [Acinetobacter baumannii AB0057]
          Length = 314

 Score =  275 bits (704), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 108/303 (35%), Positives = 169/303 (55%), Gaps = 2/303 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            K  +I TR SPLAL  A   R+ L + H  P   + ++   T+GD+I +  L +IGGKG
Sbjct: 10  MKTLKIATRQSPLALWQAEHIRARLQERH--PDLTVELVKFVTQGDKILDTPLAKIGGKG 67

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+  +   DL 
Sbjct: 68  LFVKELEAALLDGRADLAVHSMKDVPMALPEGLTLAVICEREDPLDAFVSNQFEKFADLP 127

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRRK+ +L+ R D+ +ID RG + TRL KL++ +  AI+LA AG+KRL   
Sbjct: 128 QGAKVGTSSLRRKSQILKQRPDLQIIDLRGNVGTRLAKLDDGQYDAIILASAGLKRLGLA 187

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I+  +      P+ GQGA+ +E   ++ +   L++ + H +T   V  ERAF A L+G
Sbjct: 188 ERIRHCIEPSVSLPAVGQGALGLECRADDQEVLALIQPLLHPETDVCVRAERAFNAYLEG 247

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  IAG+A  +   ++  G V + DG+            +A  +G + A+ +      
Sbjct: 248 GCQVPIAGYATLQDGKIHIEGRVGSVDGQTLLRAELTDEANNAQQLGENLARNLLDQGAG 307

Query: 303 NVF 305
           ++ 
Sbjct: 308 DLL 310


>gi|167855158|ref|ZP_02477929.1| porphobilinogen deaminase [Haemophilus parasuis 29755]
 gi|167853703|gb|EDS24946.1| porphobilinogen deaminase [Haemophilus parasuis 29755]
          Length = 309

 Score =  275 bits (704), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 108/304 (35%), Positives = 166/304 (54%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            K+  RI TR SPLAL  A   + +L    + P  ++ ++ + TKGD I +  L +IGGK
Sbjct: 1   MKEILRIATRQSPLALWQANFVKDALEQ--RFPQLSVELVTMVTKGDIILDTPLAKIGGK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  L+    D AVHS KD+P    +GL ++    RED RD F+S+   +L+ L
Sbjct: 59  GLFVKELELALLKNRADIAVHSMKDVPMTFPEGLGLAVICEREDPRDAFVSNHYANLEAL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GTSSLRR+  L+     + +   RG + TRL+KL+N +  AI+LA AG+ RL  
Sbjct: 119 PAGAVVGTSSLRRQCQLMAKYPHLQIKSLRGNVGTRLSKLDNGEYDAIILASAGLIRLGL 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
            + I+  + +E   P+ GQGA+ IET +N+ +    +  +NH+ T   V  ERA  + L 
Sbjct: 179 SERIRTFIPVETSLPACGQGAVGIETRLNDERVLAYLAELNHQPTAYCVQAERAMNSRLQ 238

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I GFA   G  +    +V + DG      S  GN  +A  +G + A+ +     
Sbjct: 239 GGCQVPIGGFATLTGDEIELNALVGSLDGSTIVRASAKGNIKEAEKLGVEVAEALLAKGA 298

Query: 302 KNVF 305
            ++ 
Sbjct: 299 DHIL 302


>gi|261345249|ref|ZP_05972893.1| hydroxymethylbilane synthase [Providencia rustigianii DSM 4541]
 gi|282566947|gb|EFB72482.1| hydroxymethylbilane synthase [Providencia rustigianii DSM 4541]
          Length = 314

 Score =  275 bits (704), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 109/304 (35%), Positives = 170/304 (55%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
                RI TR SPLAL  A+  ++ L  +H  P   + ++P+ TKGD I +  L ++GGK
Sbjct: 3   STNIVRIATRKSPLALWQAYFVKAKLEQLH--PNLQVELVPMVTKGDIILDTPLAKVGGK 60

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  L+ G  D AVHS KD+P +  +GL +     RED RD F+S+   ++ +L
Sbjct: 61  GLFVKELELALLEGRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNHYANIDEL 120

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              S++GTSSLRR+  L   R D+ + D RG + TRL+KL+N +  AI+LA AG+KRL+ 
Sbjct: 121 PAGSIVGTSSLRRQCQLKELRPDLVIRDLRGNVGTRLSKLDNGEYDAIILAVAGLKRLEL 180

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           ++ IK  L  E   P+ GQGA+ IE  +++ + ++L+  +NH++T   V  ERA    L+
Sbjct: 181 DERIKTALEPELSLPAVGQGAVGIECRLDDQRTRDLLAKLNHDETSICVLAERAMNMRLE 240

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I  +A  + + ++   +V A DG       R      A   G   A+ +     
Sbjct: 241 GGCQVPIGSYAIWQDNKIWLRALVGAPDGSTVIRGERLVEPEHATQAGIALAEELLDKGA 300

Query: 302 KNVF 305
           + + 
Sbjct: 301 REIL 304


>gi|215484908|ref|YP_002327147.1| porphobilinogen deaminase [Acinetobacter baumannii AB307-0294]
 gi|301346814|ref|ZP_07227555.1| porphobilinogen deaminase [Acinetobacter baumannii AB056]
 gi|301512648|ref|ZP_07237885.1| porphobilinogen deaminase [Acinetobacter baumannii AB058]
 gi|301595532|ref|ZP_07240540.1| porphobilinogen deaminase [Acinetobacter baumannii AB059]
 gi|332851472|ref|ZP_08433469.1| hydroxymethylbilane synthase [Acinetobacter baumannii 6013150]
 gi|332866846|ref|ZP_08437233.1| hydroxymethylbilane synthase [Acinetobacter baumannii 6013113]
 gi|213987600|gb|ACJ57899.1| porphobilinogen deaminase [Acinetobacter baumannii AB307-0294]
 gi|332729925|gb|EGJ61256.1| hydroxymethylbilane synthase [Acinetobacter baumannii 6013150]
 gi|332734374|gb|EGJ65495.1| hydroxymethylbilane synthase [Acinetobacter baumannii 6013113]
          Length = 309

 Score =  275 bits (704), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 108/303 (35%), Positives = 169/303 (55%), Gaps = 2/303 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            K  +I TR SPLAL  A   R+ L + H  P   + ++   T+GD+I +  L +IGGKG
Sbjct: 5   MKTLKIATRQSPLALWQAEHIRARLQERH--PDLTVELVKFVTQGDKILDTPLAKIGGKG 62

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+  +   DL 
Sbjct: 63  LFVKELEAALLDGRADLAVHSMKDVPMALPEGLTLAVICEREDPLDAFVSNQFEKFADLP 122

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRRK+ +L+ R D+ +ID RG + TRL KL++ +  AI+LA AG+KRL   
Sbjct: 123 QGAKVGTSSLRRKSQILKQRPDLQIIDLRGNVGTRLAKLDDGQYDAIILASAGLKRLGLA 182

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I+  +      P+ GQGA+ +E   ++ +   L++ + H +T   V  ERAF A L+G
Sbjct: 183 ERIRHCIEPSVSLPAVGQGALGLECRADDQEVLALIQPLLHPETDVCVRAERAFNAYLEG 242

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  IAG+A  +   ++  G V + DG+            +A  +G + A+ +      
Sbjct: 243 GCQVPIAGYATLQDGKIHIEGRVGSVDGQTLLRAELTDEANNAQQLGENLARNLLDQGAG 302

Query: 303 NVF 305
           ++ 
Sbjct: 303 DLL 305


>gi|307250258|ref|ZP_07532212.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|306857699|gb|EFM89801.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
          Length = 314

 Score =  275 bits (704), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 109/304 (35%), Positives = 164/304 (53%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            K   RI TR SPLAL  A   +  L    + P  ++ ++ + TKGD I + +L +IGGK
Sbjct: 6   MKDTLRIATRQSPLALWQANFVKDELEK--RFPELSVELVTMVTKGDVILDTSLAKIGGK 63

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  L+    D AVHS KD+P    +GL ++    RED RD F+S+  Q+L +L
Sbjct: 64  GLFVKELELALLENRADIAVHSMKDVPMTFPEGLGLAVICEREDPRDAFVSNKYQNLDEL 123

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GTSSLRR+  L+     + V   RG + TRL+KL+N +  AI+LA AG+ RL  
Sbjct: 124 PAGAVVGTSSLRRQCQLMAKYPHLEVKSLRGNVGTRLSKLDNGEYDAIILASAGLIRLGM 183

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
            + I+  +++E   P+ GQGA+ IET V++ +    +  +NH  T   V  ERA    L 
Sbjct: 184 PERIRSFISVEQSLPAAGQGAVGIETRVDDERVLNYLATLNHNPTACCVIAERAMNTRLQ 243

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I GF+   G+ +    +V A DG      S   +R +A  +G   A+ +     
Sbjct: 244 GGCQVPIGGFSTLNGNEITLNALVGALDGSNIIRASGVADRENAEQLGISVAEQLLAQGA 303

Query: 302 KNVF 305
             + 
Sbjct: 304 DKIL 307


>gi|150398163|ref|YP_001328630.1| porphobilinogen deaminase [Sinorhizobium medicae WSM419]
 gi|150029678|gb|ABR61795.1| porphobilinogen deaminase [Sinorhizobium medicae WSM419]
          Length = 330

 Score =  275 bits (703), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 152/305 (49%), Positives = 208/305 (68%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KPFRIGTR SPLALA   ETR  L   H +P     I+ LSTKGDRIT+R+L EIGG
Sbjct: 22  MQTKPFRIGTRGSPLALAQTHETRDRLAAAHGLPVEMFEIVTLSTKGDRITDRSLAEIGG 81

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFTEE+E++L+SG++D AVHS+KDM TKL  GL +SA+LPRED+RD F+  +A  L +
Sbjct: 82  KGLFTEELEQQLLSGDLDFAVHSSKDMTTKLPDGLFLSAFLPREDVRDAFVGRSATRLAE 141

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +G+SSLRR+AL+ R R D++VI +RG++ETRL KL   +    LLAYAG++RL 
Sbjct: 142 LPQGATVGSSSLRRQALIRRLRPDVNVITYRGQVETRLRKLAEGQVDGTLLAYAGLRRLG 201

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
              V  E+L+ E FPP+P QGAICIE  + + +   L+  ++   T ++V+CER FLA L
Sbjct: 202 MAHVPTELLDPESFPPAPAQGAICIEARLGDDRINALLSAVDDPRTHEAVSCERGFLATL 261

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG+A   G+ + F G++L  DG   H +  +G   DA  +GR+A + IR  +
Sbjct: 262 DGSCRTPIAGYAQSDGARIRFSGMILTPDGTTCHRIETDGRTADAAALGREAGERIRAKA 321

Query: 301 NKNVF 305
               F
Sbjct: 322 GPEFF 326


>gi|114321817|ref|YP_743500.1| hydroxymethylbilane synthase [Alkalilimnicola ehrlichii MLHE-1]
 gi|122310751|sp|Q0A577|HEM3_ALHEH RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|114228211|gb|ABI58010.1| hydroxymethylbilane synthase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 308

 Score =  275 bits (703), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 106/305 (34%), Positives = 160/305 (52%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLA+  A    + L   H  P   + ++P+ T+GDRI ++ L+ IGG
Sbjct: 1   MPQDKLRIATRRSPLAMWQAEHVAAELRRHH--PGLEVELVPMVTRGDRILDQALSRIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ +  G  D AVHS KD+P ++  G  +   L R +  D F+S+  + L D
Sbjct: 59  KGLFIKELEQGMEEGRADLAVHSMKDVPWRMPDGFALPVILERHEPTDAFVSNHYRRLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L     +GT+SLRR+      R D+ V   RG + TRL KL+  +  AI+LA +G+ RL 
Sbjct: 119 LPEGGHLGTASLRRQCQAKARRPDLRVSTLRGNVNTRLAKLDAGEFDAIILAASGLSRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            ++ I   L  E+  P+ GQGA+ IE    + + QELV  ++H  T   +  ERA  A L
Sbjct: 179 FDERIARRLPPEESLPAVGQGALGIECLAEDRRVQELVAPLDHGPTHTLLKAERAMNARL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC+  IAG+A  +G  ++  G+V + DG+        G    A  +G      +    
Sbjct: 239 QGSCQVPIAGYACYQGEEIWLRGLVGSPDGQEIVRGEVRGPIAQAAELGDRLGGELLERG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 AARIL 303


>gi|225850000|ref|YP_002730234.1| porphobilinogen deaminase [Persephonella marina EX-H1]
 gi|225645034|gb|ACO03220.1| porphobilinogen deaminase [Persephonella marina EX-H1]
          Length = 308

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 115/301 (38%), Positives = 169/301 (56%), Gaps = 2/301 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LAL  A      L      P   + ++ + TKGD+I +  L ++GGKGLF 
Sbjct: 3   IRIGTRKSKLALWQANYIADQLKK--HFPDLEVELVKIVTKGDKILDVPLAKVGGKGLFV 60

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ ++  EID AVHS KD+PT   +GL + A   RED RD F+S    S++D+   +
Sbjct: 61  KEIEEAMLRNEIDIAVHSLKDVPTYFPEGLGLVAITEREDPRDAFLSVKYNSIEDMPEGA 120

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+GTSSLRRKA ++  R DI + D RG ++TR+ KL   +   I+LAYAG+KRL  E  +
Sbjct: 121 VLGTSSLRRKAQIMMKRKDIRIEDLRGNVDTRIRKLEEGQYDGIILAYAGLKRLGLEGKV 180

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           ++IL  +   P+  QG + IE  +++ K +E+V V+NH ++      ERAFL  L+G C+
Sbjct: 181 RQILQPDYMIPAVAQGFLGIEARLDDEKTREIVSVLNHRESEIRAKAERAFLKTLEGGCQ 240

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             +AG++      L   G V    G      S  G+  DA ++G   A+ +     K V 
Sbjct: 241 VPLAGYSEIVNGKLKITGFVSDLTGDRVFRDSMEGSLEDAESLGVKLAEKLLSDGAKEVL 300

Query: 306 N 306
            
Sbjct: 301 E 301


>gi|237801592|ref|ZP_04590053.1| porphobilinogen deaminase [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331024452|gb|EGI04508.1| porphobilinogen deaminase [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 313

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 110/305 (36%), Positives = 166/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   +S L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSTREIRIATRQSALALWQAEYVKSRLEQAH--PGLLVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     RED RD F+S+T  SL+ 
Sbjct: 59  KGLFVKELETALLEDRADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTFDSLQA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSVVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   +++ED  P+ GQGA+ IE    + +   L+  ++HEDT   V  ER+    L
Sbjct: 179 FEDRITSAISVEDSLPAGGQGAVGIECRSVDAEIHALLAPLHHEDTAVRVIAERSLNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  ++  G+V    G +         +  A  +G + A+ +    
Sbjct: 239 NGGCQVPIACYAILEGDDVWLRGLVGDPSGSVLLHAEARAPQTSAQALGVEVAEALLAQG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 AAKIL 303


>gi|226946767|ref|YP_002801840.1| porphobilinogen deaminase [Azotobacter vinelandii DJ]
 gi|226721694|gb|ACO80865.1| porphobilinogen deaminase [Azotobacter vinelandii DJ]
          Length = 314

 Score =  275 bits (702), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 108/302 (35%), Positives = 163/302 (53%), Gaps = 2/302 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L +IGGKGL
Sbjct: 5   REIRIATRKSALALWQAEYVKARLEQAH--PGLAVSLVPMVSRGDKLLDAPLAKIGGKGL 62

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL +L  
Sbjct: 63  FVKELETALLENAADIAVHSMKDVPMEFPEGLGLYCICEREDPRDAFVSNAFASLDELPA 122

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            S+IGTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL  E 
Sbjct: 123 GSLIGTSSLRRQAQLLARRPDLKIQFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLGFEG 182

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  + I D  P+ GQGA+ IE    + + Q L+  ++H  T   V  ERA    L+G 
Sbjct: 183 RIRSRIAIADSLPAGGQGAVGIECRSADREIQALLAPLDHAPTALRVGAERALNKRLNGG 242

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKN 303
           C+  IA +A  +   L+  G+V   DG++           +A  +G   A+ +     + 
Sbjct: 243 CQVPIACYAELEDGQLWLRGLVGQPDGRLLLRAEARAPADEAEALGVRVAEALLAQGAQR 302

Query: 304 VF 305
           + 
Sbjct: 303 IL 304


>gi|304414148|ref|ZP_07395516.1| porphobilinogen deaminase [Candidatus Regiella insecticola LSR1]
 gi|304283362|gb|EFL91758.1| porphobilinogen deaminase [Candidatus Regiella insecticola LSR1]
          Length = 312

 Score =  275 bits (702), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 110/305 (36%), Positives = 159/305 (52%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +K  RI TR SPLAL  A   R SL   H  P   + ++P++T+GD + +  L +IGG
Sbjct: 1   MSEKVIRIATRQSPLALWQADYVRKSLESHH--PDLQVKLVPITTRGDTLLHTPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L+    D AVHS KD+P     GL +     R D  D F+S   + LK 
Sbjct: 59  KGLFVKELEQALLENCADIAVHSIKDVPIHFPAGLGLVVICQRGDPHDAFVSKNYKHLKQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  + +    + V D RG + TRLNKL+     AI+LA AG++RL 
Sbjct: 119 LPPGSIVGTSSLRRQCQIRKKYPHLIVRDLRGNVGTRLNKLDQGAYQAIILAVAGLQRLD 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I+ +++ E+  P+ GQGAI IE  + +   ++L+  +NH  T   +  ERA    L
Sbjct: 179 LQSRIQHVMSPEESLPAAGQGAIGIECRLEDDVTRQLLAPLNHFPTERRICAERALNIRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +G  L     V   DG       R G    A  IG D A  +    
Sbjct: 239 EGGCQVPIGSYAELEGDNLRLRAFVSTPDGSQMIYGERCGLAIQAEKIGLDLATELIAEG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 ADKIL 303


>gi|66043333|ref|YP_233174.1| porphobilinogen deaminase [Pseudomonas syringae pv. syringae B728a]
 gi|289677629|ref|ZP_06498519.1| porphobilinogen deaminase [Pseudomonas syringae pv. syringae FF5]
 gi|302187597|ref|ZP_07264270.1| porphobilinogen deaminase [Pseudomonas syringae pv. syringae 642]
 gi|75504025|sp|Q500N6|HEM3_PSEU2 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|63254040|gb|AAY35136.1| Porphobilinogen deaminase [Pseudomonas syringae pv. syringae B728a]
 gi|330901069|gb|EGH32488.1| porphobilinogen deaminase [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330952274|gb|EGH52534.1| porphobilinogen deaminase [Pseudomonas syringae Cit 7]
 gi|330970393|gb|EGH70459.1| porphobilinogen deaminase [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 313

 Score =  275 bits (702), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 107/305 (35%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLLVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     RED RD F+S+T  SL  
Sbjct: 59  KGLFVKELETALLENNADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTFASLDQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++HEDT   V  ER+    L
Sbjct: 179 FEDRITSAISVDDSLPAGGQGAVGIECRSVDAEIHALLAPLHHEDTAVRVIAERSLNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  ++  G+V    G +         +  A  +G   A+ +    
Sbjct: 239 NGGCQVPIACYAVLEGDDVWLRGLVGDPSGSVLLHADARAPQTSAQALGVQVAEALLEQG 298

Query: 301 NKNVF 305
             ++ 
Sbjct: 299 AADIL 303


>gi|222054398|ref|YP_002536760.1| porphobilinogen deaminase [Geobacter sp. FRC-32]
 gi|254800252|sp|B9M416|HEM3_GEOSF RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|221563687|gb|ACM19659.1| porphobilinogen deaminase [Geobacter sp. FRC-32]
          Length = 318

 Score =  275 bits (702), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 114/305 (37%), Positives = 167/305 (54%), Gaps = 3/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RIGTR S LAL  A   +S L   +  P   + ++ + T GD+I +  L ++GG
Sbjct: 1   MALKQLRIGTRASQLALWQANWVKSELEQRY--PGMEVSLVKIKTIGDKILDVPLAQVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE+ ++ G+ID AVHS KD+PT+  +GL +     RED RD  IS   +   D
Sbjct: 59  KGLFVKEIEEAMLRGDIDIAVHSMKDVPTEFPEGLGLHCITEREDPRDAVISRGTKFA-D 117

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + IGTS+LRR+A LL+ R D+ ++  RG +ETR+NKL   K  A++LA AG+KRL 
Sbjct: 118 LPQGAKIGTSALRRQAQLLKVRPDMEMVIIRGNVETRINKLETEKLDAVILAAAGLKRLG 177

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + + E L  +   P+ GQGA+ IE  ++N + ++ +   NH  T  +V  ERA L   
Sbjct: 178 FTEKVAEYLPTDLSIPAIGQGALGIECRLDNEEVKQTIDFFNHPATAYAVRAERALLWRC 237

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA F    GS L   G + + DGK     +  G   D   +G   A+ +    
Sbjct: 238 EGGCQVPIAAFGEVTGSDLKLVGFIASVDGKTSVRGTITGPAADCEKLGIKLAEQLLADG 297

Query: 301 NKNVF 305
              + 
Sbjct: 298 GHAIL 302


>gi|52424331|ref|YP_087468.1| porphobilinogen deaminase [Mannheimia succiniciproducens MBEL55E]
 gi|61213369|sp|Q65VX7|HEM3_MANSM RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|52306383|gb|AAU36883.1| HemC protein [Mannheimia succiniciproducens MBEL55E]
          Length = 310

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 109/306 (35%), Positives = 163/306 (53%), Gaps = 3/306 (0%)

Query: 1   MEKKP-FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M  K   +I TR SPLAL  A   +  L  ++  P   + ++ + TKGD I +  L +IG
Sbjct: 1   MNNKNHLKIATRQSPLALWQANYVKDRLTALY--PDLQVELVTMVTKGDVILDTPLAKIG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  L++ E D AVHS KD+P +  +GL +S    RED RD F+S+  +SL 
Sbjct: 59  GKGLFVKELEHALLNHEADIAVHSMKDVPMEFPQGLGLSVICKREDPRDAFVSNKYRSLA 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           +L   +++GTSSLRR+  L   R D+ +   RG + TRL+KL+N    AI+LA AG+ RL
Sbjct: 119 ELPQGAIVGTSSLRRQCQLKSLRPDLDIRSLRGNVGTRLSKLDNGDYDAIILASAGLIRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
              + I   +  +   P+ GQGA+ IE  V++   Q L+  + H++T   V  ERA    
Sbjct: 179 GMAERIASFIETDISLPAAGQGAVGIECRVDDELVQSLLAPLAHQETTICVLAERAMNNR 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L G C+  I GFA  K   ++   +V A+DG             +A  +G   A+ +   
Sbjct: 239 LQGGCQVPIGGFAQVKNGEVFLRALVGATDGSQIIRAEGKSAVENAEVLGVQIAEDLLQQ 298

Query: 300 SNKNVF 305
               + 
Sbjct: 299 GADKIL 304


>gi|322514003|ref|ZP_08067077.1| hydroxymethylbilane synthase [Actinobacillus ureae ATCC 25976]
 gi|322120153|gb|EFX92114.1| hydroxymethylbilane synthase [Actinobacillus ureae ATCC 25976]
          Length = 309

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 111/304 (36%), Positives = 160/304 (52%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            K   RI TR SPLAL  A   +  L    + P   + ++ + TKGD I +  L +IGGK
Sbjct: 1   MKDILRIATRQSPLALWQANFVKKELEK--RFPELQVELVTMVTKGDIILDTPLAKIGGK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  L+    D AVHS KD+P    +GL ++    RED RD F+S+  Q+L +L
Sbjct: 59  GLFVKELELALLEKRADIAVHSMKDVPMTFPEGLGLAVICEREDPRDAFVSNKYQNLDEL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GTSSLRR+  L+     + V   RG + TRL+KL+N +  AI+LA AG+ RL  
Sbjct: 119 PAGAVVGTSSLRRQCQLMAKYPHLEVKSLRGNVGTRLSKLDNGEYEAIILASAGLIRLGM 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
            + I+  + +E   P+ GQGA+ IET VN+ +    +  +NH  T   V  ERA    L 
Sbjct: 179 PERIRSFIAVEQSLPAAGQGAVGIETRVNDERVLNYLASLNHNPTACCVMAERAMNTRLQ 238

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I GFA   G+ +    +V A DG      S   +  DA  +G   A+ +     
Sbjct: 239 GGCQVPIGGFATLNGNEITLNALVGALDGSTIIRASGVADIEDAEQLGISVAEQLLAQGA 298

Query: 302 KNVF 305
             + 
Sbjct: 299 DKIL 302


>gi|330976469|gb|EGH76521.1| porphobilinogen deaminase [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 313

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 107/305 (35%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLIVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     RED RD F+S+T  SL  
Sbjct: 59  KGLFVKELETALLENNADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTFASLDQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++HEDT   V  ER+    L
Sbjct: 179 FEDRITSAISVDDSLPAGGQGAVGIECRSVDAEIHALLAPLHHEDTAVRVIAERSLNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  ++  G+V    G +         +  A  +G   A+ +    
Sbjct: 239 NGGCQVPIACYAVLEGDDVWLRGLVGDPSGSVLLHADARAPQTSAQALGVQVAEALLEQG 298

Query: 301 NKNVF 305
             ++ 
Sbjct: 299 AADIL 303


>gi|262280694|ref|ZP_06058477.1| porphobilinogen deaminase [Acinetobacter calcoaceticus RUH2202]
 gi|262257594|gb|EEY76329.1| porphobilinogen deaminase [Acinetobacter calcoaceticus RUH2202]
          Length = 314

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 111/303 (36%), Positives = 171/303 (56%), Gaps = 2/303 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            K  +I TR SPLAL  A   R+ L ++H  P   + ++   T+GD+I +  L +IGGKG
Sbjct: 10  MKTLKIATRQSPLALWQAEYIRARLQELH--PDLTVELVKFVTQGDKILDTPLAKIGGKG 67

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+  +   DL 
Sbjct: 68  LFVKELEAALLDGRADLAVHSMKDVPMALPEGLTLAVICEREDPLDAFVSNQFEKFADLP 127

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRRK+ +L+ R D+ VID RG + TRL KL++ +  AI+LA AG+KRL   
Sbjct: 128 QGAKVGTSSLRRKSQILKQRPDLQVIDLRGNVGTRLAKLDDGQYDAIILASAGLKRLGLS 187

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I+  L  +   P+ GQGA+ +E    + +   L++ + HE+T   V  ERAF A L+G
Sbjct: 188 ERIRHCLTPDISLPAVGQGALGLECRAADNEVLSLIQPLLHEETDVCVRAERAFNAYLEG 247

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  IAG+A  +   ++  G V ++DG+            +A  +G + A+ +      
Sbjct: 248 GCQVPIAGYATLQNGQIHIEGRVGSADGQTLLRAELTDEASNAHQLGENLARNLLDQGAG 307

Query: 303 NVF 305
            + 
Sbjct: 308 ELL 310


>gi|212710180|ref|ZP_03318308.1| hypothetical protein PROVALCAL_01234 [Providencia alcalifaciens DSM
           30120]
 gi|212687179|gb|EEB46707.1| hypothetical protein PROVALCAL_01234 [Providencia alcalifaciens DSM
           30120]
          Length = 314

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 112/304 (36%), Positives = 169/304 (55%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
                RI TR SPLAL  A+  ++ L  +H      + ++P+ TKGD I +  L ++GGK
Sbjct: 3   STNIVRIATRKSPLALWQAYFVKAKLEQLHS--GLQVELVPMVTKGDIILDTPLAKVGGK 60

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  L+ G  D AVHS KD+P +  +GL +     RED RD F+S+   ++  L
Sbjct: 61  GLFVKELELALLEGRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNHYANIDAL 120

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              S++GTSSLRR+  L   R D+ + D RG + TRL+KL+N +  AI+LA AG+KRL+ 
Sbjct: 121 PAGSIVGTSSLRRQCQLRELRPDLVIRDLRGNVGTRLSKLDNGEYDAIILAVAGLKRLEL 180

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           ++ IK  L  E   P+ GQGA+ IE  +N+ + ++L+  +NH+ T   V  ERA    L+
Sbjct: 181 DERIKTALEPEQSLPAVGQGAVGIECRLNDQRTRDLLAKLNHDATSICVLAERAMNMRLE 240

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I  +A  +G  ++   +V A DG       R     DAI  G   A+ +     
Sbjct: 241 GGCQVPIGSYAIWQGDKIWLRALVGAPDGSQVIRGERLIAPVDAIQAGISLAEELLNKGA 300

Query: 302 KNVF 305
           + + 
Sbjct: 301 REIL 304


>gi|148559606|ref|YP_001259712.1| porphobilinogen deaminase [Brucella ovis ATCC 25840]
 gi|166201494|sp|A5VSL5|HEM3_BRUO2 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|148370863|gb|ABQ60842.1| porphobilinogen deaminase [Brucella ovis ATCC 25840]
          Length = 304

 Score =  274 bits (701), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 143/301 (47%), Positives = 197/301 (65%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            +IGTR S LALA A+ TR  L + H +P   I I+P+ST GDRI +R L+E+GGKGLFT
Sbjct: 1   MKIGTRGSKLALAQAYLTRRLLQEAHGLPEDAIEILPMSTAGDRIQDRPLSEVGGKGLFT 60

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           EEIE+ L  G ID AVHS KDMPT L +GL +S +L RED RD FI  +A+   DL   +
Sbjct: 61  EEIEQALKDGRIDIAVHSTKDMPTVLPEGLHLSVFLEREDPRDAFIGRSARRFMDLPQGA 120

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +G+SSLRR+AL+ R R DI V+ +RG ++TRL KL+  +     LA AG++RL    VI
Sbjct: 121 TVGSSSLRRQALIRRLRPDIEVVMYRGNVDTRLRKLDAGEVDGTFLACAGLRRLGLADVI 180

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            ++L+   FPP+PGQGAI IE+ + + +   L+  + H +T  ++ CERAFL  LDGSC+
Sbjct: 181 TDLLDPSVFPPAPGQGAIGIESRIGDERIDVLLAPLAHRETQIALACERAFLGALDGSCR 240

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
           + IAG A  +G  L F G++L  DG+  HEV+  G   DA  +G DAA  +R ++  + F
Sbjct: 241 TPIAGLATVEGDRLSFRGMILTPDGRQAHEVTAEGVVSDAAALGTDAANRVRAMAGPHFF 300

Query: 306 N 306
           +
Sbjct: 301 D 301


>gi|15889908|ref|NP_355589.1| porphobilinogen deaminase [Agrobacterium tumefaciens str. C58]
 gi|23821691|sp|Q8UC46|HEM3_AGRT5 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|15157859|gb|AAK88374.1| porphobilinogen deaminase [Agrobacterium tumefaciens str. C58]
          Length = 309

 Score =  274 bits (701), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 167/306 (54%), Positives = 225/306 (73%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KPFRIGTR SPLALA A+ETRS LM  H +P     I+ LSTKGDRIT+R L+EIGG
Sbjct: 1   MQTKPFRIGTRGSPLALAQAYETRSRLMAAHGLPEEMFEIVVLSTKGDRITDRALSEIGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFTEE+E +L+SGE+D AVHS+KDMPT L +GL +SA+LPRED+RD FI  TA  L +
Sbjct: 61  KGLFTEELENQLLSGELDIAVHSSKDMPTVLPEGLHLSAFLPREDMRDAFIGRTAPKLLE 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+G++SLRR+AL+ R R D++VI FRG ++TRL KL   +A A LLA+AG+KRL 
Sbjct: 121 LPQGAVVGSASLRRQALIRRLRPDLNVIVFRGLVDTRLRKLEEGQADATLLAFAGLKRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           K+ V  EIL+ ++FPP+P QGAI +E+ + + +  +L+  IN   T+D+V CERAFLA L
Sbjct: 181 KDNVPTEILDPKEFPPAPAQGAIGVESRIGDARMDKLLAPINDRPTYDAVTCERAFLAAL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG+A C+G  L+F G++L  DG+  H V  +GNR DA+ +G+ A + +R  +
Sbjct: 241 DGSCRTPIAGYATCEGDNLHFSGLILTPDGQTSHGVEISGNRRDALILGKKAGEEVRAKA 300

Query: 301 NKNVFN 306
             N F 
Sbjct: 301 GSNFFE 306


>gi|89093768|ref|ZP_01166714.1| porphobilinogen deaminase [Oceanospirillum sp. MED92]
 gi|89081898|gb|EAR61124.1| porphobilinogen deaminase [Oceanospirillum sp. MED92]
          Length = 313

 Score =  274 bits (701), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 109/308 (35%), Positives = 177/308 (57%), Gaps = 5/308 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR SPLAL  A   ++ L   H  P  N+ ++ +++KGD+I +  L ++GG
Sbjct: 1   MS-RTIRIATRKSPLALWQAEYVKAELERHH--PGINVELLGMTSKGDKILDAPLAKVGG 57

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ +++GE D AVHS KD+P +  +GL ++   PRE   D F+S+T  S+++
Sbjct: 58  KGLFVKELEEAMLAGEADIAVHSMKDVPMEFPEGLGLAVICPREQPTDAFVSNTYNSIEE 117

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+A +   R D+ +   RG + TRL KL++ +  AI+LA AG+ RL+
Sbjct: 118 LPEGAVVGTSSLRREAQIREKRPDLQIKWLRGNVNTRLRKLDDGEYDAIILASAGLIRLE 177

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I+  +++E   P+ GQGA+ IE   ++ +  EL+K ++ ++T   V+ ERA    L
Sbjct: 178 MPERIRSEISVEFSLPAGGQGAVGIECRTDDHELLELLKPLHDQETAWRVSAERAMNRRL 237

Query: 241 DGSCKSAIAGFAYCKGS--TLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRF 298
           +G C+  IA +A        LY  G+V   DG +       G    A  +G   A  +  
Sbjct: 238 EGGCQVPIACYATLNDDNSELYLRGLVAKPDGTLILRDEERGTPEQAEQLGITLADRLLA 297

Query: 299 ISNKNVFN 306
              K++ +
Sbjct: 298 AGAKSILD 305


>gi|121997816|ref|YP_001002603.1| porphobilinogen deaminase [Halorhodospira halophila SL1]
 gi|229836112|sp|A1WVT9|HEM3_HALHL RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|121589221|gb|ABM61801.1| hydroxymethylbilane synthase [Halorhodospira halophila SL1]
          Length = 310

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 109/305 (35%), Positives = 166/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LA+  A    + L  +H  P   + ++P+ST+GD I ++ L  IGG
Sbjct: 1   MAAESLRIATRRSQLAMWQAEHIAAELQRLH--PGLEVELVPMSTRGDEILDQPLARIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ GE D AVHS KD+P +L +G  ++A   R D RD F+S+    L +
Sbjct: 59  KGLFMKELEDGMLRGEADLAVHSMKDIPWRLPEGFDLAAVSDRADPRDAFVSNHYSDLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +GT+SLRR+  ++  R D+ +   RG ++TRL KL++    AI+LA +G+ RL+
Sbjct: 119 LPHGARVGTASLRRQCQIMDRRPDLQIEVLRGNVQTRLRKLDDGVYDAIILAASGLDRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I   L  E   P+ GQGA+ IE    + +  +LV+ +NHE T   +N ER   A L
Sbjct: 179 LTHRIAGRLTPEQSLPAVGQGALGIECREGDERVMKLVEGLNHEATRIRINAERGMNARL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +GSC+  I G+A   G  ++  G+V A DG         G   +A N+GR     +    
Sbjct: 239 EGSCQVPIGGYAELDGDEVHLRGLVGAIDGSEVIRGEIRGPAAEAENLGRQLGDDLLARG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 ADRIL 303


>gi|257465324|ref|ZP_05629695.1| porphobilinogen deaminase [Actinobacillus minor 202]
 gi|257450984|gb|EEV25027.1| porphobilinogen deaminase [Actinobacillus minor 202]
          Length = 308

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 109/304 (35%), Positives = 159/304 (52%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            K   RI TR SPLAL  A   ++ L      P   I ++ + TKGD I +  L +IGGK
Sbjct: 1   MKDILRIATRQSPLALWQANFVKAELEK--HFPELQIELVTMVTKGDIILDTPLAKIGGK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  L+    D AVHS KD+P    +GL ++    RED RD F+S+  QSL  L
Sbjct: 59  GLFVKELELALLENRADIAVHSMKDVPMTFPEGLGLAVICEREDPRDAFVSNQYQSLDKL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GTSSLRR+  L+     + +   RG + TRL+KL+N +  AI+LA AG+ RL  
Sbjct: 119 PKGAVVGTSSLRRQCQLMAAYPHLEIKSLRGNVGTRLSKLDNGEYDAIILASAGLIRLGM 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
            + I+  +++E   P+ GQGA+ IET +++ +    +  +NH+ T   V  ERA  A L 
Sbjct: 179 PERIRSFISVEQSLPAAGQGAVGIETRLDDQRVLSYLAKLNHQPTAYRVIAERAMNAHLQ 238

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I GFA  +   L    +V + DG      S       A  +G + A  +     
Sbjct: 239 GGCQVPIGGFATLENDELTLNALVGSLDGSTIIRASGVAPVDKAEQLGIEVATKLLAQGA 298

Query: 302 KNVF 305
             + 
Sbjct: 299 DKIL 302


>gi|12655813|gb|AAK00605.1|AF221100_2 porphobilinogen deaminase [Selenomonas ruminantium subsp.
           ruminantium]
          Length = 313

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 110/306 (35%), Positives = 170/306 (55%), Gaps = 3/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+K    IGTR S LAL  A   +  L + +  P   + +  ++TKGD+I +  L +IGG
Sbjct: 1   MKKDTIVIGTRSSKLALWQAEYVKGRLEEEY--PGLKVELKLMTTKGDKILDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+E+E  ++SG ID AVHS KDMPT+L +GL ++A   R D  D  +S   ++   
Sbjct: 59  KGLFTKELEMDMLSGGIDLAVHSLKDMPTELPEGLTLAAITKRFDPGDAVVSPKFKTFAA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +GTSSLRRKA LL  R D+++ D RG + TRL KL +    AI+LA AG+KRL 
Sbjct: 119 LPCGAKVGTSSLRRKAQLLHARPDLNICDLRGNVNTRLAKLESENFDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I E+L  +   P+ GQGA+ IET  ++   +E++  +N E T      ERAFL  +
Sbjct: 179 FGERITEVLPRDMVLPAVGQGALAIETREDDADMREMLAFLNDEATVHCAKAERAFLGRV 238

Query: 241 DGSCKSAIAGFAY-CKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           +G C+  +  +A       +    ++ + DG+  +    +G   +A  +G   A+ +   
Sbjct: 239 EGGCQVPVGVYAVPAANDEIQVEAVIASLDGQRLYRDKLSGKASEAEKLGVTLAEKLLAA 298

Query: 300 SNKNVF 305
             + + 
Sbjct: 299 GGQKIL 304


>gi|169634609|ref|YP_001708345.1| porphobilinogen deaminase [Acinetobacter baumannii SDF]
 gi|169153401|emb|CAP02532.1| porphobilinogen deaminase (PBG) (Hydroxymethylbilane synthase)
           (HMBS) (Pre-uroporphyrinogen synthase) [Acinetobacter
           baumannii]
          Length = 314

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 107/303 (35%), Positives = 169/303 (55%), Gaps = 2/303 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            K  +I TR SPLAL  A    + L ++H  P   + ++   T+GD+I +  L +IGGKG
Sbjct: 10  MKTLKIATRQSPLALWQAEHICARLQELH--PDLTVELVKFVTQGDKILDTPLAKIGGKG 67

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+  +   DL 
Sbjct: 68  LFVKELEAALLDGRADLAVHSMKDVPMALPEGLTLAVICEREDPLDAFVSNQFEKFADLP 127

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRRK+ +L+ R D+ +ID RG + TRL KL++ +  AI+LA AG+KRL   
Sbjct: 128 QGAKVGTSSLRRKSQILKQRPDLQIIDLRGNVGTRLAKLDDGQYDAIILASAGLKRLGLA 187

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I+  +      P+ GQGA+ +E   ++ +   L++ + H +T   V  ERAF A L+G
Sbjct: 188 ERIRHCIEPSVSLPAVGQGALGLECRADDQEVLALIQPLLHPETDICVRAERAFNAYLEG 247

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  IAG+A  +   ++  G V + DG+            +A  +G + A+ +      
Sbjct: 248 GCQVPIAGYATLQDGKIHIEGRVGSVDGQTLLRAELTDEANNAQQLGENLARNLLDQGAG 307

Query: 303 NVF 305
           ++ 
Sbjct: 308 DLL 310


>gi|15603677|ref|NP_246751.1| porphobilinogen deaminase [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12722234|gb|AAK03896.1| Pbg [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 312

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 109/305 (35%), Positives = 165/305 (54%), Gaps = 3/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +K  RI TR SPLAL  A   ++ L  +H      + ++P+ TKGD I +  L +IGG
Sbjct: 5   MTRKSLRIATRQSPLALWQANYVKACLEKIHA--GLVVELVPMVTKGDVILDTPLAKIGG 62

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L+ GE D AVHS KD+P +   GL +S    RED RD F+S++ ++L +
Sbjct: 63  KGLFVKELEQALLKGEADIAVHSMKDVPMQFPAGLMLSTICQREDPRDAFVSNSYRTLME 122

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L + R D+ +   RG + TRL KL+N    AI+LA AG+ RL 
Sbjct: 123 LPAGAVVGTSSLRRQCQLKQLRPDLHIHSLRGNVGTRLAKLDNGDYDAIILAAAGLIRLG 182

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           +++ I  ++++    P+ GQGA+ IE      + + L+  +   +T   V  ERA    L
Sbjct: 183 QQQRITSLIDVTQCLPAVGQGAVGIECRQEA-EIELLLAPLADPETTACVLAERAMNRHL 241

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  IAG+A  +   L+   +V   DG             DA  +G   A+ +    
Sbjct: 242 QGGCQVPIAGYAIIEEGQLFLRALVGEVDGSSILRAEGRSAVADAETLGIQVAEKLLQQG 301

Query: 301 NKNVF 305
              + 
Sbjct: 302 ADKIL 306


>gi|227823724|ref|YP_002827697.1| porphobilinogen deaminase [Sinorhizobium fredii NGR234]
 gi|227342726|gb|ACP26944.1| porphobilinogen deaminase [Sinorhizobium fredii NGR234]
          Length = 309

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 157/305 (51%), Positives = 208/305 (68%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KPFRIGTR SPLALA   ETR  L   H +PP    ++ LSTKGDRIT+R L EIGG
Sbjct: 1   MQTKPFRIGTRGSPLALAQTHETRDRLAAAHGLPPEMFEVVVLSTKGDRITDRPLAEIGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFTEE+E++L+SG++D AVHS+KDMPTKL  GL +SA+LPREDIRD F+  TA  L +
Sbjct: 61  KGLFTEELEQQLLSGDLDFAVHSSKDMPTKLPDGLFLSAFLPREDIRDAFVGRTAPRLVE 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +G+SSLRR+AL+ R R DI+VI +RG++ETRL KL   +    LLA+AG+KRL 
Sbjct: 121 LPEGATVGSSSLRRQALIRRLRPDINVITYRGQVETRLRKLAEGQVDGTLLAFAGLKRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
              V  E+L+ ++FPP+P QGAICIE+   + +   L+  I+   T ++V CER FLA L
Sbjct: 181 MTDVPTELLDPKEFPPAPAQGAICIESRDGDDRVNALLAAIDDPRTHEAVACERGFLATL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG+A   G+ + F G++L  DG   H V  +G   DA  +GR A + IR  +
Sbjct: 241 DGSCRTPIAGYAQSDGTYIRFSGMILTPDGATSHRVEIDGKAQDATELGRKAGEQIRDKA 300

Query: 301 NKNVF 305
               F
Sbjct: 301 GPGFF 305


>gi|24211767|sp|Q9CK24|HEM3_PASMU RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
          Length = 309

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 109/305 (35%), Positives = 165/305 (54%), Gaps = 3/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +K  RI TR SPLAL  A   ++ L  +H      + ++P+ TKGD I +  L +IGG
Sbjct: 2   MTRKSLRIATRQSPLALWQANYVKACLEKIHA--GLVVELVPMVTKGDVILDTPLAKIGG 59

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L+ GE D AVHS KD+P +   GL +S    RED RD F+S++ ++L +
Sbjct: 60  KGLFVKELEQALLKGEADIAVHSMKDVPMQFPAGLMLSTICQREDPRDAFVSNSYRTLME 119

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L + R D+ +   RG + TRL KL+N    AI+LA AG+ RL 
Sbjct: 120 LPAGAVVGTSSLRRQCQLKQLRPDLHIHSLRGNVGTRLAKLDNGDYDAIILAAAGLIRLG 179

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           +++ I  ++++    P+ GQGA+ IE      + + L+  +   +T   V  ERA    L
Sbjct: 180 QQQRITSLIDVTQCLPAVGQGAVGIECRQEA-EIELLLAPLADPETTACVLAERAMNRHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  IAG+A  +   L+   +V   DG             DA  +G   A+ +    
Sbjct: 239 QGGCQVPIAGYAIIEEGQLFLRALVGEVDGSSILRAEGRSAVADAETLGIQVAEKLLQQG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 ADKIL 303


>gi|254700531|ref|ZP_05162359.1| porphobilinogen deaminase [Brucella suis bv. 5 str. 513]
 gi|261751035|ref|ZP_05994744.1| porphobilinogen deaminase [Brucella suis bv. 5 str. 513]
 gi|261740788|gb|EEY28714.1| porphobilinogen deaminase [Brucella suis bv. 5 str. 513]
          Length = 314

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 142/305 (46%), Positives = 197/305 (64%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           +    +IG R S LALA A+ TR  L + H +P   I I+P+ST GDRI +R L+E+GGK
Sbjct: 7   KNGTLKIGARGSKLALAQAYLTRRLLQEAHGLPEDAIEILPMSTAGDRIQDRPLSEVGGK 66

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLFTEEIE+ L  G ID AVHS KDMPT L +GL +S +L RED RD FI  +A+   DL
Sbjct: 67  GLFTEEIEQALKDGRIDIAVHSTKDMPTVLPEGLHLSVFLEREDPRDAFIGRSARRFMDL 126

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              + +G+SSLRR+AL+ R R DI V+ +RG ++TRL KL+  +     LA AG++RL  
Sbjct: 127 PQGATVGSSSLRRQALIRRLRPDIEVVMYRGNVDTRLRKLDAGEVDGTFLACAGLRRLGL 186

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
             VI ++L+   FPP+PGQGAI IE+ + + +   L+  + H +T  ++ CERAFL  LD
Sbjct: 187 ADVITDLLDPSVFPPAPGQGAIGIESRIGDERIDVLLAPLAHRETQIALACERAFLGALD 246

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           GSC++ IAG A  +G  L F G++L  DG+  HEV+  G   DA  +G DAA  +R ++ 
Sbjct: 247 GSCRTPIAGLATVEGDRLSFRGMILTPDGRQAHEVTAEGVVSDAAALGTDAANRVRAMAG 306

Query: 302 KNVFN 306
            + F+
Sbjct: 307 PHFFD 311


>gi|218781846|ref|YP_002433164.1| porphobilinogen deaminase [Desulfatibacillum alkenivorans AK-01]
 gi|218763230|gb|ACL05696.1| porphobilinogen deaminase [Desulfatibacillum alkenivorans AK-01]
          Length = 310

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 119/301 (39%), Positives = 167/301 (55%), Gaps = 2/301 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            +IGTR SPLAL  A    + L   +  P     ++ + TKGD+I +  L ++GGKGLF 
Sbjct: 7   IKIGTRGSPLALWQAEHVAALLERRN--PNVKTELVVIKTKGDKILDVPLAKVGGKGLFV 64

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ L+ G  D AVHS KD+P++   GL ++A + RED RD  I   A+ L DL  ++
Sbjct: 65  KEIEESLLDGRTDMAVHSMKDVPSEFPPGLCLAAIMEREDPRDALICSRAKGLLDLPPNA 124

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            IGTSSLRR A LL    D+ +   RG I TRL+KL +    AI+LA AG+KR+  +  +
Sbjct: 125 KIGTSSLRRSAQLLALMPDLQIEPLRGNIGTRLDKLTSLNLDAIVLAAAGVKRMAMDDKV 184

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            E +  E   P+ GQGA+ IE   ++P A  L + +NHE T   V  ERAFL  LDG C+
Sbjct: 185 SEYIPEETVLPAVGQGAMGIEIREDDPVAGPLARALNHEPTQVIVTGERAFLKRLDGGCQ 244

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             +A     KG  L   G++   DG      S +G + DA  +G   A+ +     K V 
Sbjct: 245 VPVAAHGRLKGDFLQLTGVIAGVDGTPIFRDSVSGKKEDAKELGVKLAEKLLNAGGKAVL 304

Query: 306 N 306
           +
Sbjct: 305 D 305


>gi|153875202|ref|ZP_02003104.1| porphobilinogen deaminase [Beggiatoa sp. PS]
 gi|152068334|gb|EDN66896.1| porphobilinogen deaminase [Beggiatoa sp. PS]
          Length = 309

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 112/304 (36%), Positives = 166/304 (54%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            K   RI TR SPLAL      R  L   H  P   I ++ ++T+GD+I +  L +IGGK
Sbjct: 3   NKNIIRIATRKSPLALWQTHHVRDILCHAH--PQLQIELVEMTTQGDKILDVPLAKIGGK 60

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  L  G++D AVHS KD+P +   GL +   + RE+  D F+S+       L
Sbjct: 61  GLFVKELENGLFEGKVDIAVHSMKDVPVEFPPGLILPVIMEREEPYDAFVSNHYSGFTAL 120

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +++GTSSLRR+  LL  R D+ +   RG + TRL KL+N    AI+LA AG+KRL  
Sbjct: 121 PQGAIVGTSSLRRQCQLLVLRPDLQIRTLRGNVGTRLKKLDNGDYDAIILAAAGLKRLGM 180

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
            + I+E+L  E   P+ GQGAI IE   ++ + Q+L+ V+NH+ T + +  ERA   +L+
Sbjct: 181 AERIREVLKPEVMLPAIGQGAIGIECRADDTETQQLIAVLNHKPTQERLKAERALNEQLN 240

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  IAG+A  +   +   G+V   DGK        G    A  +G++ A  +     
Sbjct: 241 GGCQVPIAGYAEIEAEMMTVRGLVGDIDGKEVLHHKVQGPIESAETLGKELATELLAQGA 300

Query: 302 KNVF 305
             + 
Sbjct: 301 DRLL 304


>gi|330876446|gb|EGH10595.1| porphobilinogen deaminase [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
          Length = 313

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 107/305 (35%), Positives = 166/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLLVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     RED RD F+S+T +SL  
Sbjct: 59  KGLFVKELETALLEDNADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTFESLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLEIRFLRGNVNTRLAKLDGGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++HEDT   V  ER+    L
Sbjct: 179 FEDRITSAISVDDSLPAGGQGAVGIECRSVDAEIHALLAPLHHEDTAVRVIAERSLNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  ++  G+V    G++         +  A  +G   A+ +    
Sbjct: 239 NGGCQVPIACYAVLEGDDVWLRGLVGDPSGRVLLHADARAPQTSAQALGVQVAEALLAQG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 AAEIL 303


>gi|70733286|ref|YP_263060.1| porphobilinogen deaminase [Pseudomonas fluorescens Pf-5]
 gi|123734674|sp|Q4K3X3|HEM3_PSEF5 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|68347585|gb|AAY95191.1| porphobilinogen deaminase [Pseudomonas fluorescens Pf-5]
          Length = 313

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 110/305 (36%), Positives = 167/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L + H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLQEAH--PGLVVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  + D AVHS KD+P    +GL +     RED RD F+S+T  SL +
Sbjct: 59  KGLFVKELETALLENQADIAVHSMKDVPMDFPEGLGLFCICEREDPRDAFVSNTYASLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPEGSVVGTSSLRRQAQLLTRRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++H DT   V  ERA    L
Sbjct: 179 FEDRISSSISVDDSLPAGGQGAVGIECRSADIEIHALLAPLHHADTASRVTAERALNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  ++  G+V    G +       G R  A  +G   A  +    
Sbjct: 239 NGGCQVPIACYAVLEGEQIWLRGLVGEPSGGLLLSAEARGPRASAAELGVQVADALLAQG 298

Query: 301 NKNVF 305
             ++ 
Sbjct: 299 ADDIL 303


>gi|325576792|ref|ZP_08147407.1| hydroxymethylbilane synthase [Haemophilus parainfluenzae ATCC
           33392]
 gi|325160998|gb|EGC73116.1| hydroxymethylbilane synthase [Haemophilus parainfluenzae ATCC
           33392]
          Length = 310

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 107/302 (35%), Positives = 163/302 (53%), Gaps = 2/302 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  +I TR SPLAL  A   +  L   H  P  ++ ++P+ TKGD I +  L +IGGKGL
Sbjct: 5   KTLKIATRQSPLALWQANFVKDQLEKFH--PTLSVELVPMVTKGDVILDSPLAKIGGKGL 62

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+    D AVHS KD+P +  +GL +S    RED RD F+S+T +SL DL  
Sbjct: 63  FVKELENALLEKRADIAVHSMKDVPMEFPEGLGLSVICKREDPRDAFVSNTYRSLDDLPQ 122

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            +++GTSSLRR+  L + R D+ +   RG + TRL+KL+N +  AI+LA AG+ RL   +
Sbjct: 123 GAIVGTSSLRRQCQLKQLRPDLDIRSLRGNVGTRLSKLDNGEYDAIILASAGLIRLGLAE 182

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I   + +E   P+ GQGA+ IE  V++ + + L+  ++   T   V  ERA    L G 
Sbjct: 183 RIASFIEVEQSLPAAGQGAVGIECRVDDEEVKALLAPLSDATTTTCVLAERAMNTRLQGG 242

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKN 303
           C+  I G+A  +   ++   +V  +DG             +A  +G   A+ +       
Sbjct: 243 CQVPIGGYAIEQNGEIFLRALVGETDGSAIIRAEGKSAVENAEALGVSIAEQLLAQGADK 302

Query: 304 VF 305
           + 
Sbjct: 303 IL 304


>gi|220933221|ref|YP_002512120.1| Hydroxymethylbilane synthase [Thioalkalivibrio sp. HL-EbGR7]
 gi|254800261|sp|B8GSU8|HEM3_THISH RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|219994531|gb|ACL71133.1| Hydroxymethylbilane synthase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 316

 Score =  273 bits (698), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 116/306 (37%), Positives = 166/306 (54%), Gaps = 3/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLA+  A    + +   H  P   + ++ ++T+GDRI +  L ++GG
Sbjct: 1   MPLDTLRIATRKSPLAVWQAEHVAALVKARH--PGVRVELVGMTTQGDRILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P +L +GL +   L RED RD F+S+T +SL +
Sbjct: 59  KGLFVKELETGLLEGRADIAVHSMKDVPMELPEGLCLPVILDREDPRDAFVSNTFKSLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +GTSSLRR+  L        ++D RG + TRL KL+  +  AI+LA AG+KRL 
Sbjct: 119 LPRDARVGTSSLRRQCQLRHDHPHFQILDLRGNVNTRLAKLDAGEFDAIILAAAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   +  E   P+ GQGAI IE   N+P+   L+  ++  DT   V  ERA  A L
Sbjct: 179 FEVRIASEITPEQSLPAIGQGAIGIECRENDPEVMALIGSLDDPDTHVRVAAERAMNARL 238

Query: 241 DGSCKSAIAGFAYCKG-STLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           +G C+  IAG+A      TL   G+V   DG +      +G R +A  +GR  A  +   
Sbjct: 239 NGGCQVPIAGYAELTDADTLRLRGLVGEPDGSLILRAELSGPRAEAEALGRAVADLLLHE 298

Query: 300 SNKNVF 305
               + 
Sbjct: 299 GAGPIL 304


>gi|322421444|ref|YP_004200667.1| porphobilinogen deaminase [Geobacter sp. M18]
 gi|320127831|gb|ADW15391.1| porphobilinogen deaminase [Geobacter sp. M18]
          Length = 318

 Score =  273 bits (698), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 110/305 (36%), Positives = 165/305 (54%), Gaps = 3/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RIGTR S LAL  A   +S L   +  P   + +  + T GD+I +  L ++GG
Sbjct: 1   MALKELRIGTRASQLALWQANWVKSELEKRY--PDMTVTLKKIKTIGDKILDVPLAQVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE+ ++ GEID AVHS KD+PT+  +GL +     RED RD  IS   +   D
Sbjct: 59  KGLFVKEIEEAMLRGEIDIAVHSMKDVPTEFPEGLGLYCITEREDPRDAVISRGVKFA-D 117

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + IGTS+LRR+A LL+ R D+ ++  RG ++TR++KL      A++LA AG+ RL 
Sbjct: 118 LPQGARIGTSALRRQAQLLKVRPDLEMVIIRGNVQTRMDKLETEGLDAVILAAAGLNRLG 177

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I E+L  +   P+ GQGA+ IE  ++N + ++ +   NH DT  +V  ERA L   
Sbjct: 178 FADQITELLPTDLSLPAIGQGALGIECSLSNEEVKDAISFFNHPDTSRAVRAERALLWRC 237

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +    G  L   G + + DGK+  +    G   +   +G   A+ +    
Sbjct: 238 EGGCQVPIAAYGEVTGDQLKLTGFIASVDGKVSVKGVVTGPADECEKLGVKLAEQLLSDG 297

Query: 301 NKNVF 305
              + 
Sbjct: 298 GHAIL 302


>gi|292493894|ref|YP_003529333.1| porphobilinogen deaminase [Nitrosococcus halophilus Nc4]
 gi|291582489|gb|ADE16946.1| porphobilinogen deaminase [Nitrosococcus halophilus Nc4]
          Length = 310

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 116/306 (37%), Positives = 163/306 (53%), Gaps = 3/306 (0%)

Query: 1   MEKKP-FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M  K   RI TR S LAL  A     +L   H  P  ++ ++ +ST+GD+I +  L ++G
Sbjct: 1   MSAKTCLRIATRKSLLALWQAEYVADTLR--HHHPGLSVELVRMSTQGDKILDTPLAKVG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E+ L+SGE D AVHS KD+P  L + L IS    RED RD F+S+  Q L 
Sbjct: 59  GKGLFVKELEQGLLSGEADIAVHSMKDVPVVLPEDLHISVICEREDPRDAFVSNHWQQLD 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
            L   + +GTSSLRR++ +   R D  V+D RG + TRL KL+NN+   I+LA +G+KRL
Sbjct: 119 SLPEGARVGTSSLRRQSQVRERRPDFHVLDLRGNVNTRLAKLDNNEFDGIVLAASGLKRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
                I E+L  E   P+ GQGAI IE    +   +EL+KV+ H  T  ++  ERA    
Sbjct: 179 GLTDRITELLAPEVSLPAIGQGAIGIECRKGDTATEELLKVLEHTPTRTTIRAERALNER 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L G C+  IA +A   G  L    +V   DG         G   +A  +G    + +   
Sbjct: 239 LAGGCQVPIAAYAELDGERLRLRALVGQPDGGKVIRGEMWGTPEEAEVLGVSLGEDLLRR 298

Query: 300 SNKNVF 305
               + 
Sbjct: 299 GADKIL 304


>gi|28867368|ref|NP_789987.1| porphobilinogen deaminase [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|38257983|sp|Q88B91|HEM3_PSESM RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|28850602|gb|AAO53682.1| porphobilinogen deaminase [Pseudomonas syringae pv. tomato str.
           DC3000]
          Length = 313

 Score =  272 bits (696), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 107/305 (35%), Positives = 167/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLLVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     RED RD F+S+T +SL  
Sbjct: 59  KGLFVKELETALLEDNADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTFESLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  + +AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYNAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++HEDT   V  ER+    L
Sbjct: 179 FEDRITSAISVDDSLPAGGQGAVGIECRSVDAEIHALLAPLHHEDTAVRVIAERSLNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  ++  G+V    G++         +  A  +G   A+ +    
Sbjct: 239 NGGCQVPIACYAVLEGDDVWLRGLVGDPSGRVLLHADARAPQTSAQALGVQVAEALLAQG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 AAEIL 303


>gi|330501254|ref|YP_004378123.1| porphobilinogen deaminase [Pseudomonas mendocina NK-01]
 gi|328915540|gb|AEB56371.1| porphobilinogen deaminase [Pseudomonas mendocina NK-01]
          Length = 312

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 110/305 (36%), Positives = 161/305 (52%), Gaps = 3/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L +IGG
Sbjct: 1   MS-REIRIATRKSALALWQAEYVKARLEQAH--PGLKVSLVPMVSRGDKLLDAPLAKIGG 57

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  E D AVHS KD+P    +GL +     RED RD F+S+T  SL  
Sbjct: 58  KGLFVKELETALLENEADIAVHSMKDVPMDFPEGLGLYCICEREDPRDAFVSNTYDSLDA 117

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 118 LPAGSVVGTSSLRRQAQLLARRPDLKIQFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 177

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I+  ++ ED  P+ GQGA+ IE    +     L+  ++H +T   V  ERA    L
Sbjct: 178 FADRIRSSISAEDSLPAGGQGAVGIECRSADSDVHALLAPLHHRETALRVTAERALNKHL 237

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +   L+  G+V   DG +           DA  +G   A+ +    
Sbjct: 238 NGGCQVPIACYALLEDDQLWLRGLVGQPDGGLLLRAEERAASGDAEALGVRVAEALLAQG 297

Query: 301 NKNVF 305
              + 
Sbjct: 298 ADAIL 302


>gi|294649011|ref|ZP_06726459.1| hydroxymethylbilane synthase [Acinetobacter haemolyticus ATCC
           19194]
 gi|292825146|gb|EFF83901.1| hydroxymethylbilane synthase [Acinetobacter haemolyticus ATCC
           19194]
          Length = 305

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 113/303 (37%), Positives = 164/303 (54%), Gaps = 2/303 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            K  +I TR SPLAL  A   RS L  ++  P   + ++   T+GD+I +  L +IGGKG
Sbjct: 1   MKTLKIATRQSPLALWQAEHIRSRLNALY--PDLTVELVKFVTQGDKILDTPLAKIGGKG 58

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+ G  D AVHS KD+P  L  GL ++    RED  D F+S+     +DL 
Sbjct: 59  LFVKELEAALLDGRADLAVHSMKDVPMHLPDGLTLAVICEREDPLDAFVSNQYARFEDLP 118

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRRK  +L+ R D+ ++D RG + TRL+KL++    AI+LA AG+KRL   
Sbjct: 119 QGAKVGTSSLRRKCQILQQRPDLEIVDLRGNVGTRLSKLDDGLYDAIILASAGLKRLGLA 178

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I+  L      P+ GQGA+ +E   ++ K   L++ + HE+T   V  ERA  A L+G
Sbjct: 179 DRIRHCLAPVLSLPAVGQGALGLECRADDEKLLALIQPLQHEETSICVRAERALNAYLEG 238

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  IAG+A      L   G V + DGK   +    G+   A  +G   AQ +      
Sbjct: 239 GCQVPIAGYATIVNHQLQIEGRVGSVDGKTLLKKQLIGSTDQAEQLGEQLAQDLLDQGAG 298

Query: 303 NVF 305
            + 
Sbjct: 299 ELL 301


>gi|213971710|ref|ZP_03399816.1| porphobilinogen deaminase [Pseudomonas syringae pv. tomato T1]
 gi|301386723|ref|ZP_07235141.1| porphobilinogen deaminase [Pseudomonas syringae pv. tomato Max13]
 gi|302062167|ref|ZP_07253708.1| porphobilinogen deaminase [Pseudomonas syringae pv. tomato K40]
 gi|302130377|ref|ZP_07256367.1| porphobilinogen deaminase [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|213923528|gb|EEB57117.1| porphobilinogen deaminase [Pseudomonas syringae pv. tomato T1]
          Length = 313

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 107/305 (35%), Positives = 167/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLLVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     RED RD F+S+T +SL  
Sbjct: 59  KGLFVKELETALLEDSADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTFESLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  + +AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYNAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++HEDT   V  ER+    L
Sbjct: 179 FEDRITSAISVDDSLPAGGQGAVGIECRSVDAEIHALLAPLHHEDTAVRVIAERSLNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  ++  G+V    G++         +  A  +G   A+ +    
Sbjct: 239 NGGCQVPIACYAVLEGDDVWLRGLVGDPSGRVLLHADARAPQTSAQALGVQVAEALLAQG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 AAEIL 303


>gi|332139557|ref|YP_004425295.1| porphobilinogen deaminase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327549579|gb|AEA96297.1| porphobilinogen deaminase [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 312

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 106/304 (34%), Positives = 166/304 (54%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
             +  RI TR S LAL  A   ++ L++ +  P   + ++P+ST+GD+I +  L +IGGK
Sbjct: 6   TTRTVRIATRKSALALWQAEYVKAKLLEHY--PSMTVELVPMSTQGDKILDTPLAKIGGK 63

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  ++ G  D AVHS KD+P +  +G  + A   RE+  D F+S+   SL  L
Sbjct: 64  GLFIKELEIAMLEGRADIAVHSMKDVPVEFPEGFGLHAICERENPFDAFVSNNHDSLDAL 123

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +++GTSSLRR+  + ++R D+ + D RG + TRL KL+  +  AI+LA AG+ RLK 
Sbjct: 124 PEGAIVGTSSLRRQCQIRKYRPDLIIKDLRGNVNTRLAKLDAGEYDAIILASAGLIRLKM 183

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           +  I+  L  +   P+ GQGA+ IE   ++ +   L++ +NH DT   V  ERA    L+
Sbjct: 184 QSRIRMALPADISLPAVGQGAVGIECRNDDEELIALLQALNHADTHTRVTAERAMNERLE 243

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I  FA      L   G+V   DG      S   +R  A ++G + A+ +     
Sbjct: 244 GGCQVPIGSFATLDNDVLTLTGMVGKPDGSELLFASATASREKAKDMGIEVAEALLEQGA 303

Query: 302 KNVF 305
             + 
Sbjct: 304 GEIL 307


>gi|300115116|ref|YP_003761691.1| porphobilinogen deaminase [Nitrosococcus watsonii C-113]
 gi|299541053|gb|ADJ29370.1| porphobilinogen deaminase [Nitrosococcus watsonii C-113]
          Length = 314

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 118/306 (38%), Positives = 166/306 (54%), Gaps = 3/306 (0%)

Query: 1   MEKKP-FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M  K   RI TR S LAL  A    ++L   H  P  ++ ++ +ST+GD+I +  L +IG
Sbjct: 5   MSAKTCLRIATRKSLLALWQAEYVANTLR--HHYPDLSVELVRMSTQGDKILDTPLAKIG 62

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E+ L SGE D AVHS KD+P  L + L I+    R D RD F+S+  Q L 
Sbjct: 63  GKGLFIKELEQGLFSGEADIAVHSMKDVPVDLPENLHIAVICQRGDPRDAFVSNHWQDLD 122

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
            L   + +GTSSLRR++ +   R D  V+D RG + TRL KL+NN+   I+LA AG+KRL
Sbjct: 123 SLPEGARLGTSSLRRQSQVRERRPDFQVLDLRGNVNTRLAKLDNNEFDGIILATAGLKRL 182

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
           +    I+E L  E   P+ GQGAI IE    +   +EL+KV+ H  T  ++  ERA  A 
Sbjct: 183 ELTHRIRESLAPEVSLPAIGQGAIGIECRKGDTATEELIKVLEHPPTRITLQAERALNAR 242

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L G C+  IAG+A  +   L    +V   DG         G   DA ++G    + +   
Sbjct: 243 LAGGCQVPIAGYAELEDERLRLRALVGQPDGGRVIRGETWGMPGDAESLGASLGEDLLRR 302

Query: 300 SNKNVF 305
               + 
Sbjct: 303 GADKIL 308


>gi|331018514|gb|EGH98570.1| porphobilinogen deaminase [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 313

 Score =  272 bits (695), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 106/305 (34%), Positives = 167/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLLVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     RED RD F+S+T +SL  
Sbjct: 59  KGLFVKELETALLEDNADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTFESLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  + +AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYNAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++HEDT   +  ER+    L
Sbjct: 179 FEDRITSAISVDDSLPAGGQGAVGIECRSVDAEIHALLAPLHHEDTAVRLIAERSLNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  ++  G+V    G++         +  A  +G   A+ +    
Sbjct: 239 NGGCQVPIACYAVLEGDDVWLRGLVGDPSGRVLLHADARAPQTSAQALGVQVAEALLAQG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 AAEIL 303


>gi|251793296|ref|YP_003008024.1| porphobilinogen deaminase [Aggregatibacter aphrophilus NJ8700]
 gi|247534691|gb|ACS97937.1| porphobilinogen deaminase [Aggregatibacter aphrophilus NJ8700]
          Length = 308

 Score =  272 bits (695), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 105/305 (34%), Positives = 162/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +K  +I TR SPLAL  A   +  L  ++  P   + ++P+ TKGD I +  L +IGG
Sbjct: 1   MLEKTLKIATRQSPLALWQANYVKDCLQQLY--PDLIVELVPMVTKGDVILDSPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L++ E D AVHS KD+P +  +GL ++    RED RD F+S++ ++  +
Sbjct: 59  KGLFVKELENALLNKEADIAVHSMKDVPMQFPEGLGLAVICKREDPRDAFVSNSYRTFDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L   R D+ +   RG + TRL+KL+N    AI+LA AG+ RL 
Sbjct: 119 LPQSAVVGTSSLRRQCQLKALRPDLDIRSLRGNVGTRLSKLDNGDYDAIILASAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I   + +E   P+ GQGA+ IE   ++ + ++L+  +   +T   V  ERA    L
Sbjct: 179 LADRIASFIEVEQSLPAAGQGAVGIECRTDDVQVKQLLAPLADAETTCCVLAERAMNNHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I G+A  +   LY   +V   DG             +A  +G   A+ +    
Sbjct: 239 QGGCQVPIGGYAVLQQGQLYLRALVGNVDGSQIIRAEGKSAVKNADVLGVQIAEQLLAQG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 ADKIL 303


>gi|254717954|ref|ZP_05179765.1| porphobilinogen deaminase [Brucella sp. 83/13]
 gi|265982897|ref|ZP_06095632.1| porphobilinogen deaminase [Brucella sp. 83/13]
 gi|306838958|ref|ZP_07471782.1| porphobilinogen deaminase [Brucella sp. NF 2653]
 gi|264661489|gb|EEZ31750.1| porphobilinogen deaminase [Brucella sp. 83/13]
 gi|306405961|gb|EFM62216.1| porphobilinogen deaminase [Brucella sp. NF 2653]
          Length = 314

 Score =  272 bits (695), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 142/305 (46%), Positives = 198/305 (64%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           +    +IGTR S LALA A+ TR  L + H +P   I I+P+ST GDRI +R L+E+GGK
Sbjct: 7   KNGTLKIGTRGSKLALAQAYLTRRLLQEAHGLPEDAIEILPMSTAGDRIQDRPLSEVGGK 66

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLFTEEIE+ L  G ID AVHS KDMPT L +GL +S +L RED RD FI  +A+   DL
Sbjct: 67  GLFTEEIEQALKDGRIDIAVHSTKDMPTVLPEGLHLSVFLEREDPRDAFIGRSARRFMDL 126

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +++G+SSLRR+AL+ R R DI V+ +RG ++TRL KL+  +     LA AG++RL  
Sbjct: 127 PQGAIVGSSSLRRQALIRRLRPDIEVVMYRGNVDTRLRKLDAGEVGGTFLACAGLRRLGL 186

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
             VI ++L+   FPP+PGQGAI IE+ + + +   L+  + H +T  ++ CERAFL  LD
Sbjct: 187 ADVITDLLDPSVFPPAPGQGAIGIESRIGDERIDALLAPLAHRETQIALACERAFLGALD 246

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           GSC++ IAG A  +G  L F G++L  DG+  HEV+      DA  +G DAA  +R ++ 
Sbjct: 247 GSCRTPIAGLATVEGDRLSFRGMILTPDGRQAHEVTAEEAVSDAAALGTDAANRVRAMAG 306

Query: 302 KNVFN 306
            + F+
Sbjct: 307 PHFFD 311


>gi|256821394|ref|YP_003145357.1| porphobilinogen deaminase [Kangiella koreensis DSM 16069]
 gi|256794933|gb|ACV25589.1| porphobilinogen deaminase [Kangiella koreensis DSM 16069]
          Length = 311

 Score =  272 bits (695), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 116/305 (38%), Positives = 169/305 (55%), Gaps = 3/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLA+  A   +S L  +H  P   + ++P++T+GD+I    LT+IGG
Sbjct: 1   MSISTLRIATRQSPLAMWQAEYVQSRLQQLH--PDLTVELVPMTTQGDKILGTPLTKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ ++ G  D AVHS KD+P +  +GL++     RED  D F+S+   +L D
Sbjct: 59  KGLFVKELEQAMLEGRADIAVHSMKDVPYQFPEGLELKVICEREDPTDAFVSNKYHNLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +GTSSLRRK  LLR R D+ + D RG + TRL+KL++    AI+LA AG+KRL 
Sbjct: 119 LPCGANVGTSSLRRKIQLLRARPDLKITDLRGNVGTRLSKLDDGNYDAIVLASAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I+     E   P+PGQGA+ IE   N+P    +++ +  E T   V  ER     L
Sbjct: 179 LEERIRSQFEPELMLPAPGQGAVGIEARTNDPDLDAILQPLQDETTSLRVLAERTITKTL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
             SC+  +A FA     TL    +V   D +   E S  G   DA+ IG   +Q +  + 
Sbjct: 239 QASCQVPVAAFATINDDTLSLRALVGGVD-QQIIEASAEGPAQDALAIGHKVSQELLELG 297

Query: 301 NKNVF 305
            + + 
Sbjct: 298 ARELI 302


>gi|90416175|ref|ZP_01224107.1| porphobilinogen deaminase [marine gamma proteobacterium HTCC2207]
 gi|90331900|gb|EAS47114.1| porphobilinogen deaminase [marine gamma proteobacterium HTCC2207]
          Length = 326

 Score =  272 bits (695), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 104/304 (34%), Positives = 162/304 (53%), Gaps = 4/304 (1%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +  RI TR SPLAL  A   ++ L++ H  P  ++ ++ ++T+GD + +  L ++GGKGL
Sbjct: 18  QTIRIATRKSPLALWQAEFVKAKLLENH--PDLDVQLVAMTTRGDVLLDTPLAKVGGKGL 75

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  ++    D AVHS KD+P +   GL ++    RED  D F+S+   +L +L  
Sbjct: 76  FVKELEVAMLENRADIAVHSMKDVPMEFPPGLGLTVICEREDPLDAFVSNRYANLAELPP 135

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            SV+GTSSLRR+  +     D+ + D RG + TRL KL+     AI+LA AG+ RL  E 
Sbjct: 136 GSVVGTSSLRRQCQIRAAFPDLQIKDLRGNVNTRLAKLDYGDYDAIILASAGLIRLGMEA 195

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I   L  E   P+ GQGA+ IE  +++    EL+K + H  T   V  ERA    L+G 
Sbjct: 196 RIASRLESELCLPAGGQGAVGIECRLDDQATIELLKPLEHSQTRIRVTAERALNRRLEGG 255

Query: 244 CKSAIAGFAYCK--GSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           C+  IA +A     G +L   G+V + DG +  +   +     A  +G + A+ +     
Sbjct: 256 CQVPIACYAELDEAGESLQLRGLVGSVDGSLILQDQLSAPVAQAEQLGIELAERLLAAGA 315

Query: 302 KNVF 305
             + 
Sbjct: 316 GEIL 319


>gi|330965074|gb|EGH65334.1| porphobilinogen deaminase [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 313

 Score =  272 bits (694), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 107/305 (35%), Positives = 166/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLLVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     RED RD F+S+T +SL  
Sbjct: 59  KGLFVKELETALLEDNADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTFESLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLEIRFLRGNVNTRLAKLDGGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++HEDT   V  ER+    L
Sbjct: 179 FEDRITSAISVDDSLPAGGQGAVGIECRSVDAEIHALLAPLHHEDTAVRVIAERSLNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  ++  G+V    G++         +  A  +G   A+ +    
Sbjct: 239 NGGCQVPIACYAVLEGDDVWLRGLVGDPSGRVLLHADARAPQTSAQALGVHVAEALLAQG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 AAEIL 303


>gi|253699058|ref|YP_003020247.1| porphobilinogen deaminase [Geobacter sp. M21]
 gi|259647798|sp|C6DYY8|HEM3_GEOSM RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|251773908|gb|ACT16489.1| porphobilinogen deaminase [Geobacter sp. M21]
          Length = 318

 Score =  272 bits (694), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 166/305 (54%), Gaps = 3/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RIGTR S LAL  A   +S L   +  P   + +  + T GD+I +  L ++GG
Sbjct: 1   MALKELRIGTRASQLALWQANWVKSELEKRY--PDMTVTLTKIKTIGDKILDVPLAQVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE+ ++ GEID AVHS KD+PT+  +GL +     RED RD  IS+  +   D
Sbjct: 59  KGLFVKEIEEAMLRGEIDIAVHSMKDVPTEFPEGLGLYCITEREDPRDAVISNNVKFA-D 117

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + IGTS+LRR+A LL+ R D+ ++  RG ++TR++KL      A++LA AG+ RL 
Sbjct: 118 LPQGARIGTSALRRQAQLLKVRPDLEMVIIRGNVQTRMDKLKTEGLDAVILAAAGLNRLG 177

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I E+L  +   P+ GQGA+ IE +++N   ++ +   NH DT  +V  ERA L   
Sbjct: 178 FADQITELLPTDLSLPAIGQGALGIECNLSNQDVKDAISFFNHPDTSRAVRAERALLWRC 237

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA F    G  L   G + + DGK+  +    G   D   +G   A+ +    
Sbjct: 238 EGGCQVPIAAFGEVTGDELKLTGFIASVDGKVSVKGVVTGPADDCEKLGVKLAEQLLSEG 297

Query: 301 NKNVF 305
              + 
Sbjct: 298 GHAIL 302


>gi|254784450|ref|YP_003071878.1| hydroxymethylbilane synthase [Teredinibacter turnerae T7901]
 gi|237686105|gb|ACR13369.1| hydroxymethylbilane synthase [Teredinibacter turnerae T7901]
          Length = 324

 Score =  272 bits (694), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 112/303 (36%), Positives = 170/303 (56%), Gaps = 2/303 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K   RI TR S LAL  A   +S L   H  P   + ++PL+++GD+I +  L ++GGKG
Sbjct: 15  KHTLRIATRKSALALWQAEFVKSELCRHH--PELAVELVPLTSRGDKILDVPLAKVGGKG 72

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E+ +I+GE D AVHS KD+P +  +GL ++    RED RD  +S+   +L  + 
Sbjct: 73  LFVKELEQAIIAGEADIAVHSMKDVPMEFPQGLGLAVICEREDPRDALVSNKYSNLDAIP 132

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +VIGTSSLRR++ LL  R D+ V   RG + TRL KL+  +  AI+LA AG+KRL+  
Sbjct: 133 AGAVIGTSSLRRQSQLLAMRPDLEVTFLRGNVNTRLAKLDAGEYDAIILASAGLKRLQMV 192

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I E +  E   P+ GQGA+ IE   ++ +   L++ ++H  T  +V  ERA   +L+G
Sbjct: 193 DRIAEFIAPEVMLPAGGQGAVGIECRTDDQETLALLQPLHHGVTEQAVLAERAMNRKLEG 252

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  I GFA  + + L+  G+V   DG         G+  DA  +G   A+ +      
Sbjct: 253 GCQVPIGGFAIHQDNQLWVRGLVADPDGSEVLYDQVIGDPADAETLGVVLAEKLLAAGAD 312

Query: 303 NVF 305
            + 
Sbjct: 313 AIL 315


>gi|237809861|ref|YP_002894301.1| porphobilinogen deaminase [Tolumonas auensis DSM 9187]
 gi|237502122|gb|ACQ94715.1| porphobilinogen deaminase [Tolumonas auensis DSM 9187]
          Length = 308

 Score =  272 bits (694), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 108/306 (35%), Positives = 161/306 (52%), Gaps = 5/306 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLAL  A   +  L   H  P   + ++P+ST+GD+I +  L +IGG
Sbjct: 1   MTE--LRIATRKSPLALWQANFVKQQLELHH--PGLQVTLVPMSTQGDKILDTPLAKIGG 56

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ ++    D AVHS KD+P     GL ++    R+D  D F+S    S+ +
Sbjct: 57  KGLFVKELEQAMLENRADIAVHSMKDVPVDFPDGLGLAVICERDDPYDAFVSSRFASVYE 116

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L   R D+ + D RG + TRL KL+     AI+LA AG++RL 
Sbjct: 117 LPEGAVVGTSSLRRQCQLRAQRPDLVIRDLRGNVNTRLAKLDAGDYDAIILAAAGLRRLD 176

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           K + I+  L  E   P+ GQGA+ IE  + + +   L+  + H  T   V  ERA    L
Sbjct: 177 KAERIRSRLPPELSLPANGQGAVGIECRLGDTQTLALLASLEHATTRYCVMAERAMNRTL 236

Query: 241 DGSCKSAIAGFAYC-KGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
            G C+  I  FA       L+  G+V + DGK       +G +  A  +G+  A+ +   
Sbjct: 237 QGGCQVPIGAFAEMQDNDHLWLRGLVGSVDGKQIIHGDISGPKEQAEELGKLLAEQLLVQ 296

Query: 300 SNKNVF 305
              ++ 
Sbjct: 297 GADDIL 302


>gi|119484355|ref|ZP_01618972.1| Porphobilinogen deaminase [Lyngbya sp. PCC 8106]
 gi|119457829|gb|EAW38952.1| Porphobilinogen deaminase [Lyngbya sp. PCC 8106]
          Length = 321

 Score =  272 bits (694), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 106/307 (34%), Positives = 161/307 (52%), Gaps = 5/307 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            +  RIG+R S LAL   +  ++ L      P     +  +ST+GD+I +  L +IG KG
Sbjct: 8   TRTVRIGSRKSQLALVQTYWVQAELKK--HFPDIEFEVHTMSTQGDKILDVALAKIGDKG 65

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFI---SHTAQSLK 119
           LFT+E+E  +++ + D AVHS KD+PT L +GL +     RE+  D  +    H  + L+
Sbjct: 66  LFTKELEVGMLNHDTDIAVHSLKDLPTNLPEGLMLGCVTERENPADALVVHERHKDKQLE 125

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
            L   +VIGTSSLRR A L      +   D RG + TRL KL+     AI+LA AG+KRL
Sbjct: 126 TLPQGAVIGTSSLRRLAQLRHHFPHLEFKDIRGNLNTRLEKLDEGGYDAIILAVAGLKRL 185

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
                I + ++ +    + GQGA+ IE    +    E++KV+ H  T    + ERAFL E
Sbjct: 186 GMGDRIHQTISPDVSLHAVGQGALGIECRDGDENILEILKVLEHTPTAQRCHAERAFLRE 245

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I   +  + + L   G+V + DGK     + +G   +A  +G D A  +R  
Sbjct: 246 LEGGCQVPIGVNSEVENNQLTLIGMVASLDGKRLIRDTVSGETTNAEQLGIDLAHRLREQ 305

Query: 300 SNKNVFN 306
             K + +
Sbjct: 306 GAKEILD 312


>gi|238756296|ref|ZP_04617611.1| Porphobilinogen deaminase [Yersinia ruckeri ATCC 29473]
 gi|238705502|gb|EEP97904.1| Porphobilinogen deaminase [Yersinia ruckeri ATCC 29473]
          Length = 315

 Score =  271 bits (693), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 109/305 (35%), Positives = 162/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLA+  A   +  L   H      + ++P+ T+GD I +  L ++GG
Sbjct: 3   MSDKIIRIATRQSPLAMWQAHYVQQLLQTCHS--GLKVELVPMVTRGDIILDTPLAKVGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     R+D RD F+S+  Q + D
Sbjct: 61  KGLFVKELELALLEDRADIAVHSMKDVPIAFPQGLGLVTICERDDPRDAFVSNNYQRMDD 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L + R D+ V D RG + TRL+KL+     AI+LA AG+ RL 
Sbjct: 121 LPAGSIVGTSSLRRQCQLRQRRPDLIVKDLRGNVGTRLSKLDQGDYDAIILAVAGLNRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I+  ++ E+  P+ GQGA+ IE  +++   + L+  +NH  T   V  ERA    L
Sbjct: 181 LKDRIRYAMSPEESLPAVGQGAVGIECRLDDNLTRALLAPLNHRPTELRVCAERAMNTRL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +  TL+   +V A DG       R G    A  +G + A  +    
Sbjct: 241 EGGCQVPIGSYAILEDDTLWLRALVGAPDGSQMICGERRGPATHAEQMGIELADELLSRG 300

Query: 301 NKNVF 305
            K + 
Sbjct: 301 AKAIL 305


>gi|92115224|ref|YP_575152.1| hydroxymethylbilane synthase [Chromohalobacter salexigens DSM 3043]
 gi|91798314|gb|ABE60453.1| hydroxymethylbilane synthase [Chromohalobacter salexigens DSM 3043]
          Length = 311

 Score =  271 bits (693), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 102/305 (33%), Positives = 160/305 (52%), Gaps = 4/305 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            +  RI TR S LAL  A   ++ L+ +H  P   + ++ ++T+GD+I +  L ++GGKG
Sbjct: 1   MQTLRIATRQSRLALWQAEHVKARLLALH--PGLEVELVAMTTRGDKILDSPLAKVGGKG 58

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E+ L+ G  D AVHS KD+P    +GL +S  L      D F+S+   SL  L 
Sbjct: 59  LFVKELEEALLDGRADIAVHSMKDVPMHFPEGLGLSVILESGAPTDAFVSNDYASLDALP 118

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
               +GTSSLRR   +   R D+ V++ RG ++TRL KL+  +  AI+LA +G++RL+  
Sbjct: 119 EGVRVGTSSLRRGLQVKEARPDLEVLNLRGNVQTRLGKLDGGEFEAIILATSGLQRLELG 178

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I + L  E   P+ GQGA+ IE   ++    EL+  ++H  T   V  ERA    LDG
Sbjct: 179 HRITQELPPEVSLPACGQGALGIECRHDDESLLELLAPLDHPQTATRVRAERAMNTRLDG 238

Query: 243 SCKSAIAGFAYCKGS--TLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            C+  I G+A  +    TL+   +V   DG         G+  +   +G   A+ +    
Sbjct: 239 GCQVPIGGYAVLEDGDRTLWLRALVGDPDGSRVLRAEGRGSADEPEALGVRIAESLLDQG 298

Query: 301 NKNVF 305
             ++ 
Sbjct: 299 AGDIL 303


>gi|262375167|ref|ZP_06068401.1| porphobilinogen deaminase [Acinetobacter lwoffii SH145]
 gi|262310180|gb|EEY91309.1| porphobilinogen deaminase [Acinetobacter lwoffii SH145]
          Length = 310

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 116/306 (37%), Positives = 172/306 (56%), Gaps = 3/306 (0%)

Query: 1   ME-KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M+  K  +I TR SPLAL  A   R+ L D+H      + ++   T+GD+I +  L +IG
Sbjct: 1   MKFMKTLKIATRQSPLALWQAEHIRARLQDLHA--GLQVELVTFVTQGDKILDTPLAKIG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+T  S +
Sbjct: 59  GKGLFVKELEAALLDGRADLAVHSMKDVPMALPEGLSLAVICEREDPLDAFVSNTYTSFE 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           +L   + +GTSSLRRK  +L+ R D+ +ID RG + TRL+KL+  +  AI+LA AG+KRL
Sbjct: 119 ELPQGAKVGTSSLRRKTQILKQRPDLDIIDLRGNVGTRLSKLDAGQYDAIILASAGLKRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
              + I+  L  E   P+ GQGA+ +E   ++    +L++ + H DT   V  ERAF A 
Sbjct: 179 GLAERIRHTLTPEVSLPAVGQGALGLECRTHDQTVLDLIQPLLHADTDACVRAERAFNAY 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  IAG+A  K   +   G V + DG +     + G   DA  +G   A+ +   
Sbjct: 239 LEGGCQVPIAGYATLKEGVISIEGRVGSIDGAVLLRAQQTGKTADAEQLGVKLAKDLLDQ 298

Query: 300 SNKNVF 305
               + 
Sbjct: 299 GAGELL 304


>gi|226951768|ref|ZP_03822232.1| porphobilinogen deaminase [Acinetobacter sp. ATCC 27244]
 gi|226837483|gb|EEH69866.1| porphobilinogen deaminase [Acinetobacter sp. ATCC 27244]
          Length = 305

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 114/303 (37%), Positives = 164/303 (54%), Gaps = 2/303 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            K  +I TR SPLAL  A   RS L  ++  P   + ++   T+GD+I +  L +IGGKG
Sbjct: 1   MKTLKIATRQSPLALWQAEHIRSRLNTLY--PDLTVELVKFVTQGDKILDTPLAKIGGKG 58

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+ G  D AVHS KD+P  L  GL ++    RED  D F+S+     +DL 
Sbjct: 59  LFVKELEAALLDGRADLAVHSMKDVPMHLPDGLTLAVICEREDPLDAFVSNQYARFEDLP 118

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRRK  +L+ R D+ +ID RG + TRL+KL++    AI+LA AG+KRL   
Sbjct: 119 QGAKVGTSSLRRKCQILQQRPDLEIIDLRGNVGTRLSKLDDGLYDAIILASAGLKRLGLA 178

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I+  L      P+ GQGA+ +E   ++ K   L++ + HE+T   V  ERA  A L+G
Sbjct: 179 DRIRHCLAPVLSLPAVGQGALGLECRADDEKLLALIQPLQHEETSICVRAERALNAYLEG 238

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  IAG+A      L   G V + DGK   +    G+   A  +G   AQ +      
Sbjct: 239 GCQVPIAGYATIVNHQLQIEGRVGSVDGKTLLKKQLIGSTDQAEQLGEQLAQDLLDQGAG 298

Query: 303 NVF 305
            + 
Sbjct: 299 ELL 301


>gi|496214|gb|AAA18907.1| porophorbilinogen deaminase [Pseudomonas aeruginosa]
          Length = 314

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 111/307 (36%), Positives = 165/307 (53%), Gaps = 3/307 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSS-LMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M  +  RI TR S LAL  A    S+ L   H  P   + ++P++++GD++ +  L +IG
Sbjct: 1   MSSREIRIATRQSALALWQAEYVNSTGLEQAH--PGLTVTLLPMTSRGDKLLDAPLAKIG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  L+ G  D AVHS KD+P    +GL +     RED RD F+S+T  SL+
Sbjct: 59  GKGLFVKELETALLEGAADIAVHSMKDVPMDFPEGLGLYTICEREDPRDAFVSNTYASLE 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
            L   SV+GTS L R+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL
Sbjct: 119 QLPAGSVVGTSRLGRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGVIRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
             E  I+  ++++D  P+ GQGA+ IE    +     L++ ++H DT   V  ERA    
Sbjct: 179 GFESRIRSSISVDDSLPAGGQGAVGIECRTADSDLHALLEPLHHTDTALRVTAERALNKR 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  IA +A  +G  L+  G+V   DG             DA  +G   A+ +   
Sbjct: 239 LNGGCQVPIACYAIREGDQLWLRGLVGQPDGTQLLRAEGRAPLADAEALGVRVAEDLLEQ 298

Query: 300 SNKNVFN 306
             + +  
Sbjct: 299 GAEAILE 305


>gi|77164030|ref|YP_342555.1| porphobilinogen deaminase [Nitrosococcus oceani ATCC 19707]
 gi|76882344|gb|ABA57025.1| hydroxymethylbilane synthase [Nitrosococcus oceani ATCC 19707]
          Length = 310

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 120/306 (39%), Positives = 167/306 (54%), Gaps = 3/306 (0%)

Query: 1   MEKKP-FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M  K   RI TR S LAL  A     +L   H  P  NI ++ +ST+GD+I +  L +IG
Sbjct: 1   MSAKTCLRIATRKSLLALWQAEYVADTLR--HHYPDLNIELVRMSTQGDKILDTPLAKIG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E+ L SGE D AVHS KD+P  L + L I+    R D RD F+S+  Q L 
Sbjct: 59  GKGLFIKELEQGLFSGEADIAVHSMKDVPVDLPENLHIAVICQRGDPRDAFVSNHWQDLD 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
            L   + +GTSSLRR++ +   R D  V+D RG + TRL KL+NN+  AI+LA AG+KRL
Sbjct: 119 SLPEGARVGTSSLRRQSQVRERRPDFQVLDLRGNVNTRLAKLDNNEFDAIILAAAGLKRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
           +  + I+E L  E   P+ GQGAI IE    +   +EL+KV+ H  T  ++  ERA  A 
Sbjct: 179 ELTQRIRESLAPEVSLPAIGQGAIGIECRKGDTATEELIKVLEHPPTRITIRAERALNAR 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L G C+  IAG+A  +   L    +V   DG         G   +A ++G    + +   
Sbjct: 239 LAGGCQVPIAGYAELEDERLRLRALVGQPDGGRVIRGETWGMPGEAESLGASLGEDLLRR 298

Query: 300 SNKNVF 305
               + 
Sbjct: 299 GADKIL 304


>gi|254435152|ref|ZP_05048659.1| porphobilinogen deaminase [Nitrosococcus oceani AFC27]
 gi|207088263|gb|EDZ65535.1| porphobilinogen deaminase [Nitrosococcus oceani AFC27]
          Length = 314

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 120/306 (39%), Positives = 167/306 (54%), Gaps = 3/306 (0%)

Query: 1   MEKKP-FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M  K   RI TR S LAL  A     +L   H  P  NI ++ +ST+GD+I +  L +IG
Sbjct: 5   MSAKTCLRIATRKSLLALWQAEYVADTLR--HHYPDLNIELVRMSTQGDKILDTPLAKIG 62

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E+ L SGE D AVHS KD+P  L + L I+    R D RD F+S+  Q L 
Sbjct: 63  GKGLFIKELEQGLFSGEADIAVHSMKDVPVDLPENLHIAVICQRGDPRDAFVSNHWQDLD 122

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
            L   + +GTSSLRR++ +   R D  V+D RG + TRL KL+NN+  AI+LA AG+KRL
Sbjct: 123 SLPEGARVGTSSLRRQSQVRERRPDFQVLDLRGNVNTRLAKLDNNEFDAIILAAAGLKRL 182

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
           +  + I+E L  E   P+ GQGAI IE    +   +EL+KV+ H  T  ++  ERA  A 
Sbjct: 183 ELTQRIRESLAPEVSLPAIGQGAIGIECRKGDTATEELIKVLEHPPTRITIRAERALNAR 242

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L G C+  IAG+A  +   L    +V   DG         G   +A ++G    + +   
Sbjct: 243 LAGGCQVPIAGYAELEDERLRLRALVGQPDGGRVIRGETWGMPGEAESLGASLGEDLLRR 302

Query: 300 SNKNVF 305
               + 
Sbjct: 303 GADKIL 308


>gi|254424552|ref|ZP_05038270.1| porphobilinogen deaminase [Synechococcus sp. PCC 7335]
 gi|196192041|gb|EDX87005.1| porphobilinogen deaminase [Synechococcus sp. PCC 7335]
          Length = 319

 Score =  270 bits (691), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 107/307 (34%), Positives = 159/307 (51%), Gaps = 5/307 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            +  RIG+R S LAL      ++ L      P     +  + T+GD+I +  L++IG KG
Sbjct: 7   TRTIRIGSRKSQLALVQTHWVQAELSKA--FPDITFEVSTMETQGDKILDVALSKIGDKG 64

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFI---SHTAQSLK 119
           LFT+E+E  ++S  +D AVHS KD+PT+L +GL +     RED  D  +    H  + L 
Sbjct: 65  LFTQELEDDMLSHRVDFAVHSLKDLPTQLPEGLMLGCVTEREDPADALVVHEKHKDKQLD 124

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
            L   +VIGTSSLRR A L          D RG + TRL KL+  +  AI+LA AG+ RL
Sbjct: 125 TLPEGAVIGTSSLRRLAQLRHHFPHFQFKDIRGNVNTRLRKLDEGEYDAIVLAAAGLNRL 184

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
                I ++L  E    + GQGA+ IE    +     ++K + H  T      ERAFL E
Sbjct: 185 DMSDRIHQLLPAEISLHAVGQGALGIECRSGDEDILTVIKALEHLPTAQRCYAERAFLRE 244

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I      +G TL   GIV + DG+   + +  G   DA ++G++ A+ +R  
Sbjct: 245 LEGGCQVPIGVNTRIEGDTLTLVGIVASLDGQQLIKDTVQGAPADAESMGKELAERLREQ 304

Query: 300 SNKNVFN 306
             + + +
Sbjct: 305 GAQKILD 311


>gi|167031229|ref|YP_001666460.1| porphobilinogen deaminase [Pseudomonas putida GB-1]
 gi|189028150|sp|B0KH05|HEM3_PSEPG RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|166857717|gb|ABY96124.1| porphobilinogen deaminase [Pseudomonas putida GB-1]
          Length = 313

 Score =  270 bits (691), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 111/305 (36%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L +IGG
Sbjct: 1   MSTREIRIATRKSALALWQAEYVKARLEQAH--PGLLVTLVPMVSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  E D AVHS KD+P    +GL +     RED RD F+S+T  SL+ 
Sbjct: 59  KGLFVKELETALLDNEADIAVHSMKDVPMDFPEGLGLYCICEREDPRDAFVSNTFDSLEA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++H DT D V  ERA    L
Sbjct: 179 FEDRITSTISVDDSLPAGGQGAVGIECRSADVEIHALLAPLHHADTADRVVAERALNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  L+  G+V    G           R  A  +G   A+ +    
Sbjct: 239 NGGCQVPIACYAVLEGDQLWLRGLVGQPSGGTLLVADARAPRTAAETLGVQVAEDLLSQG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AEAIL 303


>gi|220910316|ref|YP_002485627.1| porphobilinogen deaminase [Cyanothece sp. PCC 7425]
 gi|219866927|gb|ACL47266.1| porphobilinogen deaminase [Cyanothece sp. PCC 7425]
          Length = 322

 Score =  270 bits (691), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 106/307 (34%), Positives = 160/307 (52%), Gaps = 5/307 (1%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
             +  RIG+R S LAL   +  +  L      P  +  +  +ST+GD+I +  L +IG K
Sbjct: 8   SSRTIRIGSRKSQLALVQTYWVQEQLQK--HFPDRSFEVHTMSTQGDKILDVALAKIGDK 65

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK-- 119
           GLFT+E+E+ ++S E D AVHS KD+PT L  GL +     RE+  D  + +     +  
Sbjct: 66  GLFTKELEQGMLSQETDFAVHSLKDLPTHLPDGLILGCITERENPADALVMNEKYRDRPL 125

Query: 120 -DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR 178
             L   +VIGTSSLRR A L  +   ++  D RG + TRL KL+  +  A++LA AG++R
Sbjct: 126 ETLPEGAVIGTSSLRRLAQLRHYFPHLTFKDVRGNVNTRLAKLDAGEYDALVLAVAGLQR 185

Query: 179 LKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLA 238
           L     I +IL  E    + GQGA+ IE   ++P+   L+K + H+ T      ERAFL 
Sbjct: 186 LGFSDRIHQILPPEISLHAVGQGALGIECRSDDPEVLSLIKALEHQPTAWRCLAERAFLR 245

Query: 239 ELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRF 298
           EL+G C+  I      +G  L   G+V + DG+   +    G    A  +G + AQ +R 
Sbjct: 246 ELEGGCQVPIGVNTQLEGDQLTLTGLVASLDGQRLIKDQITGAATTAEQMGTELAQRLRQ 305

Query: 299 ISNKNVF 305
              + + 
Sbjct: 306 QGAEEIL 312


>gi|209526164|ref|ZP_03274695.1| porphobilinogen deaminase [Arthrospira maxima CS-328]
 gi|209493420|gb|EDZ93744.1| porphobilinogen deaminase [Arthrospira maxima CS-328]
          Length = 322

 Score =  270 bits (691), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 104/307 (33%), Positives = 159/307 (51%), Gaps = 5/307 (1%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           + +  RI +R S LAL   +  +  L    + P     +  +ST+GD+I +  L +IG K
Sbjct: 8   QTRTIRIASRKSQLALVQTYWVQEELQK--RFPDIKFEVHTMSTQGDKILDVALAKIGDK 65

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFI---SHTAQSL 118
           GLFT+E+E  +++ + D AVHS KD+PT L +GL +     RED  D  +   +H  + L
Sbjct: 66  GLFTKELEVGMLNHDTDMAVHSLKDLPTNLPEGLMLGCVTEREDPADALVVHENHRDKQL 125

Query: 119 KDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR 178
             L   +V+GTSSLRR A L      +   D RG + TRL KL+  +  AI+LA AG+KR
Sbjct: 126 DTLPPGAVVGTSSLRRLAQLRHNFPHLEFKDIRGNLNTRLQKLDEGQYDAIILAVAGLKR 185

Query: 179 LKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLA 238
           L     I +++  E    + GQGA+ +E    + +  E+VK + H  T    + ERAFL 
Sbjct: 186 LGMADRIHQVIPAEISLHAVGQGALGLECREGDTEIFEVVKALEHTVTAQRCHSERAFLR 245

Query: 239 ELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRF 298
           EL+G C+  I      +G  L   G+V + DGK   + +  G   DA  +G   A  ++ 
Sbjct: 246 ELEGGCQVPIGVNTMVEGDRLTLTGMVASLDGKRLIKDTVTGQASDAEQLGIQLAHKLKQ 305

Query: 299 ISNKNVF 305
              + + 
Sbjct: 306 QGAEEIL 312


>gi|307546845|ref|YP_003899324.1| porphobilinogen deaminase [Halomonas elongata DSM 2581]
 gi|307218869|emb|CBV44139.1| porphobilinogen deaminase [Halomonas elongata DSM 2581]
          Length = 380

 Score =  270 bits (691), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 108/305 (35%), Positives = 166/305 (54%), Gaps = 4/305 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            +  RI TR S LA+  A   R  LM+VH  P   + ++ LST+GD+I +  L ++GGKG
Sbjct: 71  MQTLRIATRKSQLAMWQAEHVRDRLMEVH--PELTVELVALSTRGDQILDTPLAKVGGKG 128

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E+ ++ G  D AVHS KD+P +  + L +S  L   +  D F+S+   SL +L 
Sbjct: 129 LFVKELEEAMLDGRADIAVHSMKDVPMQFPESLGLSVILAGAEPTDAFVSNQYASLDELP 188

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + IGTSSLRR   +   R D+ V++ RG ++TRL KL+N +  AILLA AG+KRL  E
Sbjct: 189 EGARIGTSSLRRGLQMRERRPDLEVLNLRGNVQTRLGKLDNGEFDAILLATAGLKRLGLE 248

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I + L  E   P+ GQGA+ IE  +++ +   L+  ++  DT   V  ERA    L+G
Sbjct: 249 ERITQELPPEICLPACGQGALGIECRMHDAELIGLLAPLDDPDTATRVRAERAMNTRLEG 308

Query: 243 SCKSAIAGFAYCKGS--TLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            C+  IAG A  +    TL+   +V   +G         G+  +   +G   A+ +    
Sbjct: 309 GCQVPIAGHAVFENDGQTLWLRALVGNPEGTEVLRAEGRGSIHEPEALGIRVAEELLDQG 368

Query: 301 NKNVF 305
             ++ 
Sbjct: 369 AGDIL 373


>gi|126725997|ref|ZP_01741839.1| porphobilinogen deaminase [Rhodobacterales bacterium HTCC2150]
 gi|126705201|gb|EBA04292.1| porphobilinogen deaminase [Rhodobacterales bacterium HTCC2150]
          Length = 313

 Score =  270 bits (690), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 131/311 (42%), Positives = 183/311 (58%), Gaps = 4/311 (1%)

Query: 1   MEK----KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLT 56
           M+K     P +IGTR SPLALA A ETR  L   H + P    I+ + T GD + +R L 
Sbjct: 1   MKKFTPQSPLKIGTRGSPLALAQAHETRDRLSKAHNLAPEAFEIVVIKTTGDIVQDRPLK 60

Query: 57  EIGGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQ 116
           EIGGKGLFT+EIE+ ++SG+ID AVHS KDMP +   GL I+ YLPRED+RD F+S +A 
Sbjct: 61  EIGGKGLFTKEIEEAMLSGDIDIAVHSMKDMPVEQPDGLAITCYLPREDVRDAFVSLSAD 120

Query: 117 SLKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGI 176
           S  DL   + +G+SSLRR+A L   R D+++++FRG ++TR+ KL +  A A  LA AG+
Sbjct: 121 SFDDLRQGATVGSSSLRRRAQLAHRRPDLNLVEFRGNVQTRMRKLGDGVADATFLAMAGL 180

Query: 177 KRLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAF 236
            RL    V +  L  + F P+  QGAI IE  + +    E++  I+ + T D +  ERAF
Sbjct: 181 IRLGMSDVARLPLETDVFLPAVAQGAIGIEQRIGDSVISEMLTAIHDQHTGDLLAAERAF 240

Query: 237 LAELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           LA ++GSC++ IAG A      L+F   +L  DG      + +G   D   IGR  A  +
Sbjct: 241 LARVEGSCQTPIAGLAEIIDGKLHFRAEILRPDGSEAITGAASGEIADGAAIGRQVADDL 300

Query: 297 RFISNKNVFNF 307
              +    F +
Sbjct: 301 LARAPTGFFEW 311


>gi|126666605|ref|ZP_01737583.1| porphobilinogen deaminase [Marinobacter sp. ELB17]
 gi|126628993|gb|EAZ99612.1| porphobilinogen deaminase [Marinobacter sp. ELB17]
          Length = 313

 Score =  270 bits (690), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 108/306 (35%), Positives = 169/306 (55%), Gaps = 3/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L  +H      + ++ + T GD+I +  L ++GG
Sbjct: 1   MSARNLRIATRSSALALWQAEFIKAELERLHS--NVTVELVKIKTLGDKILDVPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ ++ G  D AVHS KD+P    +GL + A   R+D  D FIS+   SL D
Sbjct: 59  KGLFVKELEEAMLDGRADLAVHSMKDVPMAFPEGLGLVAICERDDPTDAFISNHFSSLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L L++V+GTSSLRR++ L   R D+ +   RG + TRL KL+     AI+LA +G+KRL 
Sbjct: 119 LPLNAVVGTSSLRRESQLRANRPDLQIRVLRGNVNTRLAKLDAGNYDAIILASSGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +      P+ GQGA+ IE  +++ + + +++ +NH D+ D V  ERA    L
Sbjct: 179 FEARIRNCMPDTLSLPAVGQGALGIECRLDDQELRAMLEPLNHTDSADRVKAERALNTRL 238

Query: 241 DGSCKSAIAGFAYCKG-STLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           +G C+  IA +A  +    L+  G+V A DG +        +R +   +GR+ A+ +   
Sbjct: 239 NGGCQVPIAAYALLEDNDMLWLRGLVGAVDGSLIFRAEGRVHRSEGERLGRELAEDLLAQ 298

Query: 300 SNKNVF 305
               V 
Sbjct: 299 GADKVL 304


>gi|221640136|ref|YP_002526398.1| porphobilinogen deaminase [Rhodobacter sphaeroides KD131]
 gi|221160917|gb|ACM01897.1| Porphobilinogen deaminase [Rhodobacter sphaeroides KD131]
          Length = 310

 Score =  270 bits (690), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 133/303 (43%), Positives = 183/303 (60%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P +IGTR SPLALA A+ETRS L     +P     I+ + T GD++ +R L EIGGKGLF
Sbjct: 7   PLKIGTRGSPLALAQAYETRSRLSAAFSLPEEAFEIVVIKTTGDKVLDRPLKEIGGKGLF 66

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T EIE+ L+SG ID AVHS KDMPT   +GL +  YLPRED RD FI+     L DL   
Sbjct: 67  TREIEEALLSGGIDIAVHSMKDMPTLQPEGLILDTYLPREDTRDAFITFAEGGLADLPQG 126

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           + +G+SSLRR+A LL  R D+ V++FRG ++TRL KLN+  A    LA AG+ RLK  +V
Sbjct: 127 ATVGSSSLRRRAQLLNKRPDLQVVEFRGNLQTRLKKLNDGVARGTFLAMAGLNRLKMNEV 186

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
            +  +  E+   +  QGAI IE   ++P+AQE++  I+   T   +  ER+FL +LDGSC
Sbjct: 187 PRVPIEPEEMLSAVAQGAIGIERRTDDPRAQEMLAAIHDVPTGHRLAAERSFLLKLDGSC 246

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           ++ IAG A  +G  L+  G +L  DG         G   DA  +G + A  +   +  + 
Sbjct: 247 ETPIAGLAILEGDQLWLRGEILRPDGSESISGEIRGAIADAAALGSELASELLGRAPADF 306

Query: 305 FNF 307
           F++
Sbjct: 307 FSW 309


>gi|146305321|ref|YP_001185786.1| porphobilinogen deaminase [Pseudomonas mendocina ymp]
 gi|145573522|gb|ABP83054.1| hydroxymethylbilane synthase [Pseudomonas mendocina ymp]
          Length = 312

 Score =  270 bits (690), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 109/302 (36%), Positives = 163/302 (53%), Gaps = 2/302 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L +IGGKGL
Sbjct: 3   REIRIATRKSALALWQAEYVKARLEQAH--PGLLVSLVPMVSRGDKLLDAPLAKIGGKGL 60

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+  E D AVHS KD+P    +GL +     RED RD F+S+T  SL  L  
Sbjct: 61  FVKELETALLENEADIAVHSMKDVPMDFPEGLGLYCICEREDPRDAFVSNTYDSLDALPA 120

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL  + 
Sbjct: 121 GSVVGTSSLRRQAQLLARRPDLKIQFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLGFQD 180

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  ++ ED  P+ GQGA+ IE    + +   L+  ++H +T   V  ERA    L+G 
Sbjct: 181 RIRSSISAEDSLPAGGQGAVGIECRSADAEIHALLAPLHHRETALRVTAERALNKRLNGG 240

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKN 303
           C+  IA +A  +   L+  G+V   DG +           DA  +G   A+ +     + 
Sbjct: 241 CQVPIACYALLENDQLWLRGLVGQPDGGLLLRAEHRAASSDAEALGVRVAEALLAQGAEA 300

Query: 304 VF 305
           + 
Sbjct: 301 IL 302


>gi|90023307|ref|YP_529134.1| hydroxymethylbilane synthase [Saccharophagus degradans 2-40]
 gi|89952907|gb|ABD82922.1| hydroxymethylbilane synthase [Saccharophagus degradans 2-40]
          Length = 308

 Score =  270 bits (690), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 109/303 (35%), Positives = 170/303 (56%), Gaps = 2/303 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            K  RI TR S LAL  A + ++ L  ++  P   + + PL ++GD+I +  L ++GGKG
Sbjct: 1   MKKIRIATRKSELALWQANDVKAKLEALY--PSLEVELFPLVSRGDKILDVPLAKVGGKG 58

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L++ E D AVHS KD+P +  +GL+++  L RED RD ++S   ++L  L 
Sbjct: 59  LFVKELEHALLADEADIAVHSMKDVPMEFPEGLELAVILEREDPRDAWVSAGYENLDALP 118

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
              V+GTSSLRR++ +L  R DI+V   RG + TRL KL+  +  AI+LA AG+KRLK  
Sbjct: 119 AGGVVGTSSLRRQSQILARRPDITVKFLRGNVNTRLAKLDAGEYDAIILAAAGLKRLKFG 178

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I+  L+ E+  P+ GQGA+ IE    + +  +L++ ++H  T + V  ERA    L+G
Sbjct: 179 DRIRSYLSPEESLPAGGQGAVGIECRSADSETLKLLQALHHTITAEQVLAERAMNRRLEG 238

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  I  FA  + + L+  G+V   DG         G   D   +G + A+ +      
Sbjct: 239 GCQVPIGCFAVHQNNQLWLRGLVADPDGSKVIYDEMTGAAADGEKMGVELAEKLLAAGAD 298

Query: 303 NVF 305
            + 
Sbjct: 299 KIL 301


>gi|332559141|ref|ZP_08413463.1| porphobilinogen deaminase [Rhodobacter sphaeroides WS8N]
 gi|332276853|gb|EGJ22168.1| porphobilinogen deaminase [Rhodobacter sphaeroides WS8N]
          Length = 310

 Score =  270 bits (690), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 133/303 (43%), Positives = 184/303 (60%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P +IGTR SPLALA A+ETRS L     +P     I+ + T GD++ +R L EIGGKGLF
Sbjct: 7   PLKIGTRGSPLALAQAYETRSRLSAAFSLPEEAFEIVVIKTTGDKVLDRPLKEIGGKGLF 66

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T EIE+ L+SG ID AVHS KDMPT   +GL +  YLPRED RD FI+     L DL   
Sbjct: 67  TREIEEALLSGGIDIAVHSMKDMPTLQPEGLILDTYLPREDTRDAFITFADGGLADLPQG 126

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           + +G+SSLRR+A LL  R D+ V++FRG ++TRL KLN+  A    LA AG+ RLK ++V
Sbjct: 127 ATVGSSSLRRRAQLLNKRPDLQVVEFRGNLQTRLKKLNDGVARGTFLAMAGLNRLKMDEV 186

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
            +  +  E+   +  QGAI IE   ++P+AQE++  I+   T   +  ER+FL +LDGSC
Sbjct: 187 PRVPIEPEEMLSAVAQGAIGIERRTDDPRAQEMLAAIHDVRTGHRLAAERSFLLKLDGSC 246

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           ++ IAG A  +G  L+  G +L  DG         G   DA  +G + A  +   +  + 
Sbjct: 247 ETPIAGLAILEGDQLWLRGEILRPDGSESISGEIRGAIADAAALGSELASELLGRAPADF 306

Query: 305 FNF 307
           F++
Sbjct: 307 FSW 309


>gi|301155139|emb|CBW14603.1| hydroxymethylbilane synthase [Haemophilus parainfluenzae T3T1]
          Length = 310

 Score =  270 bits (690), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 106/302 (35%), Positives = 164/302 (54%), Gaps = 2/302 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  +I TR SPLAL  A   +  L   H  P  ++ ++P+ TKGD I +  L +IGGKGL
Sbjct: 5   KTLKIATRQSPLALWQANFVKDQLEKFH--PTLSVELVPMVTKGDVILDSPLAKIGGKGL 62

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+    D AVHS KD+P +  +GL +S    RED RD F+S+T +SL +L  
Sbjct: 63  FVKELENALLEKRADIAVHSMKDVPMEFPEGLGLSVICKREDPRDAFVSNTYRSLDELPQ 122

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            +++GTSSLRR+  L + R D+ +   RG + TRL+KL+N++  AI+LA AG+ RL   +
Sbjct: 123 GAIVGTSSLRRQCQLKQLRPDLDIRSLRGNVGTRLSKLDNSEYDAIILASAGLIRLGLAE 182

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I   + +E   P+ GQGA+ IE  V++ + + L+  ++   T   V  ERA    L G 
Sbjct: 183 RIASFIEVEQSLPAAGQGAVGIECRVDDEEVKALLAPLSDATTTTCVLAERAMNTRLQGG 242

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKN 303
           C+  I G+A  +   ++   +V  +DG             +A  +G   A+ +       
Sbjct: 243 CQVPIGGYAIEQNGEIFLRALVGEADGSAIIRAEGKSAVENAEALGVTIAEQLLAQGADK 302

Query: 304 VF 305
           + 
Sbjct: 303 IL 304


>gi|284053907|ref|ZP_06384117.1| porphobilinogen deaminase [Arthrospira platensis str. Paraca]
          Length = 322

 Score =  270 bits (690), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 105/307 (34%), Positives = 160/307 (52%), Gaps = 5/307 (1%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           + +  RI +R S LAL   +  +  L    + P     +  +ST+GD+I +  L +IG K
Sbjct: 8   QTRTIRIASRKSQLALVQTYWVQEELQK--RFPDIKFEVHTMSTQGDKILDVALAKIGDK 65

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFI---SHTAQSL 118
           GLFT+E+E  +++ + D AVHS KD+PT L +GL +     RED  D  +   +H  + L
Sbjct: 66  GLFTKELEVGMLNHDTDMAVHSLKDLPTNLPEGLMLGCVTEREDPADALVVHENHRDKQL 125

Query: 119 KDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR 178
             L   +V+GTSSLRR A L      +   D RG + TRL KL+  +  AI+LA AG+KR
Sbjct: 126 DTLPPGAVVGTSSLRRLAQLRHNFPHLEFKDIRGNLNTRLQKLDEGQYDAIILAVAGLKR 185

Query: 179 LKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLA 238
           L     I +++  E    + GQGA+ IE    + +  E+VK + H  T    + ERAFL 
Sbjct: 186 LGMADRIHQVIPAEISLHAVGQGALGIECREGDTEILEVVKALEHTATAQRCHSERAFLR 245

Query: 239 ELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRF 298
           EL+G C+  I      +G  L   G+V + DGK   + +  G   DA  +G + A  ++ 
Sbjct: 246 ELEGGCQVPIGVNTMVEGDRLTLTGMVASLDGKRLIKDTVTGQASDAEQLGIELANQLKQ 305

Query: 299 ISNKNVF 305
              + + 
Sbjct: 306 QGAEEIL 312


>gi|152997593|ref|YP_001342428.1| porphobilinogen deaminase [Marinomonas sp. MWYL1]
 gi|150838517|gb|ABR72493.1| porphobilinogen deaminase [Marinomonas sp. MWYL1]
          Length = 326

 Score =  270 bits (689), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 110/304 (36%), Positives = 169/304 (55%), Gaps = 2/304 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K    I TR S LAL  A   ++ L  ++  P   + ++ ++TKGD+I +  L++IGGKG
Sbjct: 19  KDKIVIATRESQLALWQANNIKAQLESLY--PDMKVELLGMTTKGDQILDSPLSKIGGKG 76

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L  G  D AVHS KD+P    +GL ++    RED  D F+S+  +SL  L 
Sbjct: 77  LFVKELENALTEGLADIAVHSMKDVPMAFPEGLGLAVICEREDPHDAFVSNKVESLDQLP 136

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +++GTSSLRR   L   R D+ + D RG + TRL K+++ +  AI+LA AG+ RL+  
Sbjct: 137 SGAIVGTSSLRRSCQLRMKRPDLIIKDLRGNVNTRLKKMDDGEYDAIILATAGLVRLEML 196

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I++ +  E   P+ GQGA+ IE   ++ +   L+  + HE+T   V  ERA    L+G
Sbjct: 197 DRIRQRIPAETSLPAGGQGAMGIECRSDDIQTINLLAPLQHEETAIRVTAERAVNERLNG 256

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C++ IA FA  +  TL+  G+V + DGK   E    G++ DA ++G   A  +      
Sbjct: 257 GCQAPIACFAILENDTLWLRGLVGSPDGKTMIEGEIRGHKDDAKSLGVQLADDLLARGAD 316

Query: 303 NVFN 306
            + N
Sbjct: 317 IILN 320


>gi|118592006|ref|ZP_01549400.1| porphobilinogen deaminase [Stappia aggregata IAM 12614]
 gi|118435302|gb|EAV41949.1| porphobilinogen deaminase [Stappia aggregata IAM 12614]
          Length = 303

 Score =  270 bits (689), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 143/299 (47%), Positives = 195/299 (65%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LALA A ETR  LM  H +   +  I+ + T GDRI +R L+E+GGKGLFT
Sbjct: 1   MRIGTRGSALALAQAHETRDRLMAAHGLAEDSFEIVVIKTSGDRIQDRPLSEVGGKGLFT 60

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ L+ G ID AVHS+KDMPT L  GL ++A+LPRED+RD F+S  A++L DL   +
Sbjct: 61  KEIEEALLDGRIDLAVHSSKDMPTVLPDGLALTAFLPREDVRDAFLSPKAKTLTDLPHGA 120

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+G+SSLRR+A++ R R DI V+ +RG ++TRL KL      A LLA AG++RL  E  I
Sbjct: 121 VVGSSSLRRQAMIKRLRPDIEVVMYRGNLQTRLRKLAEGAVDATLLAAAGLRRLGLEAEI 180

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
             +L  + F P+ GQGAICIE+  ++    E++  I+ E T   ++ ERAFLA LDGSC+
Sbjct: 181 TSLLETDQFLPAVGQGAICIESRADDTATLEMLAAIHDEATQIRLDAERAFLAVLDGSCR 240

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           + I G A   G TL+F GIVL  DG   HE + +G + DA+ IGR   + ++     + 
Sbjct: 241 TPIGGLATLDGDTLHFRGIVLKPDGSEVHEATASGLKSDAVQIGRSVGEDLKSCMGPDF 299


>gi|126463094|ref|YP_001044208.1| porphobilinogen deaminase [Rhodobacter sphaeroides ATCC 17029]
 gi|126104758|gb|ABN77436.1| porphobilinogen deaminase [Rhodobacter sphaeroides ATCC 17029]
          Length = 322

 Score =  270 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 133/303 (43%), Positives = 183/303 (60%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P +IGTR SPLALA A+ETRS L     +P     I+ + T GD++ +R L EIGGKGLF
Sbjct: 19  PLKIGTRGSPLALAQAYETRSRLSAAFSLPEEAFEIVVIKTTGDKVLDRPLKEIGGKGLF 78

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T EIE+ L+SG ID AVHS KDMPT   +GL +  YLPRED RD FI+     L DL   
Sbjct: 79  TREIEEALLSGGIDIAVHSMKDMPTLQPEGLILDTYLPREDTRDAFITFAEGGLADLPQG 138

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           + +G+SSLRR+A LL  R D+ V++FRG ++TRL KLN+  A    LA AG+ RLK  +V
Sbjct: 139 ATVGSSSLRRRAQLLNKRPDLQVVEFRGNLQTRLKKLNDGVARGTFLAMAGLNRLKMNEV 198

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
            +  +  E+   +  QGAI IE   ++P+AQE++  I+   T   +  ER+FL +LDGSC
Sbjct: 199 PRVPIEPEEMLSAVAQGAIGIERRTDDPRAQEMLAAIHDVPTGHRLAAERSFLLKLDGSC 258

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           ++ IAG A  +G  L+  G +L  DG         G   DA  +G + A  +   +  + 
Sbjct: 259 ETPIAGLAILEGDQLWLRGEILRPDGSESISGEIRGAIADAAALGVELASELLGRAPADF 318

Query: 305 FNF 307
           F++
Sbjct: 319 FSW 321


>gi|116750623|ref|YP_847310.1| porphobilinogen deaminase [Syntrophobacter fumaroxidans MPOB]
 gi|158512355|sp|A0LN73|HEM3_SYNFM RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|116699687|gb|ABK18875.1| hydroxymethylbilane synthase [Syntrophobacter fumaroxidans MPOB]
          Length = 309

 Score =  270 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 113/306 (36%), Positives = 171/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RIGTR S LAL  +   ++++  +   P   + +  + T GD+I +  L ++GG
Sbjct: 1   MTDRVIRIGTRGSMLALKQSGNVKAAMEAL--WPGLRVELQVVRTTGDKILDVPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE  L++  +D AVHS KD+P  L +GL+I A   RED RDV ++ T + + D
Sbjct: 59  KGLFVKEIEDALLARTVDLAVHSMKDVPAILPEGLEIGAIPKREDPRDVIVTRTGKGIAD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L +   +GTSSLRR + + + R DI + + RG IETRL KL      AI+LA AG+ R+ 
Sbjct: 119 LPMGGRVGTSSLRRASQIRKLRPDIEIANLRGNIETRLRKLTEGAFDAIILAAAGLHRMG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  +   L+  DF P+ GQGAI IE   ++ + +EL+  ++  DT  +V  ER+ L  L
Sbjct: 179 WQNRVTSYLDPADFLPAIGQGAIGIELRCDDGEVRELLAPLHDPDTHVAVEAERSLLRTL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I G A+    TL   G+V + DG+     SR G+   A  IGRD    +    
Sbjct: 239 EGGCQVPIGGHAHLVDGTLTLSGMVASIDGEELFRASRAGSPAQARKIGRDVGMELLDSG 298

Query: 301 NKNVFN 306
            + +  
Sbjct: 299 ARRILE 304


>gi|325272336|ref|ZP_08138739.1| porphobilinogen deaminase [Pseudomonas sp. TJI-51]
 gi|324102530|gb|EGB99973.1| porphobilinogen deaminase [Pseudomonas sp. TJI-51]
          Length = 313

 Score =  270 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 111/305 (36%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L +IGG
Sbjct: 1   MSTREIRIATRKSALALWQAEYVKARLEQAH--PELRVTLVPMVSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  E D AVHS KD+P    +GL +     RED RD F+S+   SL+ 
Sbjct: 59  KGLFVKELETALLDNEADIAVHSMKDVPMDFPEGLGLYCICEREDPRDAFVSNHFASLEA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSVVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    +     L+  ++H DT D V  ERA    L
Sbjct: 179 FEDRITATISVDDSLPAGGQGAVGIECRSADHAIHALLAPLHHHDTADRVVAERAMNKRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  L+  G+V    G           R  A  +G + A+++    
Sbjct: 239 NGGCQVPIACYAVLEGDQLWLRGLVGQPSGGTLLVADARAPRATAEALGVEVAEHLLGQG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AEAIL 303


>gi|189423573|ref|YP_001950750.1| porphobilinogen deaminase [Geobacter lovleyi SZ]
 gi|238058916|sp|B3E2H7|HEM3_GEOLS RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|189419832|gb|ACD94230.1| porphobilinogen deaminase [Geobacter lovleyi SZ]
          Length = 312

 Score =  270 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 115/306 (37%), Positives = 171/306 (55%), Gaps = 3/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RIGTR S LAL  A  T+S L   +  P   + ++ + T GD+I +  L ++GG
Sbjct: 1   MAPKRLRIGTRASQLALWQANWTKSELEARY--PGIQVELVKIKTMGDKILDVPLAQVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE+ ++ GEID AVHS KD+PT+  +GL +     RED RD FIS       +
Sbjct: 59  KGLFVKEIEEAMLRGEIDLAVHSMKDVPTEFPEGLGLVVTTKREDPRDAFISDKVTFS-E 117

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + IGTS+LRR+A LL+ R D+ ++  RG +ETR+ KL  +   A++LA AG+ RL 
Sbjct: 118 LRQGARIGTSALRRQAQLLKARPDLEMVIIRGNVETRIRKLKEDNLDAVILAAAGLNRLG 177

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
              V+ E+L+ +   P+ GQGA+ +E  +++    E +  +NH DT  +V  ERA L   
Sbjct: 178 FTDVVTELLDTDFSIPAIGQGALGLECRLDDNATIEALAFLNHADTAAAVAAERALLKRC 237

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA      G TL   G + + DGK       +G+  DA+ +G + A  +    
Sbjct: 238 EGGCQVPIAAHGTVSGDTLTLVGFIASVDGKQTVRDRISGSTADAVKLGTELADRLLAAG 297

Query: 301 NKNVFN 306
            K +  
Sbjct: 298 GKAILE 303


>gi|197116806|ref|YP_002137233.1| porphobilinogen deaminase [Geobacter bemidjiensis Bem]
 gi|226706286|sp|B5EBG8|HEM3_GEOBB RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|197086166|gb|ACH37437.1| hydroxymethylbilane synthase [Geobacter bemidjiensis Bem]
          Length = 318

 Score =  269 bits (688), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 111/305 (36%), Positives = 165/305 (54%), Gaps = 3/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RIGTR S LAL  A   +S L   +  P   + +  + T GD+I +  L ++GG
Sbjct: 1   MALKELRIGTRASQLALWQANWVKSELEKRY--PDMTVTLTKIKTIGDKILDVPLAQVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE+ ++ GEID AVHS KD+PT+  +GL +     RED RD  IS+  +   D
Sbjct: 59  KGLFVKEIEEAMLRGEIDIAVHSMKDVPTEFPEGLGLYCITEREDPRDAVISNGVKFA-D 117

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + IGTS+LRR+A LL+ R D+ ++  RG ++TR++KL      A++LA AG+ RL 
Sbjct: 118 LPQGARIGTSALRRQAQLLKVRPDLEMVIIRGNVQTRMDKLKTEGLDAVILAAAGLNRLG 177

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I E+L  +   P+ GQGA+ IE +++N   ++ +   N  DT  +V  ERA L   
Sbjct: 178 FADQITEMLPTDLSLPAIGQGALGIECNLSNQDVKDAISFFNSPDTSRAVRAERALLWRC 237

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA F    G  L   G + + DGK+  +    G   D   +G   A+ +    
Sbjct: 238 EGGCQVPIAAFGEVTGDQLKLTGFIASVDGKVSVKGVVTGPADDCEKLGVKLAEQLLSEG 297

Query: 301 NKNVF 305
              + 
Sbjct: 298 GHAIL 302


>gi|149204076|ref|ZP_01881044.1| porphobilinogen deaminase [Roseovarius sp. TM1035]
 gi|149142518|gb|EDM30563.1| porphobilinogen deaminase [Roseovarius sp. TM1035]
          Length = 315

 Score =  269 bits (688), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 133/303 (43%), Positives = 184/303 (60%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P +IGTR SPLALA AFETR+ L     +P     I+ + T GD+I +R L EIGGKGLF
Sbjct: 11  PLKIGTRGSPLALAQAFETRARLGAAFDLPEEAFEIVVIKTTGDQIIDRPLKEIGGKGLF 70

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T EIE+ +++G+ID AVHS KDMP    +GL +  YLPRED+RD F+S T  SL DL   
Sbjct: 71  TREIEQAMLTGDIDIAVHSMKDMPVLQPEGLLLDTYLPREDVRDAFVSPTVASLADLPAG 130

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           S++GTSSLRRKA +L     + V++FRG ++TRL KL +  A    LA AG+ RL + +V
Sbjct: 131 SLVGTSSLRRKAQVLVAYPHLEVVEFRGNVQTRLKKLEDGVAACTFLAMAGLNRLGRSEV 190

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
               ++ +   P+  QGAI IE   ++ +A E++  I+H++T   +  ERAFLA LDGSC
Sbjct: 191 ATCAIDADVMLPAVAQGAIGIERRADDTRAAEMLAAIHHKETGQRLVSERAFLAALDGSC 250

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           ++ IAG A   GSTL   G +L  DG       ++    D   +GR  A  +   +    
Sbjct: 251 ETPIAGLAELNGSTLRLRGEILRPDGSESLTDDQSAPIEDGAELGRAMAAKLLAQAGPGF 310

Query: 305 FNF 307
           F++
Sbjct: 311 FDW 313


>gi|326796191|ref|YP_004314011.1| porphobilinogen deaminase [Marinomonas mediterranea MMB-1]
 gi|326546955|gb|ADZ92175.1| Porphobilinogen deaminase [Marinomonas mediterranea MMB-1]
          Length = 308

 Score =  269 bits (687), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 168/305 (55%), Gaps = 2/305 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            K    I TR S LAL  A   +  L  ++  P   + ++ ++TKGD+I +  L++IGGK
Sbjct: 1   MKDKIVIATRESKLALWQANTVKKQLETLY--PNLTVELLGMTTKGDQILDSPLSKIGGK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  L+ G  D AVHS KD+P    KGL ++    RED  D F+S+   SL +L
Sbjct: 59  GLFVKELESALLDGRADIAVHSMKDVPMAFPKGLGLAVICEREDPSDAFVSNKYSSLDEL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              SV+GTSSLRR   + + R D+ +   RG + TRL KL+NN+  AI+LA AG+ RL+ 
Sbjct: 119 PKGSVLGTSSLRRACQIQQHRPDLKIESLRGNVGTRLGKLDNNEYDAIILATAGLIRLEL 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E  IK  L+     P+ GQGA+ IE   N+    EL+  + H+DT+  V  ERA    L+
Sbjct: 179 EDRIKSRLSDTYCLPAGGQGAMGIECRDNDKDILELLAPLQHQDTYYRVTAERAVNKRLN 238

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C++ IA FA      ++  G+V ++DG+        G   +A  +G   A+ +     
Sbjct: 239 GGCQAPIACFATLSDGEIWLRGLVGSTDGQQMITGDIKGAPQNAEQLGITLAEDLLNRGA 298

Query: 302 KNVFN 306
           + + +
Sbjct: 299 QRILD 303


>gi|86359485|ref|YP_471377.1| porphobilinogen deaminase [Rhizobium etli CFN 42]
 gi|86283587|gb|ABC92650.1| porphobilinogen deaminase protein [Rhizobium etli CFN 42]
          Length = 309

 Score =  269 bits (687), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 166/306 (54%), Positives = 216/306 (70%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KPFRIGTR SPLALA A E R  LM  H +      I+ L+TKGDRIT+R L EIGG
Sbjct: 1   MQTKPFRIGTRGSPLALAQAHEARDRLMAAHNLSEEMFEIVVLTTKGDRITDRPLAEIGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFTEE+E+KL+SGE+D AVHSAKDMPT L  GL +SAYLPREDIRD  +  TA  L D
Sbjct: 61  KGLFTEELEQKLVSGELDFAVHSAKDMPTHLPDGLHLSAYLPREDIRDAVVGRTAPKLID 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +G+SSLRR+AL+ R R DI+VI FRG +ETRL KL+  +  A LLA AG+KRL 
Sbjct: 121 LPHGATVGSSSLRRQALIRRMRPDINVITFRGSVETRLRKLDEGQVDATLLALAGLKRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           K +VI ++L+ + FPP+P QGAICIE+ V + K  +L+  +N   T+DSV+CERAFLA L
Sbjct: 181 KVEVITDVLDPDTFPPAPAQGAICIESRVGDTKIDDLLAAVNDATTFDSVSCERAFLAAL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ I G+A C+G  + F G+++  DG+  H V+ +G+R DA  +G  A Q +R  +
Sbjct: 241 DGSCRTPIGGYAVCEGDLIRFSGLIITPDGRSQHAVTTDGHRRDAAALGTRAGQDVRARA 300

Query: 301 NKNVFN 306
               F+
Sbjct: 301 GSAFFD 306


>gi|329898164|ref|ZP_08272361.1| Porphobilinogen deaminase [gamma proteobacterium IMCC3088]
 gi|328920873|gb|EGG28310.1| Porphobilinogen deaminase [gamma proteobacterium IMCC3088]
          Length = 307

 Score =  269 bits (687), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 106/301 (35%), Positives = 162/301 (53%), Gaps = 2/301 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
              I TR SPLAL  A   + +L   H  P   + ++ ++++GD++ +  L +IGGKGLF
Sbjct: 3   KIVIATRESPLALWQAHYVKDALEMAH--PGLAVELLGMTSRGDQLLDSPLAKIGGKGLF 60

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +E+E  L+ G  D AVHS KD+P    +GL +     RE   D F+S+T +S+  L   
Sbjct: 61  VKELETALLEGRADIAVHSMKDVPMSFPEGLCLGPICEREAPNDAFVSNTYESIDALPKG 120

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           +++GTSSLRR+  L  +R D+ V   RG + TRL KL++ +  AI+LA AG+     E  
Sbjct: 121 AIVGTSSLRRECQLRSYRPDLVVNFLRGNVNTRLAKLDDGQYDAIILAAAGLILFGFEDR 180

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I+  L  E   P+ GQGA+ IE   ++   ++L++V++H  T   V  ERA    L+G C
Sbjct: 181 IRSRLTPEQSLPAGGQGAVGIELRSDDEPTRDLIQVLHHPKTAAEVTAERALNQTLNGGC 240

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           +  IA F   +G TL+  G+V A DG         G   DA  +G+  A  +     + +
Sbjct: 241 QVPIAAFCVTEGDTLWLRGLVGAVDGSSILRAEARGKVEDAEVLGQQVANELLNQGAEAI 300

Query: 305 F 305
            
Sbjct: 301 L 301


>gi|85705298|ref|ZP_01036397.1| porphobilinogen deaminase [Roseovarius sp. 217]
 gi|85670171|gb|EAQ25033.1| porphobilinogen deaminase [Roseovarius sp. 217]
          Length = 315

 Score =  269 bits (687), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 134/313 (42%), Positives = 186/313 (59%), Gaps = 6/313 (1%)

Query: 1   MEKK------PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRT 54
           M +       P +IGTR SPLALA AFETR+ L     +P     I+ + T GD+I +R 
Sbjct: 1   MTRNLPTPSHPLKIGTRGSPLALAQAFETRARLGAAFDLPEEVFEIVVIKTTGDQIIDRP 60

Query: 55  LTEIGGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHT 114
           L EIGGKGLFT EIE+ L++GEID AVHS KDMP    +GL +  YLPRED+RD F+S  
Sbjct: 61  LKEIGGKGLFTREIEQALLTGEIDIAVHSMKDMPVLQPEGLLLDTYLPREDVRDAFVSPL 120

Query: 115 AQSLKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYA 174
             SL DL   +++GTSSLRRKA +L     + V++FRG ++TRL KL +  A    LA A
Sbjct: 121 VGSLADLPAGALVGTSSLRRKAQVLVAYPHLQVVEFRGNVQTRLKKLADGVATCTFLAMA 180

Query: 175 GIKRLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCER 234
           G+ RL + +V    ++ E   P+  QGAI IE   ++ +A E++  I+H++T   +  ER
Sbjct: 181 GLNRLGRSEVATGAIDPEVMLPAVAQGAIGIERRADDTRAAEMLAAIHHKETGQRLVSER 240

Query: 235 AFLAELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQ 294
           AFLA LDGSC++ IAG A   G+TL   G +L  DG       ++    D  ++GR  A 
Sbjct: 241 AFLAALDGSCETPIAGLAELNGNTLRLRGEILRPDGSESLTDDQSAPIEDGADLGRAMAA 300

Query: 295 YIRFISNKNVFNF 307
            +   +    F++
Sbjct: 301 KLLAQAGPGFFDW 313


>gi|328541997|ref|YP_004302106.1| Porphobilinogen deaminase [polymorphum gilvum SL003B-26A1]
 gi|326411747|gb|ADZ68810.1| Porphobilinogen deaminase [Polymorphum gilvum SL003B-26A1]
          Length = 302

 Score =  268 bits (686), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 143/300 (47%), Positives = 193/300 (64%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LALA A ETR+ LM  H +      I+ + T GDRI +R L+E+GGKGLFT
Sbjct: 1   MRIGTRGSALALAQAHETRARLMAAHGLAEDAFEIVVIKTSGDRILDRPLSEVGGKGLFT 60

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ L+   ID AVHS+KDMPT L  GL ++A+LPRED+RD F+S  A+ L DL   +
Sbjct: 61  KEIEEALLDDRIDLAVHSSKDMPTLLPDGLALTAFLPREDVRDAFVSPKAKMLMDLPQGA 120

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+G+SSLRR+A++ R R DI V+ +RG ++TRL KL +    A LLAYAG++RL    V+
Sbjct: 121 VVGSSSLRRQAMIKRLRPDIEVVMYRGNVQTRLQKLEDGAVDATLLAYAGLRRLGLADVV 180

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
             +L+ + F P+ GQGAICIE+ V +     L+  I+  +T   +  ERAFLAELDGSC+
Sbjct: 181 TSLLDTDAFLPAVGQGAICIESRVEDAATLGLLAAIHDRETEIRLTAERAFLAELDGSCR 240

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
           + I G A   G  L   GI+L  DG   HE++R G   DA  IGR+A + ++       F
Sbjct: 241 TPIGGLARIDGDRLSLAGIILRPDGSEAHEIAREGAVADAEAIGREAGRTLKAAGGPGFF 300


>gi|163782608|ref|ZP_02177605.1| porphobilinogen deaminase [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882181|gb|EDP75688.1| porphobilinogen deaminase [Hydrogenivirga sp. 128-5-R1-1]
          Length = 303

 Score =  268 bits (686), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 111/300 (37%), Positives = 165/300 (55%), Gaps = 5/300 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LAL  A   +S L          + ++ ++T GD+I +  L +IGGKGLF 
Sbjct: 3   VRIGTRKSKLALWQANFVKSFLEKKW---GVEVELVKITTTGDKILDSPLAKIGGKGLFV 59

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ L+ G ID AVHS KD+P  + +GL + A   RE+  DV +S     L +L   +
Sbjct: 60  KEIEQALMEGRIDLAVHSLKDVPMVIPEGLTLGAITEREEPHDVLLSRDGGKLLELREGA 119

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+  L R R D+ V   RG ++TR+ KL      AI+LAYAG+KR+  E  +
Sbjct: 120 KVGTSSLRRQVQLKRLRRDLEVEVLRGNVDTRVRKLKEGMYDAIILAYAGVKRMGYEDEV 179

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            E+  ++ F P+ GQG++ IE    + +   L++ +NH ++     CERAFL  L+G C+
Sbjct: 180 TEV--LDYFIPAVGQGSLAIEIREGDEETLRLIEPLNHPESRVRAECERAFLRRLEGGCQ 237

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             I  FA  KG+TL   G +   +G  F E    G   +A  +G   A+ +     + + 
Sbjct: 238 VPIGAFAQVKGNTLTVRGFISDLEGLKFIEGEEVGKPEEASELGERLAESLLQQGGERIL 297


>gi|75910970|ref|YP_325266.1| porphobilinogen deaminase [Anabaena variabilis ATCC 29413]
 gi|75704695|gb|ABA24371.1| hydroxymethylbilane synthase [Anabaena variabilis ATCC 29413]
          Length = 336

 Score =  268 bits (685), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 110/307 (35%), Positives = 165/307 (53%), Gaps = 5/307 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           ++  RIG+R S LAL   +  R  L   +  P  N  +  +ST+GD+I +  L +IG KG
Sbjct: 22  RRTIRIGSRKSQLALVQTYWVREQLQ--NSFPDINFEVHTMSTQGDKILDVALAKIGDKG 79

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTA---QSLK 119
           LFT+E+E  +I+ EID AVHS KD+PT L +GL ++A   RE+  D  + H     + + 
Sbjct: 80  LFTKELEVGMINEEIDFAVHSLKDLPTNLPEGLALAAITERENPADALVVHENFKDKQID 139

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
            L   +VIGTSSLRR A L      ++  D RG + TRL KL+  +   ++LA AG++RL
Sbjct: 140 TLPAGAVIGTSSLRRLAQLRNQFPHLTFKDVRGNLNTRLAKLDAGEYDGLILAAAGLQRL 199

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
                I ++L  E    + GQGA+ IE   N+ +   ++K I H  T D    ER+FL  
Sbjct: 200 GMGDRIHQVLPKEVSLHAVGQGALGIECRANDAELITILKAIEHPQTRDRCLAERSFLRS 259

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I       G  L   G+V + DG+   + + +G+  DA  IG   A+ +R  
Sbjct: 260 LEGGCQVPIGVNTEINGDELILTGVVASVDGQNLVKDTVSGDASDAEAIGIRLAELLREQ 319

Query: 300 SNKNVFN 306
             + + N
Sbjct: 320 GAQEILN 326


>gi|83952840|ref|ZP_00961570.1| porphobilinogen deaminase [Roseovarius nubinhibens ISM]
 gi|83835975|gb|EAP75274.1| porphobilinogen deaminase [Roseovarius nubinhibens ISM]
          Length = 304

 Score =  268 bits (685), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 131/302 (43%), Positives = 183/302 (60%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            +IGTR SPLALA A+ETR  L+    +P     I+ ++T GDR+ +R L EIGGKGLFT
Sbjct: 1   MKIGTRGSPLALAQAYETRDRLVAAFDLPETAFEIVIITTTGDRVIDRPLKEIGGKGLFT 60

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
            EIE  L++G+ID AVHS KDMP    +GL I  YLPRED+RD FI  T ++L ++A  +
Sbjct: 61  REIEDALLTGDIDLAVHSMKDMPVLQPEGLIIDCYLPREDVRDAFICPTGRNLSEMAPGT 120

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +G+SSLRR+A +L     + V++FRG ++TRL KL+   A    LA AG+ RLK+ +VI
Sbjct: 121 KVGSSSLRRRAQVLVAHPQLEVVEFRGNVQTRLRKLDEGVAACTFLAMAGLNRLKRTEVI 180

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              L  E+  P+  QGAI IE   ++  A  +++ I+H  T   +  ERAFLA LDGSC+
Sbjct: 181 TRALEPEEMLPAVAQGAIGIERRRDDSGAAMMLEAIHHGPTGQRLAAERAFLAALDGSCE 240

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
           + IAG A  +G TL   G +L  DG       R+    D   +GR  A  +   +  + F
Sbjct: 241 TPIAGLAELQGGTLRLRGEILRPDGSERLCDDRSAPVEDGAELGRAMAVDLLAQAGPDFF 300

Query: 306 NF 307
           ++
Sbjct: 301 DW 302


>gi|15605804|ref|NP_213181.1| porphobilinogen deaminase [Aquifex aeolicus VF5]
 gi|2982966|gb|AAC06580.1| porphobilinogen deaminase [Aquifex aeolicus VF5]
          Length = 323

 Score =  268 bits (685), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 113/301 (37%), Positives = 171/301 (56%), Gaps = 5/301 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
             RIGTR S LAL  A   +  L          + ++ ++T GD+IT+  L +IGGKGLF
Sbjct: 21  KIRIGTRKSKLALWQANYVKDFLEKHW---GVEVELVKITTTGDKITDVPLAKIGGKGLF 77

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +EIEK L+ G ID AVHS KD+P  + KGL++ A   RE+  DV IS + + L +L   
Sbjct: 78  VKEIEKALLEGSIDLAVHSLKDVPMVIPKGLKLGAITKRENPYDVLISRSGKKLYELPSG 137

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           SVIGTSSLRR+  + + R D+ V   RG ++TR+ KL      A++LAYAG+KR+  E  
Sbjct: 138 SVIGTSSLRRQVQIKKRRRDLKVEVLRGNVDTRMRKLKEGLYDAVILAYAGVKRMGYESE 197

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I E+  +EDF P+ GQG++ IE    + + +EL+K +N+E+++     ER FL  L+G C
Sbjct: 198 ITEV--LEDFIPAVGQGSLAIEIREGDKRIEELIKPLNNEESFLCAIAERTFLRRLEGGC 255

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           +  +  FA  +  TL     +   + + + E  R GN  +A  +G   A+ +     + +
Sbjct: 256 QVPVGAFAKIENGTLKMKAFISDIEAERYIEGYREGNPEEAEKLGLSLAEELLKKGGEEI 315

Query: 305 F 305
            
Sbjct: 316 L 316


>gi|262370151|ref|ZP_06063478.1| porphobilinogen deaminase [Acinetobacter johnsonii SH046]
 gi|262315190|gb|EEY96230.1| porphobilinogen deaminase [Acinetobacter johnsonii SH046]
          Length = 306

 Score =  268 bits (685), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 112/303 (36%), Positives = 168/303 (55%), Gaps = 2/303 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            K  +I TR SPLAL  A   R+ L  +H      + ++   T+GD+I +  L +IGGKG
Sbjct: 1   MKTLKIATRQSPLALWQAEHIRARLEALHA--GLTVELVTFVTQGDKILDTPLAKIGGKG 58

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S++  S   L 
Sbjct: 59  LFVKELEAALLDGRADLAVHSMKDVPMALPEGLSLAVICEREDPLDAFVSNSYVSFDALP 118

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRRK  +L+ R D+ +ID RG + TRL+KL+  +  AI+LA AG+KRL   
Sbjct: 119 QGAKVGTSSLRRKCQILKQRPDLDIIDLRGNVGTRLSKLDAGQYDAIILASAGLKRLGLA 178

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I   +  E   P+ GQGA+ +E   N+    +L+  + H DT   V  ERAF A L+G
Sbjct: 179 ERICHTIRPELSLPAVGQGALGLECRANDQAVLDLIHPLLHIDTDTCVRAERAFNAYLEG 238

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  IAG+A    + +   G V + DG+   +    G+  +A ++G   AQ +      
Sbjct: 239 GCQVPIAGYATLADNRIQLEGRVGSVDGQTLLKAQVAGDAAEAEHLGVVLAQELLAQGAG 298

Query: 303 NVF 305
           ++ 
Sbjct: 299 DLL 301


>gi|110635531|ref|YP_675739.1| porphobilinogen deaminase [Mesorhizobium sp. BNC1]
 gi|110286515|gb|ABG64574.1| hydroxymethylbilane synthase [Chelativorans sp. BNC1]
          Length = 309

 Score =  268 bits (685), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 153/306 (50%), Positives = 203/306 (66%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+    +IGTR S LALA A ETR+ LM  H +P     I+ + T GDRI +R L+E GG
Sbjct: 1   MQTDVIKIGTRGSALALAQAAETRARLMVAHGLPEDAFEIVVIRTSGDRIQDRPLSEAGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ L+ G ID AVHS+KDMPT L  GL++SA+L RED+RDVFI   A+ L+D
Sbjct: 61  KGLFTKEIEEALLEGRIDLAVHSSKDMPTFLPDGLELSAFLEREDVRDVFIGRAAKRLED 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +GTSSLRR+AL LR R D+ V  FRG ++TRL KL +  A   LLA AG+KRLK
Sbjct: 121 LPHGANLGTSSLRRQALALRLRPDLKVGVFRGNVQTRLRKLEDGAADGTLLALAGLKRLK 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E V  E+++   FPP+ GQGAICIE+   + +  +LV+ I+H  T  +++CERAFLA L
Sbjct: 181 LEHVATELMDPVIFPPALGQGAICIESRTGDTRIAKLVEAIHHPATGFALSCERAFLAAL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ +AG A   G  + F G++L  DG+  HE+  +G   DA  IGRDA + IR  +
Sbjct: 241 DGSCRTPMAGLATVDGDRIAFSGMILTPDGREVHEIGGDGAAQDAAEIGRDAGRRIRQKA 300

Query: 301 NKNVFN 306
               F 
Sbjct: 301 GAGFFE 306


>gi|238897905|ref|YP_002923584.1| hydroxymethylbilane synthase (porphobilinogen deaminase)
           [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
 gi|259647800|sp|C4K4E3|HEM3_HAMD5 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|229465662|gb|ACQ67436.1| hydroxymethylbilane synthase (porphobilinogen deaminase)
           [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
          Length = 309

 Score =  268 bits (684), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 163/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     R+ TR SPLAL  A   ++ L   H  P   ++++P+ T+GD I    L++ GG
Sbjct: 1   MSNNMIRLATRQSPLALWQAHYVKTGLEFFH--PDLKVILLPMVTQGDNILGTALSKTGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ ++    D AVHS KDMP    +GL + A   RED RD F+S     +  
Sbjct: 59  KGLFVKELERAVLDNRADIAVHSIKDMPLYFPEGLGLVAVCEREDPRDAFLSLRYHDVAQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L +    I V D RG +  RL KL+     AI+LA AG+KRL 
Sbjct: 119 LPEGSVVGTSSLRRQCQLYKNYPGIVVRDLRGNVGARLKKLDQGDYDAIVLAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  + +IL  E   P+ GQGAI IE  +++    + V  +NH  +   ++CERA L  L
Sbjct: 179 LENRMTQILRPETSLPAAGQGAIGIECRLDDTVTLQRVATLNHRPSQLKISCERALLKRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C++ I  +A  +   L+    V A DG++  +  R GN   A  IG + A  +    
Sbjct: 239 EGGCQTPIGSYAEIENDELWLRAFVGAPDGQLIIDGERRGNFDSAEKIGFELANELLSRG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AEAIL 303


>gi|163737211|ref|ZP_02144629.1| porphobilinogen deaminase [Phaeobacter gallaeciensis BS107]
 gi|161389815|gb|EDQ14166.1| porphobilinogen deaminase [Phaeobacter gallaeciensis BS107]
          Length = 320

 Score =  268 bits (684), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 128/307 (41%), Positives = 180/307 (58%), Gaps = 4/307 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGD----RITNRTLTEIGG 60
           P +IGTR SPLALA A ETR+ L+    +P     I+ + T GD       ++ L E+GG
Sbjct: 12  PLKIGTRGSPLALAQAHETRARLVAAFDLPQDAFEIVVIKTSGDNQALIAADKPLKELGG 71

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ L+SG ID AVHS KDMP     GL +  YLPRED+RD F+S    ++ D
Sbjct: 72  KGLFTKEIEEDLLSGAIDIAVHSMKDMPVAQPAGLLLDTYLPREDVRDAFVSPDVTAITD 131

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+A LL  R D+ V++FRG ++TRL KL +  A    LA AG+ RL 
Sbjct: 132 LRAGAVVGTSSLRRRAQLLHRRPDLQVVEFRGNVQTRLTKLRDGVAECTFLAMAGLNRLG 191

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            ++V    +  ED  P+  QGAI IE   ++ +  +++  ++  +T + +  ERAFLA L
Sbjct: 192 ADQVPATPIPPEDMLPAVAQGAIGIERRADDSRTGDMLAALHDRETGERLAAERAFLAAL 251

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG A  +G TL   G VL  DG       +     D   +GR+ A  +   +
Sbjct: 252 DGSCETPIAGLATLEGRTLRLRGEVLRPDGSEAISDEQTCPVEDGAELGREMAAKLLAQA 311

Query: 301 NKNVFNF 307
               F++
Sbjct: 312 GAGFFDW 318


>gi|84500376|ref|ZP_00998625.1| porphobilinogen deaminase [Oceanicola batsensis HTCC2597]
 gi|84391329|gb|EAQ03661.1| porphobilinogen deaminase [Oceanicola batsensis HTCC2597]
          Length = 315

 Score =  268 bits (684), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 127/304 (41%), Positives = 177/304 (58%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +P +IGTR SPLALA A E R  L     +PP    +  + T GDR+ +R L EIGGKGL
Sbjct: 10  RPLKIGTRGSPLALAQAHEARDRLAHAFDLPPEAFEVCVIQTTGDRVQDRPLKEIGGKGL 69

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT EIE  L++G ID AVHS KDMP    +GL +  YLPRED RD F+S+  + L  +  
Sbjct: 70  FTREIEHALLTGGIDIAVHSMKDMPVLQPEGLLLDCYLPREDPRDAFVSNLYERLDQIPA 129

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +GTSSLRR+A +L  R D+ V++FRG ++TRL KL +  A A  LA AG+ RL +  
Sbjct: 130 GARVGTSSLRRRAQVLVRRPDLEVVEFRGNVQTRLRKLADGVASATFLAMAGLNRLDRAS 189

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
           + +  L  ++  P+  QGAI IE   ++     L++ I+  +T   +  ERAFLA LDGS
Sbjct: 190 IARSALATDEMLPAVAQGAIGIERREDDHATAALLEAIHDPETARQLAAERAFLAALDGS 249

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKN 303
           C++ IAG A  +G TL   G +L  DG    +  R+    D   +GR+    +   +   
Sbjct: 250 CETPIAGLADLEGGTLRLRGEILRPDGSEALKDDRSAPVEDGAKLGREMGAALLAQAGDG 309

Query: 304 VFNF 307
            F+F
Sbjct: 310 FFDF 313


>gi|121535332|ref|ZP_01667145.1| porphobilinogen deaminase [Thermosinus carboxydivorans Nor1]
 gi|121306118|gb|EAX47047.1| porphobilinogen deaminase [Thermosinus carboxydivorans Nor1]
          Length = 317

 Score =  268 bits (684), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 117/304 (38%), Positives = 167/304 (54%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            K    IGTR S LAL  A      L   H  P   + I  + T GD+I +  L +IGGK
Sbjct: 1   MKNKLVIGTRGSKLALWQANYIAHRLCQYH--PGLEVTIKHIVTTGDKILDVPLAKIGGK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           G+FT+EIE  ++ GEID AVHS KDMPT+L  GL ++A   RE+  D  IS    +L  L
Sbjct: 59  GVFTKEIELAMLRGEIDLAVHSLKDMPTELPPGLTLAAITEREEPFDALISPKYGTLDKL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              + +GTSSLRR+A LL  R D++V D RG ++TRL KL   +  AI+LA AG+KRL  
Sbjct: 119 PHGAKVGTSSLRRRAQLLNCRPDLTVCDLRGNVDTRLRKLETEELDAIVLAQAGLKRLGW 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           +  I + L  +   P+ GQGA+ +ET  ++ +   LV  ++ EDT  +V  ER+FL EL+
Sbjct: 179 DDRITQQLPPDICLPAVGQGALALETRSDDSEVLALVAFLHDEDTAAAVTAERSFLNELE 238

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I  +   +   L     +L+ DG    +    G    A ++GR  AQ++     
Sbjct: 239 GGCQVPIGVYGRVENGELVLDAAILSLDGAAALKDRICGAPAAAEDLGRKLAQHMYVTGG 298

Query: 302 KNVF 305
           + + 
Sbjct: 299 REIL 302


>gi|56476047|ref|YP_157636.1| porphobilinogen deaminase [Aromatoleum aromaticum EbN1]
 gi|56312090|emb|CAI06735.1| Porphobilinogen deaminase [Aromatoleum aromaticum EbN1]
          Length = 314

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 101/300 (33%), Positives = 153/300 (51%), Gaps = 2/300 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
             I TR S LAL  A   ++ L  ++  P   + ++ ++T+GD+I +R L ++GGKGLF 
Sbjct: 13  LVIATRESRLALWQAEHVKARLEALY--PGCRVELLGMTTRGDQILDRPLAKVGGKGLFV 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +L +   +     RE   D F+S    SL D+   +
Sbjct: 71  KELEAALLEERADIAVHSMKDVPMQLAEPFALPCISAREVPLDAFVSPRYASLADMPPGT 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+GTSSLRR++ L      ++V   RG ++TRL KL+  +  AI+LA AG++RL     I
Sbjct: 131 VVGTSSLRRESQLHAQFPFLAVTSLRGNLDTRLRKLDEGQYDAIILAAAGLRRLGLADRI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE           +  +N  DT   V  ERA    L GSC+
Sbjct: 191 RAELPSEVSLPAAGQGALGIECLAKRTDIAAWLAPLNDADTSACVRAERAVARALAGSCE 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             +  +A  +   L+  G V   DG       R G+  DA  +G   A  +R    +++ 
Sbjct: 251 VPLGAYAEIRAGRLWLRGFVALPDGSRMVRAEREGDAADAEGLGLALADDLRAQGAEDIL 310


>gi|50083560|ref|YP_045070.1| porphobilinogen deaminase [Acinetobacter sp. ADP1]
 gi|55976395|sp|Q6FFA9|HEM3_ACIAD RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|49529536|emb|CAG67248.1| porphobilinogen deaminase (PBG) (Hydroxymethylbilane synthase)
           (HMBS) (Pre-uroporphyrinogen synthase) [Acinetobacter
           sp. ADP1]
          Length = 311

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 115/303 (37%), Positives = 166/303 (54%), Gaps = 2/303 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            +  +I TR SPLAL  A   R  L  ++  P   + ++   T+GD+I +  L +IGGKG
Sbjct: 6   MQTLKIATRQSPLALWQAEHIRDRLQALY--PELKVELVKFVTQGDKILDTPLAKIGGKG 63

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+   S   L 
Sbjct: 64  LFVKELEAALLDGRADLAVHSMKDVPMHLPEGLSLAVICEREDPLDAFVSNHVMSFDQLP 123

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
           L + +GTSSLRRK  +L+ R D+ +ID RG + TRL KL++ +  AI+LA AG+KRL   
Sbjct: 124 LGARVGTSSLRRKCQILKQRPDLEIIDLRGNVGTRLAKLDDGQYDAIVLASAGLKRLGLI 183

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I+  +N E   P+ GQGA+ +E   N+ K  +L+  + H+ T   V  ERAF A L+G
Sbjct: 184 SRIRHSINAEISLPAVGQGALGLECRANDKKILDLIAPLAHQPTSACVRAERAFNAYLEG 243

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  IAGFA      L   G V + DGK   +    G+   A  +G   A+ +      
Sbjct: 244 GCQVPIAGFATLTQECLTLEGRVGSVDGKTLLKDHVEGHADQAEVLGVQLAKQLLAQGAG 303

Query: 303 NVF 305
            + 
Sbjct: 304 ELL 306


>gi|170719443|ref|YP_001747131.1| porphobilinogen deaminase [Pseudomonas putida W619]
 gi|229836111|sp|B1J1V2|HEM3_PSEPW RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|169757446|gb|ACA70762.1| porphobilinogen deaminase [Pseudomonas putida W619]
          Length = 313

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 110/305 (36%), Positives = 163/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L +IGG
Sbjct: 1   MSTREIRIATRKSALALWQAEYVKARLEQAH--PGLLVTLVPMVSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  E D AVHS KD+P    +GL +     RED RD F+S+   SL  
Sbjct: 59  KGLFVKELETALLDNEADIAVHSMKDVPMDFPEGLGLYCICEREDPRDAFVSNRFSSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I   ++++D  P+ GQGA+ IE    + +   L+  ++H DT D V  ERA    L
Sbjct: 179 FEERITASISVDDSLPAGGQGAVGIECRSADSEIHALLAPLHHTDTADRVVAERALNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  L+  G+V    G           R  A  +G   A+ +    
Sbjct: 239 NGGCQVPIACYAVLEGEQLWLRGLVGQPSGGTLLMADARAPRASAETLGVQVAEDLLGQG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 AAAIL 303


>gi|332284596|ref|YP_004416507.1| porphobilinogen deaminase [Pusillimonas sp. T7-7]
 gi|330428549|gb|AEC19883.1| porphobilinogen deaminase [Pusillimonas sp. T7-7]
          Length = 315

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 109/302 (36%), Positives = 161/302 (53%), Gaps = 2/302 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
              I TR S LAL  A   R  L  ++  P   + ++ ++T+GD+I +R+L+++GGKGLF
Sbjct: 7   KLVIATRASRLALWQAEHVRDRLQTLY--PQCQVSLLTMTTRGDQILDRSLSKVGGKGLF 64

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +E+E  L+ G  D AVHS KD+P  +     +S  L R+D RD F+S+   SL DL   
Sbjct: 65  VKELETALLDGRADLAVHSLKDVPVDMQSPFALSVILERDDPRDAFVSNDYSSLDDLPAG 124

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           SV+GTSSLRR+A + +    + V   RG ++TRL KL+     AI+LA AG++RL  E  
Sbjct: 125 SVVGTSSLRREAQIRQRYPQLQVQPLRGNLDTRLGKLDRGDYAAIILASAGLRRLGLEAR 184

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I+  LN E   P+ GQGA+ IE   +    Q  +  ++  DT      ERA    L GSC
Sbjct: 185 IRSHLNPEQSLPAAGQGALGIEILESRSDMQTWLAPLSDPDTTACALAERAVSRVLGGSC 244

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           +  +A FA   G+TL   G+V   DG        +G+   A  +G   A  +     + +
Sbjct: 245 QVPLAAFAQRDGNTLMVRGLVAEPDGSRIIRAQVSGDVSQAEELGVRIANELLEEGARII 304

Query: 305 FN 306
            +
Sbjct: 305 LD 306


>gi|87118400|ref|ZP_01074299.1| porphobilinogen deaminase [Marinomonas sp. MED121]
 gi|86166034|gb|EAQ67300.1| porphobilinogen deaminase [Marinomonas sp. MED121]
          Length = 308

 Score =  267 bits (683), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 112/304 (36%), Positives = 170/304 (55%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            K    I TR S LAL  A   + SL  ++  P   + ++ ++TKGD+I N  L++IGGK
Sbjct: 1   MKDKIIIATRESQLALWQANNVKDSLAALY--PDIQVELLGMTTKGDQILNSPLSKIGGK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  L+ G  D AVHS KD+P    +GL ++    RED  D F+S+   +L  L
Sbjct: 59  GLFVKELEHALLDGRADIAVHSMKDVPMAFPEGLGLAVICEREDPTDAFVSNKYDNLASL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GTSSLRR + L   R D+ + D RG + TRL KL+N +  AI+LA AG+ RL+ 
Sbjct: 119 PQGAVVGTSSLRRSSQLALARPDLVIKDLRGNVNTRLRKLDNQEYDAIILATAGLMRLEM 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
              IKE ++ +D  P+ GQGA+ IE   ++    +L+  + H++T+  V  ERA    L+
Sbjct: 179 TDRIKERISDQDSLPAGGQGAMGIECRSDDADMIKLLAPLQHQETYYRVTAERAVNERLN 238

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C++ IA F+  +G  LY  G+V + DG         G++ DA  +G   A+ +     
Sbjct: 239 GGCQAPIAAFSLLEGDELYLRGLVGSVDGSTILRDEIRGSKNDAHALGVQLAEKLIAAGA 298

Query: 302 KNVF 305
             + 
Sbjct: 299 DTLL 302


>gi|17229370|ref|NP_485918.1| porphobilinogen deaminase [Nostoc sp. PCC 7120]
 gi|17130968|dbj|BAB73577.1| porphobilinogen deaminase [Nostoc sp. PCC 7120]
          Length = 336

 Score =  267 bits (683), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 110/307 (35%), Positives = 167/307 (54%), Gaps = 5/307 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           ++  RIG+R S LAL   +  R  L   +  P  N  +  +ST+GD+I +  L +IG KG
Sbjct: 22  RRTIRIGSRKSQLALVQTYWVREQLQ--NSFPDINFEVHTMSTQGDKILDVALAKIGDKG 79

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTA---QSLK 119
           LFT+E+E  +I+ EID AVHS KD+PT L +GL ++A   RE+  D  + H     + + 
Sbjct: 80  LFTKELEVGMINEEIDFAVHSLKDLPTNLPEGLALAAITERENPADALVVHENFKDKQID 139

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
            L   +VIGTSSLRR A L      ++  D RG + TRL KL+  +   ++LA AG++RL
Sbjct: 140 TLPAGAVIGTSSLRRLAQLRNQFPHLTFKDVRGNLNTRLAKLDAGEYDGLILAAAGLQRL 199

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
                + +IL  E    + GQGA+ IE   ++ +   ++K I H +T D    ER+FL  
Sbjct: 200 GMGDRVHQILPKEISLHAVGQGALGIECRADDAELITVLKAIEHPETRDRCLAERSFLRS 259

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I       G+ L   G+V + DG+   + + +GN  DA  IG   A+ +R  
Sbjct: 260 LEGGCQVPIGVNTEINGNELILTGVVASVDGQNLVKDTVSGNASDAEAIGIRLAELLREQ 319

Query: 300 SNKNVFN 306
             + + N
Sbjct: 320 GAQEILN 326


>gi|77464252|ref|YP_353756.1| porphobilinogen deaminase [Rhodobacter sphaeroides 2.4.1]
 gi|77388670|gb|ABA79855.1| Porphobilinogen deaminase [Rhodobacter sphaeroides 2.4.1]
          Length = 314

 Score =  267 bits (682), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 133/303 (43%), Positives = 183/303 (60%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P +IGTR SPLALA A+ETRS L     +P     I+ + T GD++ +R L EIGGKGLF
Sbjct: 11  PLKIGTRGSPLALAQAYETRSRLSAAFSLPEEAFEIVVIKTTGDKVLDRPLKEIGGKGLF 70

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T EIE+ L+SG ID AVHS KDMPT   +GL +  YLPRED RD FI+     L DL   
Sbjct: 71  TREIEEALLSGGIDIAVHSMKDMPTLQPEGLILDTYLPREDTRDAFITFAEGGLADLPQG 130

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           + +G+SSLRR+A LL  R D+ V++FRG ++TRL KLN+  A    LA AG+ RLK  +V
Sbjct: 131 ATVGSSSLRRRAQLLNKRPDLQVVEFRGNLQTRLKKLNDGVARGTFLAMAGLNRLKMNEV 190

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
            +  +  E+   +  QGAI IE   ++P+AQE++  I+   T   +  ER+FL +LDGSC
Sbjct: 191 PRVPIESEEMLSAVAQGAIGIERRTDDPRAQEMLAAIHDVPTGHRLAAERSFLLKLDGSC 250

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           ++ IAG A  +G  L+  G +L  DG         G   DA  +G + A  +   +  + 
Sbjct: 251 ETPIAGLAILEGDQLWLRGEILRPDGSESISGEIRGAIADAAALGSELASELLGRAPADF 310

Query: 305 FNF 307
           F++
Sbjct: 311 FSW 313


>gi|77920653|ref|YP_358468.1| porphobilinogen deaminase [Pelobacter carbinolicus DSM 2380]
 gi|123756552|sp|Q3A009|HEM3_PELCD RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|77546736|gb|ABA90298.1| hydroxymethylbilane synthase [Pelobacter carbinolicus DSM 2380]
          Length = 315

 Score =  267 bits (682), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 167/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RIGTR S LAL  A   +  L  +H  P  ++V++P++TKGD+I +  L ++GG
Sbjct: 1   MSSSALRIGTRASRLALWQAEWVQQQLETLH--PGLSVVLVPITTKGDKILDVPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE+ L  G ID AVHS KD+P+ L  GL +    PRED RD  ++   +S   
Sbjct: 59  KGLFVKEIEEALYDGSIDLAVHSMKDVPSVLPPGLILPCIPPREDPRDALVTPDGRSFAQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + IGTS+LRR+A LL  R D+ ++  RG +ETRL K+       I+LA AG+KRL+
Sbjct: 119 LPQGARIGTSALRRQAQLLHRRPDLDIVSLRGNVETRLRKMEEEDMDGIVLAAAGLKRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I E L+++   P+ GQGA+ +E    + +  EL+  ++  DT  +V  ERAFL  L
Sbjct: 179 LAERIAEYLSVDVSLPAIGQGALGLECREGDDRTLELIAPLHDADTAVAVRAERAFLRRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  +A  A     TL   G+V   DG    + +       A  +G   A+ +    
Sbjct: 239 NGGCQVPLAAHATVAEQTLTMVGLVAEVDGGSLIKETLAAPVAQAEAVGCQLAETLLARG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 ADRIL 303


>gi|206889552|ref|YP_002248559.1| porphobilinogen deaminase [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206741490|gb|ACI20547.1| porphobilinogen deaminase [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 311

 Score =  267 bits (682), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 114/306 (37%), Positives = 176/306 (57%), Gaps = 3/306 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           ++    IG+R S LA+  A   +  L  ++  P   + I  + T GD+I +  L +IGGK
Sbjct: 4   KRNKIVIGSRGSKLAMWQANWVKDKLQTLY--PELKVEIEKIKTTGDKILDAPLAKIGGK 61

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +EIE+ L+S  +D AVHS KD+PT++ +GLQISA   RED RD FIS     L +L
Sbjct: 62  GLFVKEIEEALLSKRVDLAVHSMKDVPTEIPEGLQISAICEREDPRDAFISKDGVLLNEL 121

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GTSSLRR   L   R+D+ +   RG ++TR+ KL + +  AI+LA AG+KR+  
Sbjct: 122 PQEAVLGTSSLRRTVQLKALRNDLVIKPLRGNVDTRIRKLKDGEFQAIVLAMAGVKRMGV 181

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E ++ +  + +   P+ GQGAI IET V++    EL+K +NHE+T   +  ERAFL+ + 
Sbjct: 182 ENLVTQAFSEDLMIPAIGQGAIGIETRVDDDFVNELIKPLNHEETAICILAERAFLSVMG 241

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGK-IFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           G C+  +A  A    ++L   G++   +GK    +  R G+   A ++G + A  +    
Sbjct: 242 GGCQVPLACHARIVNNSLKIVGMIGDPEGKMPVIKGFREGSLSQAQSLGVELANELLHRG 301

Query: 301 NKNVFN 306
            K +  
Sbjct: 302 GKEILE 307


>gi|119475318|ref|ZP_01615671.1| porphobilinogen deaminase [marine gamma proteobacterium HTCC2143]
 gi|119451521|gb|EAW32754.1| porphobilinogen deaminase [marine gamma proteobacterium HTCC2143]
          Length = 313

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 110/308 (35%), Positives = 170/308 (55%), Gaps = 5/308 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   ++ L   H  P  ++ ++ ++T+GD++ +  L +IGG
Sbjct: 1   MPSNLVRIATRESPLALWQAEFIKAGLQAAH--PGLDVELLGMTTRGDKMLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL++S    RED RD F+S+  +++ +
Sbjct: 59  KGLFVKELETAMLEGRADIAVHSMKDVPMEFPEGLELSIICEREDPRDAFVSNHFKTVNE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L L S +GTSSLRR+  L   R D+++ID RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPLGSRVGTSSLRRQCQLRALRPDLNIIDLRGNVNTRLRKLDEGQYDAIILASAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I + + ++   P+ GQGA+ +E   ++ + Q L+  +NH  T   V+ ERA    L
Sbjct: 179 MEQRIADPIAVDSSLPAGGQGAVGVEARSDDHRIQALLAPLNHRSTALRVSAERAMNLRL 238

Query: 241 DGSCKSAIAGFAYCK---GSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            G C+  IA FA         L   G+V + DGK      R      A  +G + A  + 
Sbjct: 239 QGGCQVPIACFAELDIEGSGQLRLRGLVGSPDGKEILRCERQAKPEMAEALGIEVADNLL 298

Query: 298 FISNKNVF 305
               + + 
Sbjct: 299 AQGAERIL 306


>gi|163740378|ref|ZP_02147772.1| porphobilinogen deaminase [Phaeobacter gallaeciensis 2.10]
 gi|161386236|gb|EDQ10611.1| porphobilinogen deaminase [Phaeobacter gallaeciensis 2.10]
          Length = 320

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 128/307 (41%), Positives = 180/307 (58%), Gaps = 4/307 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGD----RITNRTLTEIGG 60
           P +IGTR SPLALA A ETR+ L+    +P     I+ + T GD       ++ L E+GG
Sbjct: 12  PLKIGTRGSPLALAQAHETRARLVAAFDLPQDAFEIVVIKTSGDNQALIAADKPLKELGG 71

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ L+SG ID AVHS KDMP     GL +  YLPRED+RD F+S    ++ D
Sbjct: 72  KGLFTKEIEEDLLSGAIDIAVHSMKDMPVAQPAGLLLDTYLPREDVRDAFVSPDVTAITD 131

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+A LL  R D+ V++FRG ++TRL KL +  A    LA AG+ RL 
Sbjct: 132 LRAGAVVGTSSLRRRAQLLHRRPDLQVVEFRGNVQTRLTKLRDGVAECTFLAMAGLNRLG 191

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            ++V    +  ED  P+  QGAI IE   ++ +  +++  ++  +T + +  ERAFLA L
Sbjct: 192 ADQVPATPIPPEDMLPAVAQGAIGIERRADDSRTGDMLAALHDRETGERLAAERAFLAAL 251

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG A  +G TL   G VL  DG       +     D   +GR+ A  +   +
Sbjct: 252 DGSCETPIAGLATLEGRTLRLRGEVLRPDGSEAISDEQTCPVEDGAELGREMATKLLAQA 311

Query: 301 NKNVFNF 307
               F++
Sbjct: 312 GAGFFDW 318


>gi|190893753|ref|YP_001980295.1| porphobilinogen deaminase [Rhizobium etli CIAT 652]
 gi|190699032|gb|ACE93117.1| porphobilinogen deaminase protein [Rhizobium etli CIAT 652]
          Length = 309

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 166/306 (54%), Positives = 217/306 (70%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KPFRIGTR SPLALA A E R  LM  H +P     I+ LSTKGDRIT+R+L EIGG
Sbjct: 1   MQTKPFRIGTRGSPLALAQAHEARDRLMAAHHLPEEMFEIVVLSTKGDRITDRSLAEIGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFTEE+E+KL+SGE+D AVHSAKDMPT L  GL +SAYLPREDIRD  I  TA  L D
Sbjct: 61  KGLFTEELEQKLVSGELDFAVHSAKDMPTHLPDGLHLSAYLPREDIRDAVIGRTAPKLID 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +G+SSLRR+AL+ R R DI+VI FRG +ETRL KL   +  A LLA AG+KRL 
Sbjct: 121 LPHGATVGSSSLRRQALIRRMRPDINVIIFRGSVETRLRKLEEGQVDATLLALAGLKRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           K +V+ +IL+ + FPP+P QGAICIE+ + + +  +L+  +N   T+D+V+CERAFLA L
Sbjct: 181 KVEVLTDILDPDTFPPAPAQGAICIESRIGDSRIDDLLAAVNDAATFDTVSCERAFLAAL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ I G+A C+G  + F G+++  DG+  H V+ +G+R DA  +G  A Q +R  +
Sbjct: 241 DGSCRTPIGGYAVCEGDLIRFSGLIITPDGRSQHAVTTDGHRRDAAALGTRAGQDVRARA 300

Query: 301 NKNVFN 306
               F+
Sbjct: 301 GSAFFD 306


>gi|113478006|ref|YP_724067.1| porphobilinogen deaminase [Trichodesmium erythraeum IMS101]
 gi|110169054|gb|ABG53594.1| hydroxymethylbilane synthase [Trichodesmium erythraeum IMS101]
          Length = 320

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 108/305 (35%), Positives = 155/305 (50%), Gaps = 5/305 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
             RIG+R S LAL   +  +  L      P     +  +ST+GD+I +  L +IG KGLF
Sbjct: 9   TIRIGSRKSQLALIQTYWVQEKLEK--NFPNITFEVHKMSTQGDKILDVALAKIGDKGLF 66

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHT---AQSLKDL 121
           T+E+E  ++  E D AVHS KD+PT L +GL +     RE+  D  + H     + L+ L
Sbjct: 67  TKELELGMLQNETDLAVHSLKDLPTNLPEGLILGCVTERENPADALVLHEKLKDKQLETL 126

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +VIGTSSLRR A L      +   D RG + TRL KL+  +  A++LA+AG+ RL  
Sbjct: 127 PEGAVIGTSSLRRLAQLRYHFPHLEFKDVRGNLNTRLAKLDAGEYDALILAFAGLHRLGM 186

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
              I +I+  E    + GQGA+ IE    +     L+K + H  T      ERAFL EL+
Sbjct: 187 SDRIHQIIPPEISLHAVGQGALGIECRAGDNNILNLLKSLEHTATAQRCYAERAFLRELE 246

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I      +G  L   G+V + DGK   +    G   DA  IG + AQ +R    
Sbjct: 247 GGCQVPIGVNTQIEGEQLTLTGLVASLDGKKLVKDIVTGATADAEQIGIELAQKLRKQGA 306

Query: 302 KNVFN 306
           + + +
Sbjct: 307 QEILD 311


>gi|300866645|ref|ZP_07111332.1| porphobilinogen deaminase [Oscillatoria sp. PCC 6506]
 gi|300335354|emb|CBN56492.1| porphobilinogen deaminase [Oscillatoria sp. PCC 6506]
          Length = 323

 Score =  267 bits (681), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 107/307 (34%), Positives = 160/307 (52%), Gaps = 5/307 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            +  RIG+R S LAL   +  +  L    + P     +  +ST+GD+I +  L +IG KG
Sbjct: 9   TRTVRIGSRKSQLALVQTYWVQEQLQQ--RFPQCTFEVHTMSTQGDKILDVPLAKIGDKG 66

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFI---SHTAQSLK 119
           LFT+E+E  ++S E D AVHS KD+PT L +GL +     RE+  D  +   +H  + L+
Sbjct: 67  LFTKELEVGMLSNETDFAVHSLKDLPTNLPEGLILGCVSERENPADALVVHANHQDKQLE 126

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
            L   +VIGTSSLRR A L      +   D RG + TRL KL+  +  AI+LA AG++RL
Sbjct: 127 TLPPGAVIGTSSLRRLAQLRHHFPHLEFKDIRGNLNTRLAKLDEGEYDAIILAVAGLQRL 186

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
                + +I++ E    + GQGA+ IE    +    EL+K + H +T      ERAFL E
Sbjct: 187 GMGDRVHQIISPEISLHAVGQGALGIECRAGDDDILELIKALEHTETAQRCYAERAFLRE 246

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I      +G  L   G+V + DG+   + +  G    A  +G D A  +R  
Sbjct: 247 LEGGCQVPIGVNTKIEGDQLTLTGLVASLDGQRLIKDTVTGAAATAELLGIDLAHRLRQQ 306

Query: 300 SNKNVFN 306
             + +  
Sbjct: 307 GAQEILE 313


>gi|296132653|ref|YP_003639900.1| porphobilinogen deaminase [Thermincola sp. JR]
 gi|296031231|gb|ADG81999.1| porphobilinogen deaminase [Thermincola potens JR]
          Length = 310

 Score =  267 bits (681), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 106/302 (35%), Positives = 162/302 (53%), Gaps = 2/302 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +   +GTR S LA+        +L  ++  P +   I+ + T+GD+I +  L +IG KGL
Sbjct: 3   REIVVGTRDSALAMWQTNWVVDNLRKLN--PDYTFKIVSMKTQGDKILDVALAKIGDKGL 60

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT+E+E  ++  EID AVHS KD+PT L +GL+I A   R D RDV ++     LKD+  
Sbjct: 61  FTKELEFAMLRNEIDLAVHSMKDLPTVLPEGLKIGAICERHDPRDVLVARDGILLKDMPQ 120

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + IGTSSLRR A LL++R D+ +I  RG + TR+ KL       I+LA AGI+RL    
Sbjct: 121 GARIGTSSLRRTAQLLKYRPDLQIISLRGNLNTRMAKLERENLDGIILAAAGIERLGWAY 180

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I + +  E   P+ GQG+I IE    + +   +V  +NH  +  ++  ERA L +L+G 
Sbjct: 181 RITQRIPFEVCLPAVGQGSIGIEIREGDEEVSRIVDKLNHGPSAAAITAERAMLKKLEGG 240

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKN 303
           C+  I      +G  L   G+V + DGK        G   +A ++G   A+ +  +    
Sbjct: 241 CQIPIGALGRVEGDRLTLEGVVASLDGKELLRSRVEGPASEAASLGVALAEKLLDMGALE 300

Query: 304 VF 305
           + 
Sbjct: 301 IL 302


>gi|146276603|ref|YP_001166762.1| porphobilinogen deaminase [Rhodobacter sphaeroides ATCC 17025]
 gi|145554844|gb|ABP69457.1| porphobilinogen deaminase [Rhodobacter sphaeroides ATCC 17025]
          Length = 322

 Score =  267 bits (681), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 130/303 (42%), Positives = 183/303 (60%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P +IGTR SPLALA A+ETRS L     +P     I+ + T GD++ +R L EIGGKGLF
Sbjct: 19  PLKIGTRGSPLALAQAYETRSRLSAAFSLPEEAFEIVVIKTTGDKVLDRPLKEIGGKGLF 78

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T EIE+ L+ G ID AVHS KDMPT   +GL +  YLPRED RD FI++    L DL   
Sbjct: 79  TREIEEALLDGGIDIAVHSMKDMPTLQPEGLILDTYLPREDTRDAFITYAEGGLADLPQG 138

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           + +G+SSLRR+A LL  R D+ V++FRG ++TRL KLN+  A    LA AG+ RLK + V
Sbjct: 139 ATVGSSSLRRRAQLLNKRPDLQVVEFRGNLQTRLKKLNDGVARGTFLAMAGLNRLKMDDV 198

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
            +  +  E+   +  QGAI IE  +++P+ QE++  I+   T   +  ER+FL +LDGSC
Sbjct: 199 PRVAIEPEEMLSAVAQGAIGIERRIDDPRTQEMLAAIHDVPTGHRLAAERSFLLKLDGSC 258

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           ++ IAG A  +G  ++  G +L  DG         G   DA  +G + A  +   +  + 
Sbjct: 259 ETPIAGLAVLEGDQIWLRGEILRPDGSESISGEIRGGIPDAAALGAELASELLGRAPSDF 318

Query: 305 FNF 307
           F++
Sbjct: 319 FSW 321


>gi|24211755|sp|Q8YVU6|HEM3_ANASP RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
          Length = 323

 Score =  267 bits (681), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 110/307 (35%), Positives = 167/307 (54%), Gaps = 5/307 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           ++  RIG+R S LAL   +  R  L   +  P  N  +  +ST+GD+I +  L +IG KG
Sbjct: 9   RRTIRIGSRKSQLALVQTYWVREQLQ--NSFPDINFEVHTMSTQGDKILDVALAKIGDKG 66

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTA---QSLK 119
           LFT+E+E  +I+ EID AVHS KD+PT L +GL ++A   RE+  D  + H     + + 
Sbjct: 67  LFTKELEVGMINEEIDFAVHSLKDLPTNLPEGLALAAITERENPADALVVHENFKDKQID 126

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
            L   +VIGTSSLRR A L      ++  D RG + TRL KL+  +   ++LA AG++RL
Sbjct: 127 TLPAGAVIGTSSLRRLAQLRNQFPHLTFKDVRGNLNTRLAKLDAGEYDGLILAAAGLQRL 186

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
                + +IL  E    + GQGA+ IE   ++ +   ++K I H +T D    ER+FL  
Sbjct: 187 GMGDRVHQILPKEISLHAVGQGALGIECRADDAELITVLKAIEHPETRDRCLAERSFLRS 246

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I       G+ L   G+V + DG+   + + +GN  DA  IG   A+ +R  
Sbjct: 247 LEGGCQVPIGVNTEINGNELILTGVVASVDGQNLVKDTVSGNASDAEAIGIRLAELLREQ 306

Query: 300 SNKNVFN 306
             + + N
Sbjct: 307 GAQEILN 313


>gi|220904556|ref|YP_002479868.1| porphobilinogen deaminase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219868855|gb|ACL49190.1| porphobilinogen deaminase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 310

 Score =  267 bits (681), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 115/306 (37%), Positives = 159/306 (51%), Gaps = 3/306 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            +    I TR S LAL  A   +S L  +   P   I +  + TKGD I +  L ++GGK
Sbjct: 1   MRNTLTIATRGSRLALWQAEHVKSCLQAIR--PGLEIRLNVIKTKGDIILDVPLAKVGGK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +EIE+ L++GE D AVHS KD+P +L +GL +    PRED  D  +SH   S+  L
Sbjct: 59  GLFVKEIEEALLNGEADLAVHSMKDVPMELPEGLILGCVPPREDPTDCLLSHKYDSVAAL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
             ++ +GTSSLRR++ LL  R D+ +   RG ++TRL KL      AI+LA AG+KRL  
Sbjct: 119 PPNACVGTSSLRRQSQLLAQRPDLRIESLRGNVDTRLRKLQEGMYDAIILASAGLKRLGL 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
                  L+   F P+ GQGA+ IE   N+ +   L+  +    T   V  ER FLA L+
Sbjct: 179 SAPHMHALDPHTFLPAVGQGALGIECRENDYELFTLLAEMEDSATRVCVEAERGFLAGLE 238

Query: 242 GSCKSAIAGFAY-CKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           G C+  IAG A      TL   G+V   DG      S++G+   A   G + A  I    
Sbjct: 239 GGCQVPIAGHARLLDDDTLRLEGLVAEVDGSRILRCSKDGHTSQARRWGLELAGEILEQG 298

Query: 301 NKNVFN 306
            K +  
Sbjct: 299 GKGILE 304


>gi|224370660|ref|YP_002604824.1| HemC [Desulfobacterium autotrophicum HRM2]
 gi|223693377|gb|ACN16660.1| HemC [Desulfobacterium autotrophicum HRM2]
          Length = 325

 Score =  267 bits (681), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 116/305 (38%), Positives = 161/305 (52%), Gaps = 2/305 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            KK  +IGTR S LAL  A   +  + D  + P   + I+ + T GD I +R L+ +GGK
Sbjct: 19  MKKTIKIGTRGSKLALWQANHVKDRIED--QFPETEVEIMTIKTTGDMIVDRPLSMVGGK 76

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +EIEK L+   ID AVHS KDMP +L  GL I A   RE+  DV IS+   SL DL
Sbjct: 77  GLFVKEIEKALLESTIDMAVHSMKDMPGELPPGLVIGAVPARENPFDVLISNNNLSLADL 136

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              + IGTSSLRR + +   R DI     RG ++TRL KL   +  A LLA AG+ RL  
Sbjct: 137 PKGARIGTSSLRRASQIKHARPDIETASIRGNLDTRLKKLAAGEFDATLLAAAGLIRLGM 196

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           + VI +  +     P+ GQGA+CIE+   +     ++  +NH +T   V+ ERAFL  LD
Sbjct: 197 KTVITQYFDETIMIPAVGQGALCIESRQEDLDIAPVLAFLNHGETHTVVSGERAFLRRLD 256

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           GSC   +A F   +   +   G+V + DG+   + +  G   D    G   A+ +     
Sbjct: 257 GSCHIPVACFGRLEDHRVILTGLVASEDGRTILKETVAGTPEDPQKAGIALAETLLSKGA 316

Query: 302 KNVFN 306
             +  
Sbjct: 317 DKILE 321


>gi|163757401|ref|ZP_02164490.1| porphobilinogen deaminase [Hoeflea phototrophica DFL-43]
 gi|162284903|gb|EDQ35185.1| porphobilinogen deaminase [Hoeflea phototrophica DFL-43]
          Length = 312

 Score =  267 bits (681), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 159/305 (52%), Positives = 209/305 (68%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           + KP+RIGTR SPLALA A ETR  LM  H +P     I+ LSTKGDRIT+R L EIGGK
Sbjct: 5   QMKPYRIGTRGSPLALAQAHETRERLMAAHDLPESAFEIVVLSTKGDRITDRPLAEIGGK 64

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLFTEE+E++L  G +D AVHS+KDMPT L +GL I  YL RED RD +IS  A  L+DL
Sbjct: 65  GLFTEELEEQLSDGRLDLAVHSSKDMPTALPEGLGIVTYLEREDPRDAYISSAAPRLEDL 124

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+G+SSLRR+AL+ R R DISVI FRG ++TRL KL + + HA +LA+AG+KRL K
Sbjct: 125 PQKAVVGSSSLRRQALIRRLRPDISVITFRGLVDTRLRKLADGEVHATMLAFAGLKRLGK 184

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
            +V+  +++ E FPP+PGQGAICIE  +++ +  EL+  I+H DT  ++NCER FL  LD
Sbjct: 185 SEVVTNLMDPESFPPAPGQGAICIEARLDDERIAELLAPIDHADTHAALNCERGFLGALD 244

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           GSC++ IAG A  +   + FYG++L  DG  FH++   G   DA  +G DA   +R  + 
Sbjct: 245 GSCRTPIAGHATLENGQVSFYGMILTPDGTTFHDIRVQGPAADAAQLGADAGAEVRARAG 304

Query: 302 KNVFN 306
              F 
Sbjct: 305 SKFFE 309


>gi|289207199|ref|YP_003459265.1| porphobilinogen deaminase [Thioalkalivibrio sp. K90mix]
 gi|288942830|gb|ADC70529.1| porphobilinogen deaminase [Thioalkalivibrio sp. K90mix]
          Length = 315

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 115/293 (39%), Positives = 161/293 (54%), Gaps = 2/293 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            KP RI TR SPLA+  A    + L  +H  P   + ++ ++T+GDR+ +  L  IGGKG
Sbjct: 1   MKPLRIATRKSPLAMWQAEHVAARLRGLH--PDLPVELVGMTTQGDRVLDSPLARIGGKG 58

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  ++    D AVHS KD+P +L   L +   L RED  D F+S+T   + +L 
Sbjct: 59  LFVKELEVAMLEDRADIAVHSVKDVPMELPADLVLPVILDREDPLDAFVSNTYAHVDELP 118

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +G+SSLRR+  L   R D+ + D RG + TRL KL+  +  AILLA AG+KRL  +
Sbjct: 119 QGARVGSSSLRRQCQLRARRPDLKITDLRGNVNTRLGKLDAGEYDAILLAAAGLKRLGFD 178

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I+  L      P+ GQGAI IE   N+P+   L+  +N  DT D V  ERAF   L+G
Sbjct: 179 ERIRARLEPAVSLPAVGQGAIAIECRENDPEIAALIAPLNDRDTSDRVRAERAFNRRLEG 238

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQY 295
            C+  +AG A   G  L   G+V A DG         G R DA  +G   A+ 
Sbjct: 239 GCQVPLAGHATLDGDRLRLDGLVGAVDGSQLLRRQVEGPRGDAEALGVQLAEQ 291


>gi|78044433|ref|YP_360051.1| porphobilinogen deaminase [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|123756773|sp|Q3ACT3|HEM3_CARHZ RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|77996548|gb|ABB15447.1| porphobilinogen deaminase [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 311

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 114/305 (37%), Positives = 169/305 (55%), Gaps = 2/305 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            KK   +G+R S LAL         L  +H  P  N  I+ + TKGD+I +  L +IG K
Sbjct: 1   MKKEVIVGSRDSALALWQTNWVVERLSKIH--PEINFKIVTMKTKGDKILDVALAKIGDK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLFT+E+E  L++  ID AVHS KD+PT L +GL+I A+  RE   DVFIS       +L
Sbjct: 59  GLFTKELEHALLNKTIDMAVHSMKDLPTVLPEGLKIGAFCEREYPGDVFISPKGFKFLEL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              + IGTSSLRR A +L  R D+  I  RG + TR  K+       I+LAYAG+KRL  
Sbjct: 119 PQGARIGTSSLRRIAQILAVRPDLQAIPLRGNLPTRFRKMEEMDLDGIILAYAGVKRLGY 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E  I E+L+ +   P+ GQG+I +E   ++   +EL+K I+H  T  ++  ERAFL  L+
Sbjct: 179 EDKITEMLSFDLCLPAVGQGSIGVEIRADDTFIEELLKPIDHFATNRAIRAERAFLKRLE 238

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I  ++  K + L+  G+V + DGK+  +  + G+  +   +G   A+ +     
Sbjct: 239 GGCQIPIGAYSEVKENRLHLKGVVASLDGKLVIKGEKEGSIEEPEKVGISLAEELLTKGA 298

Query: 302 KNVFN 306
           + +  
Sbjct: 299 QKILE 303


>gi|46201306|ref|ZP_00208053.1| COG0181: Porphobilinogen deaminase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 315

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 134/310 (43%), Positives = 183/310 (59%), Gaps = 4/310 (1%)

Query: 1   MEKK--PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHN--IVIIPLSTKGDRITNRTLT 56
           M  K    RIGTR SPLALA   ETR  L            I I  + T GD I +R L 
Sbjct: 1   MTAKLPILRIGTRGSPLALAQTHETRDRLAAAWAPLGQEGAIDIEVIKTTGDLIQDRPLA 60

Query: 57  EIGGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQ 116
           EIGGKGLFT+E+++ ++SG I  AVHS KD+PT L  G+ +   LPRED+RD FIS  A 
Sbjct: 61  EIGGKGLFTKELDEAMLSGRIHLAVHSMKDVPTLLPDGIVLPCILPREDVRDAFISLKAA 120

Query: 117 SLKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGI 176
           SL DL   +V+GTSSLRR A +L  R D+ V++FRG ++TRL KL+     A +LA AG+
Sbjct: 121 SLADLPQGAVVGTSSLRRGAQILHRRPDLKVVNFRGNVQTRLRKLDEGVVDATMLAMAGL 180

Query: 177 KRLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAF 236
           +RL     +   L+ +D  P+  QGAI I    ++  A   +  +N  D++  V  ERAF
Sbjct: 181 RRLGLAGHVTSALSEDDMLPAVAQGAIGITCRADDEAAHAFLAALNCPDSFVRVAAERAF 240

Query: 237 LAELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           L  LDGSC++ IA  A   G  L F G++++ DG   H  SR+G+R DA  +G+DAA+ +
Sbjct: 241 LTRLDGSCRTPIAALAVLDGDHLSFRGLIVSPDGTAIHATSRSGSRSDAEAMGKDAAEEL 300

Query: 297 RFISNKNVFN 306
             ++    F+
Sbjct: 301 IKVAGPGFFD 310


>gi|74318586|ref|YP_316326.1| porphobilinogen deaminase [Thiobacillus denitrificans ATCC 25259]
 gi|123772872|sp|Q3SFT5|HEM3_THIDA RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|74058081|gb|AAZ98521.1| porphobilinogen deaminase [Thiobacillus denitrificans ATCC 25259]
          Length = 306

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 112/302 (37%), Positives = 160/302 (52%), Gaps = 2/302 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
              I +R S LA+  A   R  L ++H  P   + I+ ++T+GD+I + TL++IGGKGLF
Sbjct: 3   TLTIASRESALAMWQAEHIRDRLRELH--PECKVNILGMTTRGDQILDVTLSKIGGKGLF 60

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +E+E  L +GE D AVHS KD+P +L  G +++    RED RD F+S+    L DL   
Sbjct: 61  VKELEVALAAGEADLAVHSMKDVPMELPPGFELAVIGEREDPRDAFVSNRYARLSDLPPG 120

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           SV+GTSSLRR+A L      ++V   RG + TRL KL+  +  AILLA AG+KRL     
Sbjct: 121 SVVGTSSLRREAQLRARYPHLTVKPLRGNVGTRLKKLDEGQFDAILLAAAGLKRLGLGAR 180

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           IK +L++E+  P+ GQGA+ IE    N     ++  +N   T   V  ER     L GSC
Sbjct: 181 IKSLLSVEESIPAAGQGALGIEIRSGNTAVAAMLAPLNDPVTAACVRAERQVSRVLGGSC 240

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           +  +   A  K   L   G V   DG  F      G+  D   +G+  A  +     + V
Sbjct: 241 QVPLGAHASYKDGRLLLEGFVAKPDGSRFLVDRAEGDASDPEAVGQALADKLLAQGARAV 300

Query: 305 FN 306
            +
Sbjct: 301 LD 302


>gi|85060344|ref|YP_456046.1| porphobilinogen deaminase [Sodalis glossinidius str. 'morsitans']
 gi|84780864|dbj|BAE75641.1| porphobilinogen deaminase [Sodalis glossinidius str. 'morsitans']
          Length = 320

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 104/305 (34%), Positives = 154/305 (50%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+    RI TR SPLAL  A   R  L+  H  P   + ++PL T+GD   +  L ++GG
Sbjct: 8   MQDNLLRITTRQSPLALWQAGYVRDELLRHH--PHLQVELVPLVTRGDITLDTPLAKVGG 65

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+      GL +     R+D RD F+S    +L  
Sbjct: 66  KGLFIKELELALLEHRADIAVHSMKDVTVSFPAGLGLCVLCERDDPRDAFVSPRYANLDV 125

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  L   R D+ V D RG + TRL KL+     A++LA AG+KRL 
Sbjct: 126 LPPGAIVGTSSLRRQCQLRERRPDVIVHDLRGNVGTRLAKLDRGNFDAVILAVAGLKRLG 185

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  ++  D  P+ GQGA+ IE  +++ +   L+  ++H +T   V  ERA  A L
Sbjct: 186 LEDRIRHAIDPADSLPAVGQGAVGIECRLDDARTLALLAPLHHRETSLRVGAERAMNARL 245

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A   G  ++   +V + DG              A  +G   A  +    
Sbjct: 246 QGGCQVPIGSYAVLDGEEIWLRALVGSPDGTTVIRSEGRAPLAQAEQLGLRLADDLLNRG 305

Query: 301 NKNVF 305
            + + 
Sbjct: 306 ARAIL 310


>gi|77461708|ref|YP_351215.1| porphobilinogen deaminase [Pseudomonas fluorescens Pf0-1]
 gi|123602840|sp|Q3K4T0|HEM3_PSEPF RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|77385711|gb|ABA77224.1| porphobilinogen deaminase [Pseudomonas fluorescens Pf0-1]
          Length = 313

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 111/305 (36%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEAAH--PGLLVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  E D AVHS KD+P    +GL +     RED RD F+S+T  SL  
Sbjct: 59  KGLFVKELETALLENEADIAVHSMKDVPMDFPEGLGLFCICEREDPRDAFVSNTYSSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLTRRPDLEIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++H DT D V  ERA    L
Sbjct: 179 FEDRITSAISVDDSLPAGGQGAVGIECRSADTEIHALLAPLHHADTADRVTAERALNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  L+  G+V    G           R  A  +G   A+ +    
Sbjct: 239 NGGCQVPIACYAVLEGDQLWLRGLVGEPSGGKLLNAQARAPRAAAETLGVQVAEDLLSQG 298

Query: 301 NKNVF 305
             ++ 
Sbjct: 299 ADDIL 303


>gi|217969858|ref|YP_002355092.1| porphobilinogen deaminase [Thauera sp. MZ1T]
 gi|217507185|gb|ACK54196.1| porphobilinogen deaminase [Thauera sp. MZ1T]
          Length = 310

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 100/308 (32%), Positives = 155/308 (50%), Gaps = 5/308 (1%)

Query: 1   MEK---KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTE 57
           M +   +   I TR S LAL  A   ++ L  +H  P   + ++ ++T+GD+I +R L +
Sbjct: 1   MSQSSPERIVIATRESRLALWQAEHIKARLEALH--PGCRVELLGMTTRGDQILDRPLAK 58

Query: 58  IGGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQS 117
           +GGKGLF +E+E  L+ G  D AVHS KD+P  +     +     RE   D F+S   +S
Sbjct: 59  VGGKGLFVKELETALLDGRADIAVHSMKDVPMVMEPEFALPCITAREVPLDAFVSSRYES 118

Query: 118 LKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           L D+   +V+GTSSLRR++ +      + V   RG ++TRL KL+  +  AI+LA AG+ 
Sbjct: 119 LADMPPGAVVGTSSLRRESQIHAQYPFLGVTSLRGNLDTRLRKLDEGQYDAIILAAAGLT 178

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL   + I+ ++  E   P+ GQGA+ IE           ++ +   DT   V  ERA  
Sbjct: 179 RLGLGERIRSVMPAEVSLPAAGQGALGIECLSARADVIGWLQPLVDADTTACVLAERAVA 238

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
             L GSC+  +  +A  +   L+  G V   DG       R G   +A  +GR  A  +R
Sbjct: 239 RALAGSCEVPLGAYAVMREGRLWLRGFVARPDGSTIVRAEREGAPAEAEALGRALADDLR 298

Query: 298 FISNKNVF 305
               + + 
Sbjct: 299 AQGAEAIL 306


>gi|13473577|ref|NP_105145.1| porphobilinogen deaminase [Mesorhizobium loti MAFF303099]
 gi|23821698|sp|Q98EI7|HEM3_RHILO RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|14024327|dbj|BAB50931.1| hydroxymethylbilane synthase [Mesorhizobium loti MAFF303099]
          Length = 308

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 143/306 (46%), Positives = 206/306 (67%), Gaps = 1/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+    +IGTR SPLALA A ET++ LM  H +P     ++ +ST GDRI +R L+E GG
Sbjct: 1   MQT-TLKIGTRGSPLALAQAHETQARLMAAHGLPAEAFEVVVISTSGDRIQDRPLSEAGG 59

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ L++G ID AVHS+KDMPT+L  GL++SA+LPRED RD F+   A+++ D
Sbjct: 60  KGLFTKEIEEALLAGAIDIAVHSSKDMPTQLPDGLELSAFLPREDARDAFVGKAAKTIAD 119

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +G+SSLRR+AL+ R R D+ V+ FRG ++TRL KL+   A   +LAYAG+KRL 
Sbjct: 120 LLRGAKVGSSSLRRQALIRRMRPDLDVVMFRGNVQTRLRKLDEGVAAGTILAYAGLKRLG 179

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E V  +++ ++ FPP+PGQGAI IET + +   ++++  I+   T  ++ CERAFLA L
Sbjct: 180 LEHVATDLMPLDIFPPAPGQGAIGIETRIGDRAVEKMLVAIHDVPTGQALACERAFLAAL 239

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG A  +   L F G++++ DG   H V   G   DA  IG +AA+ +R  +
Sbjct: 240 DGSCRTPIAGHATIETGNLSFAGLIISPDGTQSHTVELQGPAQDAARIGDEAARTVRAKA 299

Query: 301 NKNVFN 306
            +  F+
Sbjct: 300 GEKFFD 305


>gi|209551271|ref|YP_002283188.1| porphobilinogen deaminase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209537027|gb|ACI56962.1| porphobilinogen deaminase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 309

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 163/306 (53%), Positives = 217/306 (70%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KPFRIGTR SPLALA A E R  LM  H +P     I+ LSTKGDRIT+R+L EIGG
Sbjct: 1   MQTKPFRIGTRGSPLALAQAHEARDRLMAAHHLPEEMFEIVVLSTKGDRITDRSLAEIGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFTEE+E++L +GE+D AVHSAKDMPTKL  GL +SAYLPREDIRD  I  TA  L D
Sbjct: 61  KGLFTEELEQQLTTGELDFAVHSAKDMPTKLPDGLHLSAYLPREDIRDAVIGRTAPKLID 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +G+SSLRR+AL+ R R DI+V+ FRG +ETRL KL   +  A LLA AG+KRL 
Sbjct: 121 LPHGATVGSSSLRRQALIRRMRPDINVVTFRGLVETRLRKLEEGQVDATLLALAGLKRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           K +V+ +IL+ + FPP+P QGAIC+E+ + + +  +L+  +N   T+D+V+CERAFLA L
Sbjct: 181 KVEVLTDILDPDTFPPAPAQGAICLESRIGDTQIDDLLAPVNDAATFDTVSCERAFLAAL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ I G+A C+G  + F G+++  DG+  H V+ +G+R DA  +G  A Q +R  +
Sbjct: 241 DGSCRTPIGGYAVCEGDLIRFSGLIITPDGRSQHAVTTDGHRRDAAALGTRAGQDVRARA 300

Query: 301 NKNVFN 306
               F+
Sbjct: 301 GSAFFD 306


>gi|190575960|ref|YP_001973805.1| porphobilinogen deaminase [Stenotrophomonas maltophilia K279a]
 gi|229846305|sp|B2FI06|HEM3_STRMK RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|190013882|emb|CAQ47520.1| putative porphobilinogen deaminase [Stenotrophomonas maltophilia
           K279a]
          Length = 303

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 110/306 (35%), Positives = 160/306 (52%), Gaps = 4/306 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           ME    RI TR SPLAL  +      L   H  P  ++ ++P+ST+GD + +R+L  IGG
Sbjct: 1   ME--TVRIATRKSPLALWQSEHVADRLRQAH--PGLHVELVPMSTRGDEVLDRSLAAIGG 56

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ GE DCAVHS KD+P +L     + A L R D  D F+S+   SL  
Sbjct: 57  KGLFLKELELAMLRGEADCAVHSLKDVPMELDPPFALPAMLTRHDPADGFVSNLYASLDA 116

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L + + +GTSSLRR+A L   R D+ ++D RG + TRL KL+N    AI+LA AG++RL 
Sbjct: 117 LPIGARVGTSSLRRQAQLRALRPDLELLDLRGNVNTRLAKLDNGGYDAIVLAVAGLERLG 176

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I   L    + P+P QGA+ +E    N +   L   ++   T   V  ERA    L
Sbjct: 177 LGERIVARLQPPQWLPAPAQGAVAVECDGGNARLMALFAPLDDAATRACVEAERAMNRAL 236

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC   +A  A  +G  L+  G+V ++           G   D   +G+  A+ +    
Sbjct: 237 HGSCHVPVAAIAQWQGDDLHLQGLVGSASDGRAVRAEAVGPANDPEGLGQRVAKLLLDDG 296

Query: 301 NKNVFN 306
              + N
Sbjct: 297 AGELLN 302


>gi|11467957|sp|O66621|HEM3_AQUAE RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
          Length = 304

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 113/301 (37%), Positives = 171/301 (56%), Gaps = 5/301 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
             RIGTR S LAL  A   +  L          + ++ ++T GD+IT+  L +IGGKGLF
Sbjct: 2   KIRIGTRKSKLALWQANYVKDFLEKHW---GVEVELVKITTTGDKITDVPLAKIGGKGLF 58

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +EIEK L+ G ID AVHS KD+P  + KGL++ A   RE+  DV IS + + L +L   
Sbjct: 59  VKEIEKALLEGSIDLAVHSLKDVPMVIPKGLKLGAITKRENPYDVLISRSGKKLYELPSG 118

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           SVIGTSSLRR+  + + R D+ V   RG ++TR+ KL      A++LAYAG+KR+  E  
Sbjct: 119 SVIGTSSLRRQVQIKKRRRDLKVEVLRGNVDTRMRKLKEGLYDAVILAYAGVKRMGYESE 178

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I E+  +EDF P+ GQG++ IE    + + +EL+K +N+E+++     ER FL  L+G C
Sbjct: 179 ITEV--LEDFIPAVGQGSLAIEIREGDKRIEELIKPLNNEESFLCAIAERTFLRRLEGGC 236

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           +  +  FA  +  TL     +   + + + E  R GN  +A  +G   A+ +     + +
Sbjct: 237 QVPVGAFAKIENGTLKMKAFISDIEAERYIEGYREGNPEEAEKLGLSLAEELLKKGGEEI 296

Query: 305 F 305
            
Sbjct: 297 L 297


>gi|254447439|ref|ZP_05060905.1| porphobilinogen deaminase [gamma proteobacterium HTCC5015]
 gi|198262782|gb|EDY87061.1| porphobilinogen deaminase [gamma proteobacterium HTCC5015]
          Length = 313

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 115/305 (37%), Positives = 168/305 (55%), Gaps = 4/305 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            K  RI TR SPLAL  A +  + L   +  P  +I ++ ++TKGD+I +  L +IGGKG
Sbjct: 1   MKTLRIATRQSPLALWQAEDVAAKLKAHY--PDLDIELVKMTTKGDKILDTPLAKIGGKG 58

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMP--TKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           LF +E+E  ++ G  D AVHS KD+P  ++  +GL +S  L RED RD F+S+   SL +
Sbjct: 59  LFIKELEVGMLEGRADIAVHSMKDVPVDSEFPEGLHLSVILEREDPRDAFVSNRYNSLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GT+SLRR+  +L     +     RG + TRL KL++ +  AI+LA AG+ RL 
Sbjct: 119 LPEGAVVGTASLRRQCQVLGRYPHLKTAVLRGSVGTRLGKLDDGQFDAIVLASAGLMRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I   L  E   P+ GQGA+ IE   ++ +  +L+  +   DT   +  ERA  A L
Sbjct: 179 LEERITAKLPPEISLPAIGQGAVGIECRKDDTELNKLLAPLADRDTTTRLKAERALNARL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  IAG+A  +G  L   G+V A DG   +   R G R  A +IG   A+ +    
Sbjct: 239 QGGCQVPIAGYAELEGDQLSMRGLVGAPDGSKLYTSERRGPRDQAADIGLAVAEDLLSQG 298

Query: 301 NKNVF 305
              V 
Sbjct: 299 ANAVL 303


>gi|303247619|ref|ZP_07333890.1| porphobilinogen deaminase [Desulfovibrio fructosovorans JJ]
 gi|302491099|gb|EFL50993.1| porphobilinogen deaminase [Desulfovibrio fructosovorans JJ]
          Length = 310

 Score =  266 bits (679), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 106/305 (34%), Positives = 161/305 (52%), Gaps = 2/305 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            +    I TR S LAL  A    + L + H  P   + ++P+ TKGDRI +  L ++GGK
Sbjct: 1   MRDKLVIATRGSKLALWQANHVAARLKEAH--PGLAVDLLPIKTKGDRILDVPLAKVGGK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +EIE+ L+ G  D AVHS KD+P +   GL +     RED  D+ +S     L  L
Sbjct: 59  GLFVKEIEEALLDGRADLAVHSMKDVPAEQPAGLVVGITPKREDPCDMLLSVAYDGLDAL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              + +GTSSLRRKA L   R D++++D RG ++TR+ KL +    AI++A AG+ RL  
Sbjct: 119 PEGAKVGTSSLRRKAQLTALRPDLAIVDLRGNLDTRVGKLTDGLFDAIVVARAGLNRLGL 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
                E L    F P+  QGA+ IE   ++ +   ++   +H ++ D+V  ERAFL  L+
Sbjct: 179 SAPKSERLCPPRFLPAAAQGALGIEYRFDDRETAAMLAFFDHPESRDAVAAERAFLGRLE 238

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  IA  A   G+ +   G+V   D          G R DA+ +G+  A  +  +  
Sbjct: 239 GGCQVPIAAHAVIDGNLISIDGLVADPDTGRTFRDVATGKRDDAVELGKKLADSVLAMGA 298

Query: 302 KNVFN 306
           + + +
Sbjct: 299 RAILD 303


>gi|255020135|ref|ZP_05292205.1| Porphobilinogen deaminase [Acidithiobacillus caldus ATCC 51756]
 gi|254970428|gb|EET27920.1| Porphobilinogen deaminase [Acidithiobacillus caldus ATCC 51756]
          Length = 319

 Score =  266 bits (679), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 117/302 (38%), Positives = 170/302 (56%), Gaps = 4/302 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P RIGTR SPLAL  A   R+ L+  H  P   + I+P++T+GDR+    L EIGGKGLF
Sbjct: 17  PLRIGTRASPLALWQAEHVRAGLLRAH--PEIPVEIVPMTTQGDRMLAVPLHEIGGKGLF 74

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +EIE  L+ G +D AVHS KD+P +  +GL+I+A L RED+RD ++S+T    +DL   
Sbjct: 75  VKEIEAALLEGTVDLAVHSMKDVPAQQPEGLEIAAILAREDVRDAWVSNTFARPEDLPQG 134

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
             +G+SSLRR+A LL       V+D RG + TRL KL+      I+LA AG+KRL   + 
Sbjct: 135 GRVGSSSLRRRAQLLHRLPQTVVLDLRGNVATRLRKLDAGDYDGIVLAAAGLKRLGLLER 194

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I+  L  E   P+ GQGAI +E   ++ + + L+K +N   T   V  ER     L G C
Sbjct: 195 IRHYLEPELSLPAVGQGAIGVEIRSDDARTRTLLKPLNDPTTSRCVGAERHMNRLLGGDC 254

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           +  +A  A   G+ L   G+V + DG+        G+   A ++G   AQ +     +++
Sbjct: 255 RLPVAALAEADGTGLRLRGLVASPDGRELLRAEAVGSL--AHSVGEQVAQALLAQGAQHI 312

Query: 305 FN 306
            +
Sbjct: 313 ID 314


>gi|218437216|ref|YP_002375545.1| porphobilinogen deaminase [Cyanothece sp. PCC 7424]
 gi|218169944|gb|ACK68677.1| porphobilinogen deaminase [Cyanothece sp. PCC 7424]
          Length = 320

 Score =  266 bits (679), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 111/306 (36%), Positives = 162/306 (52%), Gaps = 5/306 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            +  RIG+R S LAL   +  +  L   H  P     +  +ST+GD+I +  L +IG KG
Sbjct: 7   TRTVRIGSRKSQLALVQTYWVQEQLQKHH--PDRQFEVETMSTQGDKILDVALAKIGDKG 64

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFI---SHTAQSLK 119
           LFT+E+E  ++ G+ D AVHS KD+PTKL  GL +     R D  D  +    H  + ++
Sbjct: 65  LFTKELEVSMLEGQTDLAVHSLKDLPTKLPDGLMLGCITERVDPADGLVVNEKHKDKQIE 124

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
            L   +VIGTSSLRR A L      ++  D RG + TRL KL+  +  AI+LA AG+ RL
Sbjct: 125 TLPEGAVIGTSSLRRLAQLRYHFPHLTFKDVRGNVNTRLAKLDAGEYDAIILAVAGLTRL 184

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
                I +++  +    + GQGA+ IE    +P+  EL+KV+ H+ T D    ER+FL E
Sbjct: 185 GMSDRIHQVIPSDISLHAVGQGALGIECRTEDPEILELLKVLEHQPTRDRCYAERSFLRE 244

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I       G TL   G+V + DGK   + +  G   DA  +G+D A  +R  
Sbjct: 245 LEGGCQVPIGVNTSVDGDTLTLTGMVASLDGKKLIKDTITGKTTDAEQLGKDLAIRVRNA 304

Query: 300 SNKNVF 305
               + 
Sbjct: 305 GAGEIL 310


>gi|83941602|ref|ZP_00954064.1| porphobilinogen deaminase [Sulfitobacter sp. EE-36]
 gi|83847422|gb|EAP85297.1| porphobilinogen deaminase [Sulfitobacter sp. EE-36]
          Length = 317

 Score =  266 bits (679), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 131/305 (42%), Positives = 177/305 (58%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           + P RIGTR SPLA+A A+ETR+ L    +IP     I+ +   GD I +R L +IGGKG
Sbjct: 9   ENPMRIGTRGSPLAMAQAYETRARLAAAFEIPQAAFEIVVIKVTGDVIQDRPLKDIGGKG 68

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT EIE+ L++G+ID AVHS KDMPT    GL +  YLPRED RD F++ T  +L  LA
Sbjct: 69  LFTREIEEDLLAGKIDIAVHSMKDMPTIQPGGLLLDTYLPREDPRDAFVAPTLSALDQLA 128

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +V+GTSSLRR+A LL  R D+ V++FRG ++TRL KL +  A    LA AG+ RL  +
Sbjct: 129 EGAVVGTSSLRRRAQLLHQRPDLQVVEFRGNVQTRLKKLADGVAECTFLAVAGLNRLGMQ 188

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
            V    ++     P+  QGAI IE    +   + ++  I+   T   +  ERAFL  LDG
Sbjct: 189 HVPATPIDDTLMLPAVAQGAIGIERRAGDLDTEAMLAAIHDTPTGQRLAAERAFLLTLDG 248

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
           SC++ IAG A   G TL+  G VL  DG       R+G       +G D AQ +   +  
Sbjct: 249 SCETPIAGLATLDGDTLHLRGQVLRPDGSEAIAGDRSGPIAQGGQMGVDLAQDLLAQAGP 308

Query: 303 NVFNF 307
             F++
Sbjct: 309 GFFDW 313


>gi|187478790|ref|YP_786814.1| porphobilinogen deaminase [Bordetella avium 197N]
 gi|115423376|emb|CAJ49910.1| porphobilinogen deaminase [Bordetella avium 197N]
          Length = 314

 Score =  265 bits (678), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 105/300 (35%), Positives = 159/300 (53%), Gaps = 2/300 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
             I TR S LAL  A   R  L D++  P   + ++ L+T+GD+I +R+L+++GGKGLF 
Sbjct: 7   LVIATRASRLALWQAEHVRDRLRDLY--PACAVELLTLTTRGDQILDRSLSKVGGKGLFV 64

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+ G  D AVHS KD+P  +     +S  L R D RD F+S    SL  L + +
Sbjct: 65  KELEHALLDGRADLAVHSLKDVPVDIQAPFALSTVLERADPRDAFVSARYASLDALPVGA 124

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+GTSSLRR+A +   R D+ V   RG ++TRL KL+  +  A++LA AG++R+     I
Sbjct: 125 VVGTSSLRREAQIRAARPDLVVRPLRGNLDTRLGKLDRGEYDAVVLAAAGLERIGYGDRI 184

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L      P+ GQGA+ IE   +    +  +  ++   T   V+ ERA    L GSC+
Sbjct: 185 RARLAPAQSLPAAGQGALGIEIRDDRDDMRAWLAPLSDASTTACVSAERAVSRALGGSCQ 244

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             I  +A   G TL    +V + DG+     SR G   +A ++G   A  +       + 
Sbjct: 245 VPIGAYAELHGQTLRIDALVASPDGRRILRASRLGPVAEADSLGMAVAHDLLAQGGDAIL 304


>gi|317402904|gb|EFV83446.1| HemC protein [Achromobacter xylosoxidans C54]
          Length = 314

 Score =  265 bits (678), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 102/307 (33%), Positives = 155/307 (50%), Gaps = 3/307 (0%)

Query: 1   ME-KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M   +   I TR S LAL  A   R  L  ++  P   + ++ L+T+GD+I +RTL+++G
Sbjct: 1   MSLPQRLVIATRASRLALWQAEHVRDRLRTLY--PACAVELLTLTTRGDQILDRTLSKVG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  L+ G  D AVH  KDMP  +    ++ A L R D RD F+S+   +L 
Sbjct: 59  GKGLFVKELETALLDGRADLAVHCLKDMPVDMQAPFELCAVLDRADPRDAFVSNRYATLA 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           DL   +V+GTSSLRR++ +      + V   RG ++TRL KL+  +  AI+LA AG+ RL
Sbjct: 119 DLPAGAVVGTSSLRRESQIRARYPQLLVKPLRGNLDTRLGKLDRGEYDAIVLAAAGLNRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
                I  +L+  +  P+ GQGA+ IE   +    +  +  +N          ERA    
Sbjct: 179 GLTDRISSLLDPAESLPAAGQGALTIEIRDDRDDMRAWLAPLNDAGATSISLAERAVSRR 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L GSC+  +A +A     TL    +V + DG        +G    A  IG   A  +   
Sbjct: 239 LGGSCQVPLAAYAEIADDTLTLRALVASPDGTRMLRAHGSGPVAQAQAIGEAVAAELFDA 298

Query: 300 SNKNVFN 306
             + + +
Sbjct: 299 GAQAILD 305


>gi|222087476|ref|YP_002546013.1| porphobilinogen deaminase [Agrobacterium radiobacter K84]
 gi|221724924|gb|ACM28080.1| porphobilinogen deaminase [Agrobacterium radiobacter K84]
          Length = 322

 Score =  265 bits (677), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 164/308 (53%), Positives = 216/308 (70%), Gaps = 1/308 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KPFRIGTR SPLALA A E R  LM  H +P     I+ L+TKGDRI +RTL EIGG
Sbjct: 14  MQTKPFRIGTRGSPLALAQAHEARDRLMAAHGLPEEMFEIVALTTKGDRIADRTLAEIGG 73

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+E+E+KL SGE+D AVHSAKDM TKL +GL ++AYLPREDIRD  I  TA  L +
Sbjct: 74  KGLFTQELEEKLTSGELDFAVHSAKDMATKLPEGLALTAYLPREDIRDSVIGRTAPKLIE 133

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +G++SLRR+AL+ R R DI+VI FRG ++TRL KL   +A A LLA AG+KRL 
Sbjct: 134 LPHGATVGSASLRRQALIRRLRPDINVITFRGSVQTRLRKLEEGQADATLLAVAGLKRLG 193

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           K  VI +IL+ ++FPP+P QGAI IE+ + + +  +L+  IN   T+D V+CER FLA L
Sbjct: 194 KVDVITDILDPDEFPPAPAQGAIGIESRIGDKRMNDLLAAINDSPTFDIVSCERGFLAAL 253

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG+A C+G  + F+G++L  DG+  H  +  GNR DA  +G +A Q IR  +
Sbjct: 254 DGSCRTPIAGYAVCEGDHIRFFGMILTPDGQQVHTTTIEGNRRDAEALGTNAGQAIRAEA 313

Query: 301 NKNVF-NF 307
               F ++
Sbjct: 314 GSAFFEDW 321


>gi|83855078|ref|ZP_00948608.1| porphobilinogen deaminase [Sulfitobacter sp. NAS-14.1]
 gi|83842921|gb|EAP82088.1| porphobilinogen deaminase [Sulfitobacter sp. NAS-14.1]
          Length = 317

 Score =  265 bits (677), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 131/305 (42%), Positives = 177/305 (58%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           + P RIGTR SPLA+A A+ETR+ L    +IP     I+ +   GD I +R L +IGGKG
Sbjct: 9   ENPMRIGTRGSPLAMAQAYETRARLAAAFEIPQAAFEIVVIKVTGDVIQDRPLKDIGGKG 68

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT EIE+ L++G+ID AVHS KDMPT    GL +  YLPRED RD F++ T  +L  LA
Sbjct: 69  LFTREIEEDLLAGKIDIAVHSMKDMPTIQPGGLLLDTYLPREDPRDAFVAPTLSALDQLA 128

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +V+GTSSLRR+A LL  R D+ V++FRG ++TRL KL +  A    LA AG+ RL  +
Sbjct: 129 ESAVVGTSSLRRRAQLLHQRPDLQVVEFRGNVQTRLKKLADGVAECTFLAVAGLNRLGMQ 188

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
            V    ++     P+  QGAI IE    +   + ++  I+   T   +  ERAFL  LDG
Sbjct: 189 HVPATPIDDTLMLPAVAQGAIGIERRAGDLDTEAMLAAIHDTPTGQRLAAERAFLLTLDG 248

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
           SC++ IAG A   G TL+  G VL  DG       R+G       +G D AQ +   +  
Sbjct: 249 SCETPIAGLATLDGDTLHLRGQVLRPDGSEAIAGDRSGPIAQGGQMGVDLAQDLLAQAGP 308

Query: 303 NVFNF 307
             F++
Sbjct: 309 GFFDW 313


>gi|311105076|ref|YP_003977929.1| porphobilinogen deaminase [Achromobacter xylosoxidans A8]
 gi|310759765|gb|ADP15214.1| porphobilinogen deaminase [Achromobacter xylosoxidans A8]
          Length = 315

 Score =  265 bits (677), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 114/306 (37%), Positives = 169/306 (55%), Gaps = 3/306 (0%)

Query: 1   ME-KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M   +   I TR S LAL  A   R  L  ++  P   + ++ L+T+GD+I +RTL+++G
Sbjct: 1   MSLPQRLVIATRASRLALWQAEHVRDRLRTLY--PACAVELLTLTTRGDQILDRTLSKVG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  L+ G  D AVHS KD+P  L    ++ A L R D RD F+S+T  +L 
Sbjct: 59  GKGLFVKELENALLDGRADLAVHSLKDVPVDLQAPFELCAVLDRADPRDAFVSNTHDTLA 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           DL   +V+GTSSLRR++ +     ++ V   RG ++TRL KL+  +  AI+LA AG++RL
Sbjct: 119 DLPAGAVVGTSSLRRESQIRARYPELVVKPLRGNLDTRLGKLDKGEYDAIVLAAAGLERL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
                I+ +L  ED  P+ GQGA+ IE   +    +  +  +   DT   V  ERA   +
Sbjct: 179 GLGARIRSLLEPEDSLPAAGQGALGIEIRDDRDDMRAWLAPLVSADTTSCVVAERAVSRK 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L GSC+  +A +A   G TL    +V + DG      SR+G   DA  IG  AAQ +   
Sbjct: 239 LGGSCQVPLAAYAEIAGGTLSLRALVASPDGVRMVHASRSGPVADAQAIGEAAAQALLDA 298

Query: 300 SNKNVF 305
             +++ 
Sbjct: 299 GAQDIL 304


>gi|319780787|ref|YP_004140263.1| porphobilinogen deaminase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317166675|gb|ADV10213.1| porphobilinogen deaminase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 308

 Score =  265 bits (677), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 142/306 (46%), Positives = 208/306 (67%), Gaps = 1/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+    RIGTR SPLALA A ET++ LM  H +P     ++ +ST GDRI +R L+E GG
Sbjct: 1   MQT-ILRIGTRGSPLALAQAHETQARLMAAHGMPAEAFEVVVISTSGDRIQDRPLSEAGG 59

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ L++G ID AVHS+KDMPT+L  GL++SA+LPRED RD F+   A+++ +
Sbjct: 60  KGLFTKEIEEALLAGRIDIAVHSSKDMPTQLPDGLELSAFLPREDARDAFVGKVAKAIAE 119

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +G+SSLRR+AL+ R R D+ V+ FRG ++TRL KL    A   +LAYAG+KRL 
Sbjct: 120 LPRGAKVGSSSLRRQALIRRMRPDLDVVMFRGNVQTRLRKLEEGVAAGTILAYAGLKRLG 179

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E V+ +++ ++ FPP+PGQGAI IET + +   ++++  ++   T  ++ CERAFLA L
Sbjct: 180 LEHVVTDLIPLDVFPPAPGQGAIGIETRIGDRDVEKMLAAVHDVPTGQALACERAFLAAL 239

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG+A  +   L F G++++ DG   H V   G+  DA  IG +AA+ +R  +
Sbjct: 240 DGSCRTPIAGYAAIEAGKLSFAGLIISPDGTQSHTVELQGSAQDAARIGGEAARSVRARA 299

Query: 301 NKNVFN 306
            +  F+
Sbjct: 300 GEKFFD 305


>gi|260464233|ref|ZP_05812426.1| porphobilinogen deaminase [Mesorhizobium opportunistum WSM2075]
 gi|259030036|gb|EEW31319.1| porphobilinogen deaminase [Mesorhizobium opportunistum WSM2075]
          Length = 308

 Score =  265 bits (677), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 139/306 (45%), Positives = 207/306 (67%), Gaps = 1/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+    +IGTR SPLALA A ET++ LM  H +P     ++ +ST GDRI +R L+E GG
Sbjct: 1   MQT-TLKIGTRGSPLALAQAHETQARLMAAHGMPAEAFEVVVISTSGDRIQDRPLSEAGG 59

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ L++G ID AVHS+KDMPT+L  GL++SA+L RED RD ++    +++ D
Sbjct: 60  KGLFTKEIEEALLAGAIDIAVHSSKDMPTQLPDGLELSAFLSREDARDAYVGKATKTIAD 119

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +G+SSLRR+AL+ R R D+ V+ FRG ++TRL KL+   A   +LAYAG+KRL 
Sbjct: 120 LPRGAKVGSSSLRRQALIRRMRPDLDVVMFRGNVQTRLRKLDEGVAAGTILAYAGLKRLG 179

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            + V+ +++ ++ FPP+PGQGAI IET + +   ++++  I+   T  ++ CERAFLA L
Sbjct: 180 LDHVVTDLIPLDVFPPAPGQGAIGIETRIGDRAVEKMLVAIHDVPTGQALACERAFLAAL 239

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG+A  +G  L F G++++ DG   H +   G   DA  IG +AA+ +R  +
Sbjct: 240 DGSCRTPIAGYAAIEGGKLSFAGLIISPDGTQSHTIDLQGPAQDAALIGTEAARTVRAKA 299

Query: 301 NKNVFN 306
            +  F+
Sbjct: 300 GEKFFD 305


>gi|293604316|ref|ZP_06686723.1| hydroxymethylbilane synthase [Achromobacter piechaudii ATCC 43553]
 gi|292817193|gb|EFF76267.1| hydroxymethylbilane synthase [Achromobacter piechaudii ATCC 43553]
          Length = 315

 Score =  265 bits (676), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 111/306 (36%), Positives = 163/306 (53%), Gaps = 3/306 (0%)

Query: 1   ME-KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M   +   I TR S LAL  A   R  L  ++  P   + ++ L+T+GD+I +RTL+++G
Sbjct: 1   MSLPQRLVIATRASRLALWQAEHVRDRLRTLY--PACAVELLTLTTRGDQILDRTLSKVG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  L+ G  D AVHS KD+P  L    ++ A L R D RD F+S+    L 
Sbjct: 59  GKGLFVKELENALLDGRADLAVHSLKDVPVDLQAPFELCAILDRADPRDAFVSNRYAGLA 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           DL   +V+GTSSLRR++ +      + V   RG ++TRL KL+  +  AI+LA AG++RL
Sbjct: 119 DLPAGAVVGTSSLRRESQIRARFPTLVVKPLRGNLDTRLGKLDKGEYDAIVLAAAGLQRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
             E  I+ +L+  D  P+ GQGA+ IE   +    +  +  +    T   V  ERA   +
Sbjct: 179 GLESRIRSLLDPADSLPAAGQGALGIEIRNDRDDMRAWLAPLISAATTSCVQAERAVSRK 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L GSC+  +A FA   G TL    +V + DG       R+G   DA  +G  AAQ +   
Sbjct: 239 LGGSCQVPLAAFAEISGDTLSLRALVASPDGVRMVHTRRSGPVADAQALGEAAAQELLDA 298

Query: 300 SNKNVF 305
               + 
Sbjct: 299 GAAAIL 304


>gi|269468208|gb|EEZ79901.1| porphobilinogen deaminase [uncultured SUP05 cluster bacterium]
          Length = 304

 Score =  265 bits (676), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 107/304 (35%), Positives = 169/304 (55%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
             K  +I TR SPLAL  A   ++ L   H  P  NI ++ ++T+GD+I N  L++IGGK
Sbjct: 1   MNKTLKIATRKSPLALWQAEHVKTRLETHH--PDLNIELVKMTTQGDQILNSPLSKIGGK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  ++ G  D AVHS KDMP ++ +G  + A L RE+  D F+S+   ++ DL
Sbjct: 59  GLFIKELEVGMMEGVADIAVHSMKDMPYEIPQGFALGAILKRENPFDAFVSNHFDNIDDL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              + +GT S+RR   L   R D+ ++D RG + TRL KL++ +  AI+LA AG+ RL  
Sbjct: 119 PQCAKVGTCSMRRIVQLKAIRPDLEILDLRGNVNTRLKKLDDGEYDAIILACAGLIRLGF 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E  IK+ ++ E   P+ GQGA+ IE   N+ +  +L+  +   +T   V+ ERA   +L+
Sbjct: 179 EDRIKQQISPEQSLPAVGQGAVGIEIRENDQEILDLITPLIDVETTHRVSAERAMNEKLE 238

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C   IAGF+    + +   G+V   D     +    G+   A  +G + A  +  +  
Sbjct: 239 GGCSVPIAGFSTIDNNQMTLTGLVGNVDTGTILKQQVCGDVAKAEALGVELADKLLSLGA 298

Query: 302 KNVF 305
           ++V 
Sbjct: 299 RDVL 302


>gi|241206704|ref|YP_002977800.1| porphobilinogen deaminase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240860594|gb|ACS58261.1| porphobilinogen deaminase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 309

 Score =  265 bits (676), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 164/306 (53%), Positives = 217/306 (70%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KPFRIGTR SPLALA A E R  LM  H +P     I+ L+TKGDRIT+R+L EIGG
Sbjct: 1   MQTKPFRIGTRGSPLALAQAHEARDRLMAAHHLPEDMFEIVVLTTKGDRITDRSLAEIGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFTEE+E+KL +GE+D AVHSAKDM TKL +GL +SAYLPREDIRD  I  TA+ L D
Sbjct: 61  KGLFTEELEQKLAAGELDFAVHSAKDMATKLPEGLYLSAYLPREDIRDAVIGRTARKLID 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +G+SSLRR+AL+ R R DI+VI FRG +ETRL KL   +  A LLA AG+KRL 
Sbjct: 121 LPHGATVGSSSLRRQALIRRMRPDINVITFRGLVETRLRKLEQGEVDATLLALAGLKRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           K  V+ +IL+ + FPP+P QGAICIE+ + + +  +L+  +N   T+D+V+CERAFLA L
Sbjct: 181 KVDVLTDILDPDTFPPAPAQGAICIESRIGDARVDDLLAPVNDGPTFDTVSCERAFLAAL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ I G+A C+G  + F G+++  DG+  H V+ +G+R DA  +G  A Q +R  +
Sbjct: 241 DGSCRTPIGGYAVCEGDLIRFSGLIITPDGRSQHAVTTDGHRRDAAALGTRAGQDVRARA 300

Query: 301 NKNVFN 306
               F+
Sbjct: 301 GSAFFD 306


>gi|116254224|ref|YP_770062.1| porphobilinogen deaminase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115258872|emb|CAK09980.1| putative porphobilinogen deaminase [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 309

 Score =  265 bits (676), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 163/306 (53%), Positives = 217/306 (70%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KPFRIGTR SPLALA A E R  LM  H +P     I+ L+TKGDRIT+R+L EIGG
Sbjct: 1   MQTKPFRIGTRGSPLALAQAHEARDRLMAAHHLPEDMFEIVVLTTKGDRITDRSLAEIGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFTEE+E+KL +GE+D AVHSAKDM TKL +GL +SAYLPREDIRD  I  TA+ L D
Sbjct: 61  KGLFTEELEQKLTAGELDFAVHSAKDMATKLPEGLYLSAYLPREDIRDAVIGRTARKLID 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +G+SSLRR+AL+ R R DI+V+ FRG +ETRL KL   +  A LLA AG+KRL 
Sbjct: 121 LPHGATVGSSSLRRQALIRRMRPDINVVTFRGLVETRLRKLEEGEVDATLLALAGLKRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           K  V+ +IL+ + FPP+P QGAICIE+ + + +  +L+  +N   T+D+V+CERAFLA L
Sbjct: 181 KVDVLTDILDPDTFPPAPAQGAICIESRIGDARIDDLLAPVNDIMTFDTVSCERAFLAAL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ I G+A C+G  + F G+++  DG+  H V+ +G+R DA  +G  A Q +R  +
Sbjct: 241 DGSCRTPIGGYAVCEGDLIRFSGLIITPDGRSQHAVTTDGHRRDAAALGTRAGQDVRARA 300

Query: 301 NKNVFN 306
               F+
Sbjct: 301 GSAFFD 306


>gi|89069761|ref|ZP_01157097.1| porphobilinogen deaminase [Oceanicola granulosus HTCC2516]
 gi|89044707|gb|EAR50818.1| porphobilinogen deaminase [Oceanicola granulosus HTCC2516]
          Length = 313

 Score =  264 bits (675), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 132/305 (43%), Positives = 176/305 (57%), Gaps = 1/305 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            +P +IGTR SPLALA A ETR  L   H +P     ++ + T GDR+ +R L EIGGKG
Sbjct: 8   DRPLKIGTRGSPLALAQAHETRDRLAAAHGLPGEAFEVVVIRTTGDRVVDRPLKEIGGKG 67

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT+EIE+ ++SG ID AVHS KDMP    +GL +  YLPRED RD F+S     +K L 
Sbjct: 68  LFTKEIEEAMLSGAIDIAVHSMKDMPVAQPEGLVLDCYLPREDPRDAFVSLLHAGIKALP 127

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRRKA LL  R D+ V++FRG ++TRL KL +  A A  LA AG+ RL  +
Sbjct: 128 DGATVGTSSLRRKAQLLHRRPDLHVVEFRGNVQTRLRKLESGVAVATFLAVAGLNRLGAD 187

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
            V +  +  ED  P+  QGAI IE   ++    E++  I+   T + +  ERAFLA LDG
Sbjct: 188 DVPQAPIAPEDMLPAVAQGAIGIERRASDEGLGEMLAAIHDRATGERLAAERAFLAALDG 247

Query: 243 SCKSAIAGFAYCKGS-TLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           SC++ IAG A   G   L   G +LA DG             D   +G D A+ +   + 
Sbjct: 248 SCETPIAGLAELIGDGRLRLRGEILAHDGSRCLADEAEAQIADGAALGTDMARRLLAQAG 307

Query: 302 KNVFN 306
              F+
Sbjct: 308 PGFFD 312


>gi|332706560|ref|ZP_08426621.1| hydroxymethylbilane synthase [Lyngbya majuscula 3L]
 gi|332354444|gb|EGJ33923.1| hydroxymethylbilane synthase [Lyngbya majuscula 3L]
          Length = 322

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 106/305 (34%), Positives = 160/305 (52%), Gaps = 5/305 (1%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +  RIG+R S LAL   +  +  L      P     +  +ST GD+I +  L++IG KGL
Sbjct: 10  RTIRIGSRKSQLALIQTYWVQEQLKK--HFPDREFEVQTMSTHGDKILDVALSKIGDKGL 67

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHT---AQSLKD 120
           FT+E+E  ++  EID AVHS KD+PT+L +GL +     RE+  D  + H     + ++ 
Sbjct: 68  FTKELELGMLRDEIDFAVHSLKDLPTRLPEGLVLGCVTERENPADALVMHQKHLDKQIET 127

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S+IGTSSLRR A L      +S  D RG + TRL KL+     A++LA AG+KRL 
Sbjct: 128 LPEGSIIGTSSLRRLAQLRYHFPHLSFKDVRGNLNTRLAKLDAGDYDALILAVAGLKRLD 187

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I +IL  E    + GQGA+ IE   ++ +  EL+  I H  T      ER+ L  L
Sbjct: 188 MSDRIHQILPPEISLHAVGQGALGIECREDDQEVLELLNAIAHPPTAQRCYAERSLLRAL 247

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I      +G+TL    IV + DG+   + +  G +  A N+G + A+ ++   
Sbjct: 248 EGGCQVPIGVDTQLEGNTLTLTAIVASVDGQKLVKDTIQGEQSQAENLGLELAEQLKKQG 307

Query: 301 NKNVF 305
            + + 
Sbjct: 308 AQEIL 312


>gi|33593520|ref|NP_881164.1| porphobilinogen deaminase [Bordetella pertussis Tohama I]
 gi|39931430|sp|Q7VVU9|HEM3_BORPE RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|33572876|emb|CAE42812.1| porphobilinogen deaminase [Bordetella pertussis Tohama I]
 gi|332382928|gb|AEE67775.1| porphobilinogen deaminase [Bordetella pertussis CS]
          Length = 314

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 109/300 (36%), Positives = 158/300 (52%), Gaps = 2/300 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
             I TR S LAL  A   R  L   +  P  ++ ++ L+T+GD+I +RTL+++GGKGLF 
Sbjct: 7   LTIATRASRLALWQAEHVRDLLRARY--PACSVELLTLTTRGDQILDRTLSKVGGKGLFV 64

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+ G  D AVHS KD+P  L    ++S  L R D RD F+S+   SL DL   +
Sbjct: 65  KELETALLDGRADLAVHSLKDVPVDLHAPFELSCVLERADPRDAFVSNDYGSLADLPPGA 124

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR++ +      + V   RG ++TRL KL+N    AI+LA AG++RL     I
Sbjct: 125 AVGTSSLRRESQIRARYPHLVVKPLRGNLDTRLGKLDNGDYAAIVLAAAGLERLGLAARI 184

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           + +L  +D  P+ GQGA+ IE        + ++  +    T   V  ERA    L GSC+
Sbjct: 185 RALLEPDDSLPAAGQGALGIEILQGRADVRAMLAPLGDAATLACVTAERAVSRMLGGSCQ 244

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             +A +A   G  L    +V A DG+      R G R  A  IG  AA+ +       + 
Sbjct: 245 VPLAAYARIDGDELALRALVAAPDGRRIVRAERRGPRDQAQAIGESAARDLLADGADAIL 304


>gi|149915548|ref|ZP_01904074.1| porphobilinogen deaminase [Roseobacter sp. AzwK-3b]
 gi|149810440|gb|EDM70283.1| porphobilinogen deaminase [Roseobacter sp. AzwK-3b]
          Length = 304

 Score =  264 bits (674), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 127/302 (42%), Positives = 177/302 (58%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            ++GTR SPLALA A+ETRS L     +PP    I+ + T GDRI +R L EIGGKGLFT
Sbjct: 1   MKLGTRGSPLALAQAYETRSRLSAAFDLPPEAFEIVVIKTTGDRIIDRPLKEIGGKGLFT 60

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
            EIE+ ++SGEID A+HS KDMP    +GL +  YLPRED+RD F+S     L DL   +
Sbjct: 61  REIEEAMLSGEIDIAIHSMKDMPVLQPEGLVLDTYLPREDVRDAFVSPHVGGLADLEPGA 120

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRRKA +L     + V++FRG ++TRL KL +  A    LA AG+ RL + +V 
Sbjct: 121 KVGTSSLRRKAQVLVAYPHLDVVEFRGNVQTRLKKLQDGVAACTFLAMAGLNRLGRSEVA 180

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              +  ++  P+  QGAI IE   ++ +  E++  I+   T   +  ERAFLA LDGSC+
Sbjct: 181 TAAIETDEMLPAVAQGAIGIERRRDDTRTAEMLAAIHDTPTGQRLAAERAFLAALDGSCE 240

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
           + IAG A   G TL   G VL  DG    +  ++    D   +G +  + +   +    F
Sbjct: 241 TPIAGLAELDGGTLRLRGQVLRPDGSEALDDDQSAPIEDGAKLGHEMGRKLLERAGPGFF 300

Query: 306 NF 307
           ++
Sbjct: 301 DW 302


>gi|302038053|ref|YP_003798375.1| porphobilinogen deaminase [Candidatus Nitrospira defluvii]
 gi|300606117|emb|CBK42450.1| Porphobilinogen deaminase [Candidatus Nitrospira defluvii]
          Length = 310

 Score =  263 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 113/305 (37%), Positives = 162/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +    +GTR S LA+  +   ++ L ++   P   I +  + T GD+I +  L +IGG
Sbjct: 1   MNRSTLILGTRGSKLAVHQSQWVQARLQEL--APGLTISLQRIQTSGDKILDVPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE  L+S EID AVHS KD+PT L +GL I    PRED RD  I+     L  
Sbjct: 59  KGLFVKEIEDALLSKEIDLAVHSMKDVPTALPEGLDILCVPPREDPRDALITRDGCRLDQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + IGTSSLRR+A LL +R D ++   RG ++TRL KL   +  AI+LA AG++RL 
Sbjct: 119 LKPGAKIGTSSLRRQAQLLHYRPDFTIEMLRGNLDTRLRKLREGQFDAIVLAAAGLRRLA 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I E L +    P+  QGA+ IE   ++   +EL+    H  T  +V  ERA L  L
Sbjct: 179 WDAEITEYLPVHLSLPAIAQGALGIEARSDDTFVRELLSRFEHRPTRITVTAERALLHRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA  A  +G  L   G+V + DG+        G   +A  +G   A+ +    
Sbjct: 239 EGGCQVPIAAHAALEGDRLTVDGLVASVDGRRVIRHQIQGPASEAQALGTKLAERLLADG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 GDVIL 303


>gi|254511195|ref|ZP_05123262.1| porphobilinogen deaminase [Rhodobacteraceae bacterium KLH11]
 gi|221534906|gb|EEE37894.1| porphobilinogen deaminase [Rhodobacteraceae bacterium KLH11]
          Length = 318

 Score =  263 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 126/307 (41%), Positives = 176/307 (57%), Gaps = 4/307 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGD----RITNRTLTEIGG 60
           P +IGTR SPLALA A+ETR  L     +P     I+ + T GD       +R L E+G 
Sbjct: 11  PLKIGTRGSPLALAQAYETRRRLSTAFDLPEDAFEIVVIKTTGDNRAMIDADRPLKEVGN 70

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ ++ GEID AVHS KDMP    +GL +  +LPRED+RD FIS    S+ D
Sbjct: 71  KGLFTKEIEEAMLKGEIDIAVHSTKDMPVAQPQGLVLDTFLPREDVRDAFISPGLNSIHD 130

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+A LL  R D+ V++FRG ++TRL KL +  A    LA AG++RL+
Sbjct: 131 LPRGAVVGTSSLRRRAQLLNRRPDLKVVEFRGNVQTRLKKLADGVADCTFLAMAGLRRLE 190

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
              V    ++ +D  P+  QGAI IE   ++ +A  ++  I+H +T   +  ER+ LA L
Sbjct: 191 MADVPATAISPDDMLPAIAQGAIGIERRNDDSRAAGMLAAIHHPETAQRLAAERSLLAGL 250

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG A  +   L   G VL  DG         G       +G+  A  +   +
Sbjct: 251 DGSCETPIAGLAEIRDGQLRLRGEVLRPDGTESIHEEAFGPVESGAKMGQAMADTLLKKA 310

Query: 301 NKNVFNF 307
             N F++
Sbjct: 311 GPNFFDW 317


>gi|257059870|ref|YP_003137758.1| porphobilinogen deaminase [Cyanothece sp. PCC 8802]
 gi|256590036|gb|ACV00923.1| porphobilinogen deaminase [Cyanothece sp. PCC 8802]
          Length = 320

 Score =  263 bits (672), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 112/306 (36%), Positives = 161/306 (52%), Gaps = 5/306 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            +  RIG+R S LAL   +  +  L   H  P H   +  +ST+GD+I +  L +IG KG
Sbjct: 7   TRSIRIGSRKSQLALVQTYWVQKELQRHH--PQHQFDVETMSTQGDKILDVALAKIGDKG 64

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHT---AQSLK 119
           LFT+E+E  +   ++D AVHS KD+PT L  GL +     R D  D  + +     + L 
Sbjct: 65  LFTKELEVAMEQNQVDLAVHSLKDLPTNLPTGLILGCVTERVDPADALVVNQKHLDKQLD 124

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
            L   +VIGTSSLRR A L      ++  D RG + TRL KL+  +  AI+LA AG++RL
Sbjct: 125 TLPEGAVIGTSSLRRLAQLRHHFPHLTFKDVRGNVNTRLKKLDEGEYDAIILAVAGLQRL 184

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
                I +++  E    + GQGA+ IE    + +   L+KV+ HE T D    ERAFL E
Sbjct: 185 DMSDRIHQVIPSEISLHAVGQGALGIECREGDEEVLALLKVLEHEPTRDRCYAERAFLRE 244

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I      +G TL   G+V + DG+   + + +G R  A  +GRD A  +R  
Sbjct: 245 LEGGCQVPIGVNTEIEGDTLTLTGMVASLDGQTLLKDTISGPRESAEQLGRDLANRLREA 304

Query: 300 SNKNVF 305
               V 
Sbjct: 305 GAGEVL 310


>gi|194367302|ref|YP_002029912.1| porphobilinogen deaminase [Stenotrophomonas maltophilia R551-3]
 gi|238059002|sp|B4SJT8|HEM3_STRM5 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|194350106|gb|ACF53229.1| porphobilinogen deaminase [Stenotrophomonas maltophilia R551-3]
          Length = 303

 Score =  263 bits (672), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 108/302 (35%), Positives = 160/302 (52%), Gaps = 2/302 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
             RI TR SPLAL  +      L   H  P  ++ ++P+ST+GD + +R+L  IGGKGLF
Sbjct: 3   TVRIATRKSPLALWQSEHVADRLRQAH--PGLHVELVPMSTRGDEVLDRSLAAIGGKGLF 60

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +E+E  ++ GE DCAVHS KD+P +L +   + A L R D  D F+S+   SL  L + 
Sbjct: 61  LKELELAMLRGEADCAVHSLKDVPMELDEPFALPAMLTRHDPADGFVSNLYASLDALPIG 120

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           + +GTSSLRR+A L   R D+ ++D RG + TRL KL+N    AI+LA AG++RL   + 
Sbjct: 121 ARVGTSSLRRQAQLRALRPDLQLLDLRGNVNTRLAKLDNGGYDAIVLAVAGLERLGLGER 180

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I   L    + P+P QGA+ +E   +N +   L   ++   T   V  ERA    L GSC
Sbjct: 181 IVARLQPPQWLPAPAQGAVAVECDGSNARLMALFAGLDDAATRACVEAERAMNRALHGSC 240

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
              +A  A  +G  L+  G+V ++           G   D   +G+  A+ +       +
Sbjct: 241 HVPVAAIAQWQGQDLHLQGLVGSASDGRAVRAEAVGPASDPEVLGQRVAKMLLDAGAGEL 300

Query: 305 FN 306
            N
Sbjct: 301 LN 302


>gi|218246829|ref|YP_002372200.1| porphobilinogen deaminase [Cyanothece sp. PCC 8801]
 gi|218167307|gb|ACK66044.1| porphobilinogen deaminase [Cyanothece sp. PCC 8801]
          Length = 320

 Score =  263 bits (672), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 113/306 (36%), Positives = 161/306 (52%), Gaps = 5/306 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            +  RIG+R S LAL   +  +  L   H  P H   +  +ST+GD+I +  L +IG KG
Sbjct: 7   TRSIRIGSRKSQLALVQTYWVQKELQRHH--PQHQFDVETMSTQGDKILDVALAKIGDKG 64

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFI---SHTAQSLK 119
           LFT+E+E  +   ++D AVHS KD+PT L  GL +     R D  D  +    H  + L 
Sbjct: 65  LFTKELEVAMEQNQVDLAVHSLKDLPTNLPTGLILGCVTERVDPADALVVNKKHLDKQLD 124

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
            L   +VIGTSSLRR A L      ++  D RG + TRL KL+  +  AI+LA AG++RL
Sbjct: 125 TLPEGAVIGTSSLRRLAQLRHHFPHLTFKDVRGNVNTRLKKLDEGEYDAIILAVAGLQRL 184

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
                I +++  E    + GQGA+ IE    + +   L+KV+ HE T D    ERAFL E
Sbjct: 185 DMSDRIHQVIPSEISLHAVGQGALGIECREGDEEVLALLKVLEHEPTRDRCYAERAFLRE 244

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I      +G TL   G+V + DG+   + + +G R  A  +GRD A  +R  
Sbjct: 245 LEGGCQVPIGVNTEIEGDTLTLTGMVASLDGQTLLKDTISGPRESAEQLGRDLANRLREA 304

Query: 300 SNKNVF 305
               V 
Sbjct: 305 GAGEVL 310


>gi|261856741|ref|YP_003264024.1| porphobilinogen deaminase [Halothiobacillus neapolitanus c2]
 gi|261837210|gb|ACX96977.1| porphobilinogen deaminase [Halothiobacillus neapolitanus c2]
          Length = 319

 Score =  263 bits (672), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 102/301 (33%), Positives = 157/301 (52%), Gaps = 3/301 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLA+         L  +H  P   + ++ ++TKGD++ +  L +IGGKGLF 
Sbjct: 11  IRIATRESPLAMWQTEFVADELRRLH--PGLRVELVSMTTKGDQLLDSPLAKIGGKGLFV 68

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+ G  D AVHS KD+P +   GL++ A L   D RD F+S+  +SL  L   +
Sbjct: 69  KELELALMDGRADIAVHSMKDVPMRFPDGLELIAILEGHDPRDAFVSNEYESLAALPAGA 128

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+GTSSLRR+  +      + +   RG I++R+ KL+     AI+LA AG+KR+  +  I
Sbjct: 129 VVGTSSLRRETQIRSRYPQLEIKMLRGNIQSRMAKLDRGDYDAIILAAAGLKRMGYDARI 188

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L+ E+  PS GQGA+ IE   ++     L+  + H  T   V  ERAF   L+G C+
Sbjct: 189 RAELSPEESLPSVGQGALGIEARSDDAAIHALIAPLIHAATTTRVLAERAFNTRLNGGCQ 248

Query: 246 SAIAGFAYCKGS-TLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
             I G+A  +    L+  G+V   DG +       G   +   +G   A+ +       +
Sbjct: 249 VPIGGYAMLQDDGNLWLRGMVGRPDGTLTLRDEITGAATEGEALGVALAERMLAAGADKI 308

Query: 305 F 305
            
Sbjct: 309 L 309


>gi|254522867|ref|ZP_05134922.1| porphobilinogen deaminase [Stenotrophomonas sp. SKA14]
 gi|219720458|gb|EED38983.1| porphobilinogen deaminase [Stenotrophomonas sp. SKA14]
          Length = 303

 Score =  263 bits (672), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 108/302 (35%), Positives = 158/302 (52%), Gaps = 2/302 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
             RI TR SPLAL  +      L   H  P  ++ ++P+ST+GD + +R+L  IGGKGLF
Sbjct: 3   TVRIATRKSPLALWQSEHVADRLRQAH--PGLHVELVPMSTRGDEVLDRSLAAIGGKGLF 60

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +E+E  ++ GE DCAVHS KD+P +L     + A L R D  D F+S+   SL+ L + 
Sbjct: 61  LKELELAMLRGEADCAVHSLKDVPMELDAPFALPAMLTRHDPADGFVSNLYASLEALPIG 120

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           + +GTSSLRR+A L   R D+ ++D RG + TRL KL+N    AI+LA AG++RL   + 
Sbjct: 121 ARVGTSSLRRQAQLRALRPDLELLDLRGNVNTRLAKLDNGGYDAIVLAVAGLERLGLGQR 180

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I   L    + P+P QGA+ +E    N +   L   ++   T   V  ERA    L GSC
Sbjct: 181 IVARLQPPQWLPAPAQGAVAVECDGGNARLMALFAGLDDASTRACVEAERAMNRALHGSC 240

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
              +A  A  +G  L+  G+V ++           G   D   +G+  A  +       +
Sbjct: 241 HVPVAAIAQWQGDDLHLQGLVGSASDGRAVRAEAVGPASDPDALGQRVATMLLDAGAGEL 300

Query: 305 FN 306
            N
Sbjct: 301 LN 302


>gi|119511003|ref|ZP_01630124.1| porphobilinogen deaminase [Nodularia spumigena CCY9414]
 gi|119464348|gb|EAW45264.1| porphobilinogen deaminase [Nodularia spumigena CCY9414]
          Length = 323

 Score =  263 bits (672), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 108/307 (35%), Positives = 160/307 (52%), Gaps = 5/307 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            +  RIG+R S LAL   +  R  L      P  +  +  +ST+GD I +  L +IG KG
Sbjct: 9   TRTIRIGSRKSQLALVQTYWVRDQLQK--SFPDISFEVHTMSTQGDNILDVALAKIGDKG 66

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHT---AQSLK 119
           LFT+E+E  +++ EID AVHS KD+PT L  GL ++    RE+  D  + H     + ++
Sbjct: 67  LFTKELEVGMLNQEIDFAVHSLKDLPTNLPSGLTLAVITERENPADALVVHDKYKDKQIE 126

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
            L   +VIGTSSLRR A L       +  D RG + TRL KL++ +  A++LA AG++RL
Sbjct: 127 TLPAGAVIGTSSLRRLAQLRNKFPHFTFKDVRGNLNTRLKKLDSGEYDALILAAAGLERL 186

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
                I +IL  E    + GQGA+ IE   ++ +   ++K I H +T D    ERAFL  
Sbjct: 187 GMSDRIHQILPKEISLHAVGQGALGIECRADDKEIINILKAIEHSETRDRCLAERAFLRI 246

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I       G  L   GIV + DG+   + +  G   DA  +G + A  +R  
Sbjct: 247 LEGGCQVPIGVNTVIDGDNLTLTGIVASVDGQKLVKDTVTGAAKDAEKLGAELAALLREQ 306

Query: 300 SNKNVFN 306
             + +  
Sbjct: 307 GAQEILE 313


>gi|186683929|ref|YP_001867125.1| porphobilinogen deaminase [Nostoc punctiforme PCC 73102]
 gi|186466381|gb|ACC82182.1| porphobilinogen deaminase [Nostoc punctiforme PCC 73102]
          Length = 336

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 105/305 (34%), Positives = 160/305 (52%), Gaps = 5/305 (1%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +  RIG+R S LAL   +  +  L      P     +  +ST+GD+I +  L +IG KGL
Sbjct: 23  RTIRIGSRKSQLALVQTYWVQEQLQK--SFPDITFEVHTMSTQGDKILDVALAKIGDKGL 80

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFI---SHTAQSLKD 120
           FT+E+E  +++ EID AVHS KD+PT L +GL ++A   RE+  D  +    H  + +  
Sbjct: 81  FTKELEVGMLNQEIDFAVHSLKDLPTNLPEGLTLAAITERENPADALVVHEKHKDKQIDT 140

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +VIGTSSLRR A L       +  D RG + TRL KL+  +  A++LA AG++RL 
Sbjct: 141 LPEGAVIGTSSLRRLAQLRHHFPHFTFKDVRGNLITRLAKLDAGEYDALILAAAGLERLG 200

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               + +I+  E    + GQGA+ IE   ++ +   L+K I H  T D    ER+FL  L
Sbjct: 201 MSDRVHQIIPKEISLHAVGQGALGIECRADDSELLTLLKAIEHPATRDRCLAERSFLRSL 260

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I       G  L   GIV + DG+   + +  G   +A  +G + A+ +R   
Sbjct: 261 EGGCQVPIGVNTEISGENLTLTGIVASIDGQKLVKDTVTGIANNAEALGTELAELLRQQG 320

Query: 301 NKNVF 305
            + + 
Sbjct: 321 AQEIL 325


>gi|192360982|ref|YP_001983840.1| porphobilinogen deaminase [Cellvibrio japonicus Ueda107]
 gi|190687147|gb|ACE84825.1| porphobilinogen deaminase [Cellvibrio japonicus Ueda107]
          Length = 315

 Score =  263 bits (671), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 110/300 (36%), Positives = 170/300 (56%), Gaps = 2/300 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR S LAL  A   ++ L   H  P   + ++PL+++GD+I +  L ++GGKGLF 
Sbjct: 8   LRIATRKSLLALWQADYVKTELERHH--PGLRVELVPLTSRGDKILDVPLAKVGGKGLFV 65

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E+ L++G  D AVHS KD+P +   GL ++   PRED RD F+S+   SL DL   +
Sbjct: 66  KELEQALLAGAADIAVHSMKDVPMEFPDGLGLAVICPREDARDAFVSNRFASLDDLPAGA 125

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+GTSSLRR+  LL  R D+ V   RG ++TRL KL++ +  AI+LA AG+ RL+ +  I
Sbjct: 126 VVGTSSLRRQCQLLARRPDLQVKFLRGNVQTRLQKLDDGEYDAIILAAAGLIRLELQARI 185

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           + ++  E   P+ GQGA+ IE  + +     L++ ++H+ T + V  ERA    L G C+
Sbjct: 186 RSLIAPEVSLPAGGQGAVGIECRMQDQATLALLQPLHHQPTAEQVLAERAMNRRLQGGCQ 245

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             IA +A  +G  L+  G+V A DG         G   +   +G   A+ +      ++ 
Sbjct: 246 VPIACYALQQGGELWLRGLVGAPDGSQMLFDEIRGPVAEGEQMGIQLAERLLAAGADSIL 305


>gi|254466587|ref|ZP_05079998.1| porphobilinogen deaminase [Rhodobacterales bacterium Y4I]
 gi|206687495|gb|EDZ47977.1| porphobilinogen deaminase [Rhodobacterales bacterium Y4I]
          Length = 323

 Score =  263 bits (671), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 137/307 (44%), Positives = 181/307 (58%), Gaps = 4/307 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGD----RITNRTLTEIGG 60
           P +IGTR SPLALA A+ETRS L     +P     I+ + T GD       ++ L E+GG
Sbjct: 15  PLKIGTRGSPLALAQAYETRSRLAAAFDLPQEAFEIVVIRTTGDNQALIAADKPLKELGG 74

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ L+SG ID AVHS KDMP    +GL +  YLPRED+RD FIS   +SL D
Sbjct: 75  KGLFTKEIEEDLLSGAIDIAVHSMKDMPVAQPEGLALDTYLPREDVRDAFISPALKSLHD 134

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           LA  +V+GTSSLRR+A LL  R D+ V++FRG ++TRL KL+   A    LA AG+ RL 
Sbjct: 135 LAEGAVVGTSSLRRRAQLLNRRPDLKVVEFRGNVQTRLRKLSEGVADCTFLAMAGLNRLA 194

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
              V    +   D  P+  QGAI IE   ++ +A E++  I+  +T   +  ERAFLA L
Sbjct: 195 MADVPANPIETSDMLPAVAQGAIGIERRADDGRAAEMLAAIHDGETGLRLAAERAFLAAL 254

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG A   GSTL   G VL  DG       +     D   +GR+ A  +   +
Sbjct: 255 DGSCETPIAGLAELHGSTLRLRGEVLRPDGSESISDDQTCPVEDGAELGREMAAKLLEKA 314

Query: 301 NKNVFNF 307
            K  F++
Sbjct: 315 GKGFFDW 321


>gi|332701796|ref|ZP_08421884.1| Porphobilinogen deaminase [Desulfovibrio africanus str. Walvis Bay]
 gi|332551945|gb|EGJ48989.1| Porphobilinogen deaminase [Desulfovibrio africanus str. Walvis Bay]
          Length = 316

 Score =  263 bits (671), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 107/305 (35%), Positives = 161/305 (52%), Gaps = 2/305 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            +    I TR S LAL  A   +S L++ H      + ++ L T+GD+I +  L ++GGK
Sbjct: 1   MRTKLTIATRGSMLALWQAEHVKSMLVERHS--GLEVELLMLKTQGDKILDVPLAKVGGK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +EIE+ L+ G  D AVHS KD+PT+L +GL I     RE+  D  +S    +L  L
Sbjct: 59  GLFVKEIEEALLDGRADLAVHSMKDVPTELPEGLIIGVTPKREEPADALLSVRYDNLAAL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +VIGTSS RR+A LL  R D  +   RG + TRL KL + +  AI+LA AG+ RL  
Sbjct: 119 PEGAVIGTSSFRRQAQLLMRRPDFEIKMLRGNVNTRLRKLMDGEYDAIVLAMAGLNRLGL 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
                E+L   DF P+  QG + IE   ++ +  +++  ++H +T   V  ER FL  L+
Sbjct: 179 SAPKMEVLGPPDFLPAVSQGVLGIEYRRDDAELADMLAFMDHPETRVRVQAERGFLTALE 238

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  IAG+A  +G  +   G+V   DG+      R+     A  +G   A+ +     
Sbjct: 239 GGCQVPIAGYAEVRGDEVRLTGLVADLDGRRVIRRERSSPAGQAWELGETLAREVLDAGG 298

Query: 302 KNVFN 306
           + +  
Sbjct: 299 REILE 303


>gi|254414246|ref|ZP_05028013.1| porphobilinogen deaminase [Microcoleus chthonoplastes PCC 7420]
 gi|196178921|gb|EDX73918.1| porphobilinogen deaminase [Microcoleus chthonoplastes PCC 7420]
          Length = 321

 Score =  262 bits (670), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 108/306 (35%), Positives = 163/306 (53%), Gaps = 5/306 (1%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +  RIG+R S LAL   +  +  L   +  P  +  +  +ST GD+I +  L++IG KGL
Sbjct: 10  RTIRIGSRKSQLALVQTYWVQEQLHKHY--PDRDFEVQTMSTHGDKILDVALSKIGDKGL 67

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFI---SHTAQSLKD 120
           FT+E+E  +++ EID AVHS KD+PT L +GL +     RE+  D  +    H  + L  
Sbjct: 68  FTKELEVGMLNQEIDLAVHSLKDLPTALPEGLVLGCVTERENPADALVLHAKHQGKQLDT 127

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +VIGTSSLRR A L       +  D RG + TRL KL+  +  A++LA AG+KRL 
Sbjct: 128 LPEGAVIGTSSLRRLAQLRYHFPHFTFKDIRGNLNTRLGKLDAGEFDALILAAAGLKRLD 187

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I +++  E    + GQGA+ IE   ++P+  +++K I H  T      ERAFL EL
Sbjct: 188 MSDRIHQVIPSEISLHAVGQGALGIECRGDDPEILDVLKAIEHSPTAQRCYAERAFLREL 247

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I      KG+ L   G+V   DG    + +  G   +A  +G + AQ +R   
Sbjct: 248 EGGCQVPIGVNTEIKGNNLILTGMVARLDGTSLIKDTVTGEATEAEALGVELAQLLRQQG 307

Query: 301 NKNVFN 306
            + + +
Sbjct: 308 AQEILD 313


>gi|33597222|ref|NP_884865.1| porphobilinogen deaminase [Bordetella parapertussis 12822]
 gi|33601068|ref|NP_888628.1| porphobilinogen deaminase [Bordetella bronchiseptica RB50]
 gi|39931443|sp|Q7W785|HEM3_BORPA RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|39931458|sp|Q7WKM1|HEM3_BORBR RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|33573649|emb|CAE37934.1| porphobilinogen deaminase [Bordetella parapertussis]
 gi|33575503|emb|CAE32581.1| porphobilinogen deaminase [Bordetella bronchiseptica RB50]
          Length = 314

 Score =  262 bits (670), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 109/300 (36%), Positives = 157/300 (52%), Gaps = 2/300 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
             I TR S LAL  A   R  L   +  P  ++ ++ L+T+GD+I +RTL+++GGKGLF 
Sbjct: 7   LTIATRASRLALWQAEHVRDLLRARY--PACSVELLTLTTRGDQILDRTLSKVGGKGLFV 64

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+ G  D AVHS KD+P  L    ++S  L R D RD F+S+   SL DL   +
Sbjct: 65  KELETALLDGRADLAVHSLKDVPVDLHAPFELSCVLERADPRDAFVSNDYGSLADLPPGA 124

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR++ +      + V   RG ++TRL KL+N    AI+LA AG++RL     I
Sbjct: 125 AVGTSSLRRESQIRARYPHLVVKPLRGNLDTRLGKLDNGDYAAIVLAAAGLERLGLAARI 184

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           + +L   D  P+ GQGA+ IE        + ++  +    T   V  ERA    L GSC+
Sbjct: 185 RALLEPADSLPAAGQGALGIEILQGRADVRAMLAPLGDAATLACVTAERAVSRMLGGSCQ 244

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             +A +A   G  L    +V A DG+      R G R  A  IG  AA+ +       + 
Sbjct: 245 VPLAAYARIDGDELALRALVAAPDGRRIVRAERRGPRDQAQAIGESAARDLLADGADAIL 304


>gi|84685204|ref|ZP_01013103.1| porphobilinogen deaminase [Maritimibacter alkaliphilus HTCC2654]
 gi|84666936|gb|EAQ13407.1| porphobilinogen deaminase [Rhodobacterales bacterium HTCC2654]
          Length = 319

 Score =  262 bits (670), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 136/310 (43%), Positives = 183/310 (59%), Gaps = 5/310 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGD----RITNRTLTEI 58
            KP +IGTR SPLALA A+ETR  L     +P     I+ + T GD       +R L EI
Sbjct: 9   TKPLKIGTRGSPLALAQAYETRDRLAAAFDLPETAFEIVVIKTTGDDRAMIAADRPLKEI 68

Query: 59  GGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSL 118
           G KGLFT EIE +L++G ID AVHS KDMPT+   GL +  YLPRED RD FIS     +
Sbjct: 69  GNKGLFTREIEDQLLNGGIDLAVHSMKDMPTEQPPGLTLDCYLPREDTRDAFISLGGGGI 128

Query: 119 KDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR 178
             LA  +V+GTSSLRRKA LL  R D++V++FRG ++TRL KL +  A A  LA AGI R
Sbjct: 129 HGLAEGAVVGTSSLRRKAQLLNRRPDLNVVEFRGNVQTRLTKLRDGVAEATFLAMAGITR 188

Query: 179 LKK-EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           L   ++V  + +  ED  P+  QGAI IE   ++    ++++ I+H  T   +  ER+FL
Sbjct: 189 LGMLDEVPHDAIAPEDMLPAIAQGAIGIERRSHDTNVADMLEAIHHGGTERRLAAERSFL 248

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
           A LDGSC++ IAG A   G TL   G +L +DG        +G   D  ++GR  AQ + 
Sbjct: 249 ATLDGSCETPIAGLAEIDGGTLRLRGEILRTDGSEALADEISGAVEDGPDMGRALAQKLL 308

Query: 298 FISNKNVFNF 307
             +  + F++
Sbjct: 309 SRAGPDFFDW 318


>gi|254483263|ref|ZP_05096495.1| porphobilinogen deaminase [marine gamma proteobacterium HTCC2148]
 gi|214036486|gb|EEB77161.1| porphobilinogen deaminase [marine gamma proteobacterium HTCC2148]
          Length = 310

 Score =  262 bits (670), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 109/306 (35%), Positives = 160/306 (52%), Gaps = 3/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +   I TR SPLAL  A   R +LM  H  P   + ++ ++++GD++ +  L ++GG
Sbjct: 1   MPTRTLTIATRESPLALWQAEYVRDALMSAH--PRLEVNLLGMTSRGDQLLDVPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     RED  D F+S+  +SL  
Sbjct: 59  KGLFVKELETALLDGSADIAVHSMKDVPMSFPEGLTLGVICEREDPTDAFVSNNFESLAQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+ V   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSVVGTSSLRRECQLRARRPDLQVKFLRGNVNTRLRKLDEGQYDAIILASAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I + ++++D  P+ GQGA+ IE    +    EL++ ++H  T   V  ERA    L
Sbjct: 179 FGERIADSISVDDSLPAGGQGAVGIELREGDGDVLELLQTVHHPLTAQRVIAERAMNQRL 238

Query: 241 DGSCKSAIAGFAY-CKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           +G C+  IA FA       L   G+V   DG          +  DA N+G   A  +   
Sbjct: 239 NGGCQVPIACFAEYLDNGHLRLRGLVGRPDGSEVLRAEAISSPEDAENLGISVANELLVQ 298

Query: 300 SNKNVF 305
               + 
Sbjct: 299 GAAAIL 304


>gi|30248604|ref|NP_840674.1| porphobilinogen deaminase [Nitrosomonas europaea ATCC 19718]
 gi|39931498|sp|Q82WS2|HEM3_NITEU RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|30180199|emb|CAD84501.1| Porphobilinogen deaminase [Nitrosomonas europaea ATCC 19718]
          Length = 308

 Score =  262 bits (670), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 114/306 (37%), Positives = 164/306 (53%), Gaps = 3/306 (0%)

Query: 1   MEK-KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M   K   I +R S LAL  A   R  L++++  P  +I I+ ++TKGD+I + +L++IG
Sbjct: 1   MSSPKKIVIASRESQLALWQANFIRGRLLELY--PQTDITILGMTTKGDQILDVSLSKIG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  L  G  D AVHS KD+P  +  G  ++A   RED RD F+S+   SL+
Sbjct: 59  GKGLFIKELELALEDGRADIAVHSMKDVPMIVPSGFTLAAITEREDPRDAFVSNDFSSLE 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           +L   SV+GTSSLRR++ L      + V   RG ++TRL KL+  +  AI+LA AG+KRL
Sbjct: 119 ELPAGSVVGTSSLRRESQLRARFPHLQVRPLRGNVQTRLRKLDEGEYSAIILAAAGLKRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
           +    I  +L  E   P+ GQGA+ IE   N+P   E +K ++H  T   V  ERA    
Sbjct: 179 ELGYRISMLLPPELSLPAVGQGALGIECRDNDPDMVEWMKPLHHAATACCVEAERAMSRM 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L GSC+  + GFA      L   G V   DG         G       +G+  AQ ++  
Sbjct: 239 LGGSCQVPLGGFAEIFEDVLTLRGFVATPDGSRMIADKLCGKPESGEQVGQQLAQNLKAH 298

Query: 300 SNKNVF 305
             + + 
Sbjct: 299 GAEEIL 304


>gi|170078218|ref|YP_001734856.1| porphobilinogen deaminase [Synechococcus sp. PCC 7002]
 gi|169885887|gb|ACA99600.1| porphobilinogen deaminase [Synechococcus sp. PCC 7002]
          Length = 321

 Score =  262 bits (669), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 105/308 (34%), Positives = 160/308 (51%), Gaps = 6/308 (1%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            K+  RIG+R S LAL   +  R  L   +  P     +  + T+GD++ +  L++IG K
Sbjct: 7   SKRTVRIGSRKSQLALVQTYWVRDELQKAY--PEITFEVQTMETQGDKVLDVALSKIGDK 64

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFI---SHTAQSL 118
           GLFT+E+E  ++ GE D AVHS KD+PT L +GL +     R D  D  +    H  + L
Sbjct: 65  GLFTQELEDGMLKGETDFAVHSLKDLPTNLPEGLMLGCVTERVDPADALVVNEKHRDKKL 124

Query: 119 KDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR 178
           + L   SVIGTSSLRR A L      +   D RG + TRL KL+  +  AI+LA AG++R
Sbjct: 125 ETLPSGSVIGTSSLRRLAQLRHHFPHLEFKDIRGNVNTRLAKLDRGEYDAIILAAAGLQR 184

Query: 179 LKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVI-NHEDTWDSVNCERAFL 237
           L     I +I++ +    + GQGA+ IE    + +   L++ +  H ++ D    ER+FL
Sbjct: 185 LDFGDRIHQIISSDISLHAVGQGALGIECRDGDEEILGLLRPVLEHAESRDRCYAERSFL 244

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            +L+G C+  I      +G  L   G+V + DG+       +G+R DA  +G + AQ   
Sbjct: 245 RQLEGGCQVPIGVNTTIEGDRLTLVGMVASLDGQTLIRDEVSGSRADAEKLGIELAQKAI 304

Query: 298 FISNKNVF 305
                 + 
Sbjct: 305 AQGADKIL 312


>gi|110678608|ref|YP_681615.1| porphobilinogen deaminase [Roseobacter denitrificans OCh 114]
 gi|109454724|gb|ABG30929.1| porphobilinogen deaminase [Roseobacter denitrificans OCh 114]
          Length = 314

 Score =  262 bits (669), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 136/303 (44%), Positives = 182/303 (60%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P +IGTR SPLA+A AFETR+ LM    +P +   I+ +   GD I +R L +IGGKGLF
Sbjct: 11  PLKIGTRGSPLAMAQAFETRARLMQAFDLPENAFTIVVIKVTGDMIQDRALKDIGGKGLF 70

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T EIE+ L+S +ID AVHS KDMPT    GL +  YLPRED+RD FIS T + + DLA  
Sbjct: 71  TREIEEDLLSEKIDIAVHSMKDMPTLQPDGLILDTYLPREDVRDAFISPTLKGIADLAQG 130

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           +V+GTSSLRRKA LL  R D++V++FRG ++TRL KL +  A    LA AG+ RLK ++V
Sbjct: 131 AVVGTSSLRRKAQLLNRRPDLNVVEFRGNVQTRLKKLADGVAECTFLACAGLSRLKMDEV 190

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
               +  +   P+  QGAI IE  + +    EL+  I+   T   +  ER FL  LDGSC
Sbjct: 191 PATPIETDHMLPAVAQGAIGIERRIADTNTAELLSAIHDGPTGQRLAAERNFLLTLDGSC 250

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           ++ IAG A   G  L   G VL  DG       R+G   D   +GRD A+ +   +  + 
Sbjct: 251 ETPIAGLAELSGDHLRLRGEVLRPDGSEALNGERSGPISDGAAMGRDLAEKLLKRAGPSF 310

Query: 305 FNF 307
           F++
Sbjct: 311 FDW 313


>gi|255658552|ref|ZP_05403961.1| hydroxymethylbilane synthase [Mitsuokella multacida DSM 20544]
 gi|260849356|gb|EEX69363.1| hydroxymethylbilane synthase [Mitsuokella multacida DSM 20544]
          Length = 315

 Score =  262 bits (669), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 114/306 (37%), Positives = 170/306 (55%), Gaps = 3/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+     IGTR S LAL  A      L   +  P   +    ++TKGD+I +  L +IGG
Sbjct: 1   MKNDTIVIGTRSSKLALWQADYVADCLRKRY--PELRVEKKLMTTKGDKILDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+E+E+ +++G ID AVHS KDMPT++ +GL ISA   R D  D  +S   ++L++
Sbjct: 59  KGLFTKELEQDMLAGGIDIAVHSLKDMPTEVPEGLVISAITERFDPGDAVVSPKYRTLEN 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +GTSSLRRKA LL  R D+ + D RG + TRL KL      AI+LA AG+KRL 
Sbjct: 119 LPQGAKVGTSSLRRKAQLLHARPDLQISDLRGNVNTRLEKLEREHFDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I E+L  E   P+ GQGA+ IET  N+ + + L+  +N E T      ERAFLA +
Sbjct: 179 FADRITEVLPREMVLPAVGQGALAIETRENDREVRNLIAFLNDEATVACARAERAFLARV 238

Query: 241 DGSCKSAIAGFAYCK-GSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           +G C+  +  +A  +    L+   ++ + DG   +  +  G+  +A ++G   A  +  +
Sbjct: 239 EGGCQVPVGVYAVPEAEGRLHVEAVIASLDGARLYRDAAVGSAAEAESLGTALADKLLAM 298

Query: 300 SNKNVF 305
               + 
Sbjct: 299 GGIAIL 304


>gi|254474607|ref|ZP_05087993.1| porphobilinogen deaminase [Ruegeria sp. R11]
 gi|214028850|gb|EEB69685.1| porphobilinogen deaminase [Ruegeria sp. R11]
          Length = 320

 Score =  262 bits (669), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 132/307 (42%), Positives = 180/307 (58%), Gaps = 4/307 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGD----RITNRTLTEIGG 60
           P +IGTR SPLALA A+ETR+ L     +P     I+ + T GD       ++ L E+GG
Sbjct: 12  PLKIGTRGSPLALAQAYETRARLAAAFDLPDDAFEIVVIKTTGDNQALIAADKPLKELGG 71

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ L+SG ID AVHS KDMP +   GL +  YLPRED+RD FIS +  S+ D
Sbjct: 72  KGLFTKEIEEDLLSGAIDIAVHSMKDMPVQQPDGLVLDTYLPREDVRDAFISPSLTSIHD 131

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           LA  +V+GTSSLRR+A LL  R D++V+ FRG ++TRL KL+   A    LA AG+ RL 
Sbjct: 132 LAKGAVVGTSSLRRRAQLLHRRPDLNVVQFRGNVQTRLRKLSEGVAECTFLAMAGLNRLA 191

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
              V    +   D  P+  QGAI IE   ++ +A +++  I+ + T   +  ERAFLA L
Sbjct: 192 MADVPANAIETNDMLPAVAQGAIGIERRTSDNRAADMLAAIHDQQTGQRLAAERAFLAAL 251

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG A   G+TL   G VL  DG       +     D   +GR  A  +   +
Sbjct: 252 DGSCETPIAGLAELDGTTLRLRGEVLRPDGSEAISDDQRCPIEDGAELGRAMAAKLLDQA 311

Query: 301 NKNVFNF 307
            +  F++
Sbjct: 312 GEGFFDW 318


>gi|114765839|ref|ZP_01444932.1| porphobilinogen deaminase [Pelagibaca bermudensis HTCC2601]
 gi|114541838|gb|EAU44875.1| porphobilinogen deaminase [Roseovarius sp. HTCC2601]
          Length = 319

 Score =  262 bits (669), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 131/307 (42%), Positives = 178/307 (57%), Gaps = 4/307 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGD----RITNRTLTEIGG 60
           P +IGTR SPLALA A ETR  L     +P     I+ + T GD       +R L EIG 
Sbjct: 11  PLKIGTRGSPLALAQAHETRDRLAAAFDLPQDAFEIVVIKTTGDDRAMIAADRPLKEIGN 70

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE++L+SG ID AVHS KDMPT+  +GL +  YLPRED RD FIS     L  
Sbjct: 71  KGLFTKEIEEQLLSGGIDIAVHSMKDMPTEQPEGLVLDCYLPREDERDAFISPGHAGLAA 130

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+A LL  R D+ V++FRG ++TRL KL +  A A  LA AG++R+ 
Sbjct: 131 LPEGTVVGTSSLRRRAQLLNRRPDLQVVEFRGNVQTRLKKLEDGVAAATFLAMAGLRRMD 190

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
              +    ++ +D  P+  QGAI IE   ++ +  +++  I+  DT   +  ER FLA L
Sbjct: 191 MTDIPMTAMSPDDMLPAIAQGAIGIERRSDDSRTGDMLAAIHDTDTATRLAAERTFLAAL 250

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG A   G  L   G +LA DG   H    +G   D   +GR  A+ +   +
Sbjct: 251 DGSCETPIAGLAELDGDRLRLRGEILAPDGSASHAGELSGPAADGPAMGRALAEELLARA 310

Query: 301 NKNVFNF 307
             + F +
Sbjct: 311 GPDFFAW 317


>gi|297617596|ref|YP_003702755.1| porphobilinogen deaminase [Syntrophothermus lipocalidus DSM 12680]
 gi|297145433|gb|ADI02190.1| porphobilinogen deaminase [Syntrophothermus lipocalidus DSM 12680]
          Length = 316

 Score =  262 bits (668), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 120/302 (39%), Positives = 173/302 (57%), Gaps = 2/302 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
             RIGTR S LAL  A      L D    P H   I  + TKGD+IT+  L++IG KGLF
Sbjct: 10  KVRIGTRGSRLALWQANYVVKRLRDC--FPGHEFEITVIKTKGDKITDVALSKIGDKGLF 67

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T+EIE  L+  EID AVHS KD+PT L +G++++A L RE+  DV +S    SL  L   
Sbjct: 68  TKEIEMALLREEIDIAVHSLKDLPTTLPEGIRLAAVLERENPLDVLLSFKGYSLSGLPRG 127

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           + IGTSSLRR A L R R DI  ++ RG +ETR+ K+ +     I+LAYAG+KR+    +
Sbjct: 128 ARIGTSSLRRTAQLKRLRPDIETVNLRGNVETRIRKMEDEGLDGIVLAYAGVKRMGFLHL 187

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           + EIL+ +   P+ GQG I +E   +   A+ELVK +NH+ TW  +  ERAFL  ++G C
Sbjct: 188 VTEILHPDQVIPAVGQGVIALEIKEDGKVAEELVKPLNHQPTWAEITAERAFLKAIEGGC 247

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           +      A  +   L   G+V + DG++ +    +G+   A  +G + A+ I  +   ++
Sbjct: 248 QVPCGCHASYQEGYLTVDGLVASLDGQVVYRDRVSGSEAFAQQLGEELARRILAMGGGSL 307

Query: 305 FN 306
             
Sbjct: 308 LE 309


>gi|260431649|ref|ZP_05785620.1| porphobilinogen deaminase [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415477|gb|EEX08736.1| porphobilinogen deaminase [Silicibacter lacuscaerulensis ITI-1157]
          Length = 320

 Score =  261 bits (667), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 130/307 (42%), Positives = 178/307 (57%), Gaps = 4/307 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGD----RITNRTLTEIGG 60
           P +IGTR SPLALA A ETR  L D   +P     I+ + T GD       +R L EIG 
Sbjct: 11  PLKIGTRGSPLALAQAHETRQRLCDAFDLPEQAFEIVVIKTTGDNRAMIDADRPLKEIGN 70

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ ++ G ID AVHS KDMP +  +GL +  +LPRED+RD FIS    S+ D
Sbjct: 71  KGLFTKEIEEAMLGGYIDIAVHSTKDMPVEQPQGLVLDTFLPREDVRDAFISPRLNSIHD 130

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+A LL  R D++V++FRG ++TRL KL +  A    LA AG++RL 
Sbjct: 131 LPEGAVVGTSSLRRRAQLLYRRPDLNVVEFRGNVQTRLKKLADGVAECTFLAMAGLRRLN 190

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            + V    ++ +D  P+  QG I IE   ++ +A E+++ I+H +T   +  ERA LA L
Sbjct: 191 MQDVPATAISPDDMLPAIAQGTIGIERRADDHRAAEMLEAIHHPETAQRLAAERALLAAL 250

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG A      L   G VL  DG       + G   DA  +GR  A  +   +
Sbjct: 251 DGSCETPIAGLAEITDGQLRLRGEVLRPDGSESVVSEQMGATEDATEMGRAMASDLLRQA 310

Query: 301 NKNVFNF 307
               F +
Sbjct: 311 GPGFFEW 317


>gi|114566228|ref|YP_753382.1| hydroxymethylbilane synthase [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
 gi|122318683|sp|Q0AZ43|HEM3_SYNWW RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|114337163|gb|ABI68011.1| hydroxymethylbilane synthase [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
          Length = 306

 Score =  261 bits (667), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 123/303 (40%), Positives = 176/303 (58%), Gaps = 2/303 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            +  R+GTR S LAL  A    S L     IP   + I  + T GD+I +  L++IG KG
Sbjct: 1   MRNLRLGTRGSQLALWQARHVASLLES--SIPDLKVEIKTIKTTGDKILDVALSKIGDKG 58

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT+EIEK+L+ GEID AVHS KD+P++L  GL I+A L RED RDV +SH   SL DL 
Sbjct: 59  LFTKEIEKELLDGEIDIAVHSMKDLPSELPPGLCIAAVLEREDPRDVLLSHKNYSLADLP 118

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             ++IGTSSLRR A L  WR D+ ++D RG +ETR+ K+       I+LA AG+KRL  E
Sbjct: 119 QAALIGTSSLRRIAQLKAWRPDLQLVDMRGNVETRIRKMKEQDLDGIILACAGVKRLGLE 178

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           ++I + L      P+ GQG I +E   +     +L+  INH+D++ +   ER FL EL G
Sbjct: 179 EMISDYLPAHLVLPAVGQGMIAVEARSDEQDVLKLLSRINHQDSFLAGQAERGFLHELGG 238

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  +A  A  +G  L+  G++ + DGK  +  S + +  +A   GR+ A+ +      
Sbjct: 239 GCQVPVASLAELQGGQLHIRGLIASLDGKEKYSGSSDCSPPEAEEAGRELARSLLQQGGA 298

Query: 303 NVF 305
            + 
Sbjct: 299 AIL 301


>gi|323141796|ref|ZP_08076663.1| hydroxymethylbilane synthase [Phascolarctobacterium sp. YIT 12067]
 gi|322413719|gb|EFY04571.1| hydroxymethylbilane synthase [Phascolarctobacterium sp. YIT 12067]
          Length = 306

 Score =  261 bits (667), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 113/304 (37%), Positives = 173/304 (56%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            K    IGTR S LAL  +    + L   +  P   +V+  + TKGDRI +  L +IGGK
Sbjct: 1   MKAKLTIGTRQSLLALWQSNHIAALLRKEY--PECEVVLKKIVTKGDRILDVPLAQIGGK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLFT+EIE+ L+ G +D AVHS KDMPT L +GL ++A   R ++ D F+S+   + ++L
Sbjct: 59  GLFTKEIEEDLLDGTVDLAVHSLKDMPTVLPEGLCLTAITERANVGDAFVSNKYATFEEL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
            L SV+GTSSLRRKA LL  R D+ + D RG ++TRL KL+     AI+LA AG++RL  
Sbjct: 119 PLGSVVGTSSLRRKAQLLAKRPDLEIRDLRGNVDTRLRKLDEGLYDAIILAAAGLERLGH 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
              I  ++  +   P+ GQGA+ IE    + + ++++  +N  +T  + + ERAFL  L+
Sbjct: 179 GDRISSLIPADVCLPAVGQGALAIEARTADKEVRDMLSFLNDLNTKQATDAERAFLGLLE 238

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I   A  +G  +    I+ A DG      + NG   DA+++G+   + +     
Sbjct: 239 GGCQVPIGVHADVEGENIRIEAIIAALDGSTILRDTINGKADDAVSLGQQLGKKMLAAGG 298

Query: 302 KNVF 305
           + + 
Sbjct: 299 QEIL 302


>gi|119386338|ref|YP_917393.1| porphobilinogen deaminase [Paracoccus denitrificans PD1222]
 gi|166217779|sp|A1B853|HEM3_PARDP RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|119376933|gb|ABL71697.1| porphobilinogen deaminase [Paracoccus denitrificans PD1222]
          Length = 313

 Score =  261 bits (667), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 130/305 (42%), Positives = 179/305 (58%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           + P RIGTR S LALA A ETR  LM  H +      I+ + T GDR+ +R L EIGGKG
Sbjct: 8   QNPIRIGTRGSALALAQAHETRDRLMAAHGLAADAFRIVVIKTTGDRVLDRPLKEIGGKG 67

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT EIE  L++ EID AVHS KDMPT   +GL I  YLPRED+RD F+S    ++ +L 
Sbjct: 68  LFTREIEDALLAHEIDIAVHSMKDMPTIQPEGLVIDCYLPREDVRDAFVSAQFAAISELP 127

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +V+G+SSLRR+A L   R D+ +++FRG ++TRL KL +  A A  LA AG+ RL   
Sbjct: 128 QGAVVGSSSLRRRAQLAARRPDLKLVEFRGNVQTRLKKLEDGVAVATFLAMAGLTRLGML 187

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
            V +  +  ++  P+  QG I +E   ++ +   L+  I+  D+   V  ERAFLA LDG
Sbjct: 188 HVARGAVEPDEMLPAVAQGCIGVERRADDARTASLLAAISDRDSALRVTAERAFLARLDG 247

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
           SC++ IAG A  +G  L   G +L  DG       R G   D   +G D A+ +R  +  
Sbjct: 248 SCQTPIAGLAELQGDRLRLRGEILRPDGSEVIAAERVGPAADGAAMGTDLAEELRGRAPA 307

Query: 303 NVFNF 307
           + F++
Sbjct: 308 DFFDW 312


>gi|300024951|ref|YP_003757562.1| porphobilinogen deaminase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526772|gb|ADJ25241.1| porphobilinogen deaminase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 310

 Score =  261 bits (667), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 138/305 (45%), Positives = 184/305 (60%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+    RIGTR SPLALA A E R  L   H +    I I  + T GDR+T+R L++IGG
Sbjct: 1   MQAARIRIGTRGSPLALAQAHEVRDRLAKAHGLSEDAISITIIKTTGDRVTDRPLSDIGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE  L + EID AVHS KDM T+L  GL + A LPRED RD FIS    ++  
Sbjct: 61  KGLFTKEIEDALFAREIDIAVHSMKDMQTELPDGLALGAVLPREDPRDAFISLKHANISA 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRRK+ +L  R D+SVIDFRG +ETRL KL +  A A  LA AG+ RL 
Sbjct: 121 LPTGAIVGTSSLRRKSQVLSIRPDLSVIDFRGNVETRLRKLKDGIAEATFLAVAGLNRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I  I+   D  P+  QGAI +E    + +A+  V  +N  ++  +V  ERAFLA L
Sbjct: 181 LSDRITAIVPSADMLPAAAQGAIGLEIRTGDKEAEAFVAPLNDVNSQRAVTAERAFLARL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +GSC++ IA  A   G  L F G VL+ DG+  ++VSR+G    + +IG  AA  +   +
Sbjct: 241 EGSCRTPIAAHATIDGEQLSFRGQVLSLDGQQKYDVSRSGAANASRDIGLAAADEVLSKA 300

Query: 301 NKNVF 305
           +  + 
Sbjct: 301 DPALL 305


>gi|89056336|ref|YP_511787.1| porphobilinogen deaminase [Jannaschia sp. CCS1]
 gi|88865885|gb|ABD56762.1| porphobilinogen deaminase [Jannaschia sp. CCS1]
          Length = 318

 Score =  261 bits (667), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 128/307 (41%), Positives = 181/307 (58%), Gaps = 4/307 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGD----RITNRTLTEIGG 60
           P RIGTR SPLALA A ETR+ LM    +P     I+ + T GD       +  L E+GG
Sbjct: 11  PLRIGTRGSPLALAQARETRARLMAAWDLPEDAFEIVVIKTTGDDRSLIDADVALKELGG 70

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ +++  ID AVHS KDMPT    GL +  YLPRED+RD F+S     L  
Sbjct: 71  KGLFTKEIEEDMLTSSIDIAVHSMKDMPTVQPDGLMLDCYLPREDVRDAFVSVNHDGLHA 130

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++G+SSLRR+A L   R D++V++FRG ++TR+ KL    A A  LA AG++RL 
Sbjct: 131 LPEGAIVGSSSLRRRAQLFARRPDLNVVEFRGNVQTRMKKLGGGVADATFLAMAGLRRLG 190

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+V+K  + +ED  P+  QGAI IE  V++ +A +++  I++ +T   +  ER+FL  L
Sbjct: 191 MEEVVKSAIEVEDMLPAVAQGAIGIERRVSDTRAGDMLAAIHNTETGQRLAAERSFLKGL 250

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IA  A   G TL   G +L  DG       R     D   +G D A+ +R  +
Sbjct: 251 DGSCQTPIAALAELDGGTLRLRGEILRPDGSEVLTDDRTAPIEDGAALGADMARDLRARA 310

Query: 301 NKNVFNF 307
               F++
Sbjct: 311 GDGFFDW 317


>gi|254515499|ref|ZP_05127559.1| porphobilinogen deaminase [gamma proteobacterium NOR5-3]
 gi|219675221|gb|EED31587.1| porphobilinogen deaminase [gamma proteobacterium NOR5-3]
          Length = 308

 Score =  261 bits (667), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 102/300 (34%), Positives = 166/300 (55%), Gaps = 2/300 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
             I TR SPLAL  A+  R +L+ +H  P  ++ ++ ++++GD+I +  L ++GGKGLF 
Sbjct: 5   VVIATRESPLALWQAYFVRDTLLKMH--PGISVELLGMTSRGDQILDVPLAKVGGKGLFV 62

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+ G    AVHS KD+P +   GL+++    RE+  D F+S+  ++L  L   +
Sbjct: 63  KELETALLDGRAHIAVHSMKDVPMEFPDGLELAVICEREEPADAFVSNNYENLDALPPGA 122

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+GTSSLRR+  L   R D++V   RG + TRL KL+  +  AI+LA AG+ RL+  + I
Sbjct: 123 VVGTSSLRRECQLRANRPDLTVRFLRGNVNTRLRKLDEGEYDAIILACAGLIRLEMGERI 182

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  + + +  P+ GQGA+ IE   ++   +EL+  ++H  T + V  ERA    L G C+
Sbjct: 183 RARIPVTESLPAGGQGAVGIEIRSDDSATRELLAPLHHGPTAERVLAERALNRRLQGGCE 242

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             IA +A  +G  L+  G+V   DG         G+R +   +G   A  +       + 
Sbjct: 243 VPIAAYAVHEGDQLWLRGLVGRPDGSNTLRADARGSRDNPEALGITVADALLEAGAAEIL 302


>gi|113952874|ref|YP_731239.1| porphobilinogen deaminase [Synechococcus sp. CC9311]
 gi|122945597|sp|Q0I8I3|HEM3_SYNS3 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|113880225|gb|ABI45183.1| porphobilinogen deaminase [Synechococcus sp. CC9311]
          Length = 316

 Score =  261 bits (667), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 102/308 (33%), Positives = 156/308 (50%), Gaps = 5/308 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI +R S LA+      ++ L   H  P   I +  ++T+GD+I +  L +IG 
Sbjct: 1   MALEHLRIASRRSQLAMVQTNWVKAELEKAH--PGLAISVEAMATQGDKILDVALAKIGD 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+E+E +++ G  + AVHS KD+PT L +GL +     RED  D  + ++  +   
Sbjct: 59  KGLFTKELEAQMLVGRAEIAVHSLKDLPTNLPEGLMLGCITEREDPADALVVNSKNAEYT 118

Query: 121 L---ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           L      S++GTSSLRR A L      +   D RG + TRL KL++     ++LA AG+ 
Sbjct: 119 LETLPEGSIVGTSSLRRLAQLRYHYPHLQFKDVRGNVITRLEKLDSGNYDCLILAAAGLS 178

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL     I + +       + GQGA+ IE   + P+  EL++V+NH  T      ERAFL
Sbjct: 179 RLGFGDRIHQSIPGNISLHAVGQGALGIECVCDRPEVMELIQVLNHAPTSARCLAERAFL 238

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
             L+G C+  I      +G T+   G+V + DGK      + G   D   +GRD A  ++
Sbjct: 239 RVLEGGCQVPIGVNTQIEGDTIQLTGMVASLDGKRLIRDEQAGPLADPEAVGRDLAHKLK 298

Query: 298 FISNKNVF 305
                 + 
Sbjct: 299 DQGAGEIL 306


>gi|159903036|ref|YP_001550380.1| porphobilinogen deaminase [Prochlorococcus marinus str. MIT 9211]
 gi|238058998|sp|A9BEB6|HEM3_PROM4 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|159888212|gb|ABX08426.1| Porphobilinogen deaminase [Prochlorococcus marinus str. MIT 9211]
          Length = 316

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 105/308 (34%), Positives = 161/308 (52%), Gaps = 5/308 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR S LA+      +  L   H  P  NI I  ++T+GD+I +  L +IG 
Sbjct: 1   MVLDQLRIATRRSKLAMVQTHWVKEQLEKAH--PGINISIEAMATQGDKILDVALAKIGD 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHT---AQS 117
           KGLFT+E+E +++ G  D AVHS KD+PT L +GL +     RED  D  + +     + 
Sbjct: 59  KGLFTKELEAQMLIGRADIAVHSLKDLPTNLPEGLMLGCVTEREDPADALVVNKSLKDKQ 118

Query: 118 LKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           L +L   +++GTSSLRR A L      +   D RG + TRL KL+      ++LA AG+ 
Sbjct: 119 LHELPPGTILGTSSLRRLAQLRHHYPHLIFKDVRGNLITRLEKLDAGAYDCLILAAAGLT 178

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL     + +++  E    + GQGA+ IE   N P+  E++K + HE+T      ER+FL
Sbjct: 179 RLGFGDRVHQLIPCEISLHAVGQGALGIECVENKPEVLEIIKSLEHEETSQRCLSERSFL 238

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            EL+G C+  I   +   G  L   G+V + DGK   + S+ G++ +   IG++ A  ++
Sbjct: 239 RELEGGCQVPIGVNSQISGQDLILTGMVASLDGKKLIKDSKRGDKSNPELIGKELANELK 298

Query: 298 FISNKNVF 305
                 + 
Sbjct: 299 SQGAMEIL 306


>gi|163745168|ref|ZP_02152528.1| porphobilinogen deaminase [Oceanibulbus indolifex HEL-45]
 gi|161381986|gb|EDQ06395.1| porphobilinogen deaminase [Oceanibulbus indolifex HEL-45]
          Length = 315

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 132/304 (43%), Positives = 179/304 (58%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +P  IGTR S LALA A E R  L     +P     I+ + T GD+I +R L EIGGKGL
Sbjct: 10  RPLNIGTRGSLLALAQANEVRDRLAAAFDLPFEAFTIVVIKTTGDKIIDRPLKEIGGKGL 69

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT EIE  L+ G ID AVHS KDMPT    GL I  YLPRED+RD FIS   +S+ DL  
Sbjct: 70  FTREIEAALLDGSIDIAVHSMKDMPTLQPGGLVIDTYLPREDMRDAFISPHLKSIADLPE 129

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            +V+GTSSLRR+A +   R D+ V++FRG ++TRL KL +  A A  LA AG+ RLK ++
Sbjct: 130 GAVVGTSSLRRRAQVKLRRPDLEVVEFRGNLQTRLKKLEDGVAEATFLAMAGLNRLKMDE 189

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
           V K  ++ +D  P+  QGAI IE  +++ +A +++  I+   T + +  ERAFLA LDGS
Sbjct: 190 VPKAAVHTDDMLPAIAQGAIGIERRMDDTRAADMLAAIHDRATGEQLAAERAFLATLDGS 249

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKN 303
           C++ IAG A   G+ +   G VL  DG             D    GR+ A+ +   +   
Sbjct: 250 CETPIAGLAELNGTNMRLRGQVLRPDGSDAIGDDVTCTISDGAEAGREMARKLLAEAGPG 309

Query: 304 VFNF 307
            F++
Sbjct: 310 FFDW 313


>gi|147677307|ref|YP_001211522.1| porphobilinogen deaminase [Pelotomaculum thermopropionicum SI]
 gi|189028095|sp|A5D3L5|HEM3_PELTS RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|146273404|dbj|BAF59153.1| porphobilinogen deaminase [Pelotomaculum thermopropionicum SI]
          Length = 312

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 112/304 (36%), Positives = 168/304 (55%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            K+   +GTR S LA+  A      L ++   P  +  I+ + T GDRI +  L +IG K
Sbjct: 1   MKREIAVGTRVSKLAMWQARWVVDRLKEL--CPGCSFRIVGIRTLGDRILDAALVKIGDK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLFT+E+E  ++ GEID AVHS KD+PT+L +GL I A   RE   DV +S   + L +L
Sbjct: 59  GLFTKELEAAMLRGEIDMAVHSMKDLPTELPEGLVIGAVCKREHPADVLVSRRGKKLDEL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +++GTSSLRR A LL +R D+ +++ RG I TRL KL      A +LAYAG+ R+ +
Sbjct: 119 PGGALVGTSSLRRCAQLLWYRDDLRMVNLRGNINTRLRKLEEENLDAAVLAYAGLFRMGR 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           +  I +++  +   P+ GQG+I +E   ++ +  ELVK I+H ++  +V  ERAFL  L+
Sbjct: 179 QDAITQVIPFDICLPAVGQGSIGVEVRSDDGEVLELVKKIDHRESRLAVFAERAFLRRLE 238

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  +      +   L   G+V   DGK        GN  DA  IG   A+ +  +  
Sbjct: 239 GGCQVPVGALGTVENDRLRLEGVVATPDGKQLVRSFVEGNGGDAAAIGLRLAEKLLELGA 298

Query: 302 KNVF 305
             + 
Sbjct: 299 GEIL 302


>gi|302342250|ref|YP_003806779.1| porphobilinogen deaminase [Desulfarculus baarsii DSM 2075]
 gi|301638863|gb|ADK84185.1| porphobilinogen deaminase [Desulfarculus baarsii DSM 2075]
          Length = 310

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 117/301 (38%), Positives = 154/301 (51%), Gaps = 2/301 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
              I TR S LALA A      L  +   P   + +    TKGD+I +  L ++GGKGLF
Sbjct: 3   KLIIATRGSELALAQARWAARQLSALS--PGLEVELQLFKTKGDKILDAPLAKVGGKGLF 60

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +EIE  L+ G    AVHS KDMP +L  GL I+A   RED RDV IS     L +L   
Sbjct: 61  VKEIEDALLDGRARVAVHSMKDMPAELPPGLCIAAVSRREDPRDVLISRDGLGLDELPAT 120

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
             +GTSSLRR+A LL  R D  V+  RG ++TRL KL      AI+LA AG+ RL     
Sbjct: 121 PRLGTSSLRRQAQLLARRPDAMVVSVRGNVQTRLRKLEELGLDAIVLAAAGLDRLGLSDP 180

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
            +  L  E   P+ GQGA+ IE   ++    EL   + H+ T  +V  ERAFL  L+G C
Sbjct: 181 RRVDLAPELMLPAVGQGALAIEARADDAFCLELCARLAHQPTAVAVEAERAFLGRLEGGC 240

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           +  IAG A   G  + F G+V + DGK        G   +A  +G   A+ I     + +
Sbjct: 241 QVPIAGHAVVDGDEIVFEGLVASLDGKRLIRRRAVGRADEAGPLGLAVAEEILADGGRQI 300

Query: 305 F 305
            
Sbjct: 301 L 301


>gi|226311390|ref|YP_002771284.1| porphobilinogen deaminase [Brevibacillus brevis NBRC 100599]
 gi|259647803|sp|C0ZAH1|HEM3_BREBN RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|226094338|dbj|BAH42780.1| porphobilinogen deaminase [Brevibacillus brevis NBRC 100599]
          Length = 309

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 109/300 (36%), Positives = 165/300 (55%), Gaps = 5/300 (1%)

Query: 7   RIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTE 66
           ++GTR S LAL         L      P  +  +  + TKGDRI + TL+++GGKGLF +
Sbjct: 5   KVGTRRSKLALTQTNWVVDKLK--GFAPEADFELHEIVTKGDRILDVTLSKVGGKGLFVK 62

Query: 67  EIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSV 126
           EIE+ L   E D AVHS KDMP +L  GL I A   R D RDV +S   ++L +L   ++
Sbjct: 63  EIEQSLFDKETDFAVHSLKDMPAELPDGLVIGAIPKRVDPRDVLLSKDGKTLDELPQGAL 122

Query: 127 IGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIK 186
           +GTSSLRR + +L +R DI +   RG I+TR+ KL      AI+LA AG++R+  E  I 
Sbjct: 123 VGTSSLRRSSQILAYRPDIQIESLRGNIDTRMRKLAEGNFDAIILAAAGLERVNFEGEIS 182

Query: 187 EILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKS 246
           + L +E   P+ GQGA+ IE   ++ +   L+K  +   T  +V+ ER+FL +L G C+ 
Sbjct: 183 QFLPVEISLPAVGQGALAIECRADDEETLALLKQFDDAPTRLAVSAERSFLHKLQGGCQV 242

Query: 247 AIAGFAYC-KGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
            I  +A   + + +   G+V + DGK   + +  G   D + +G   A+ +      +V 
Sbjct: 243 PIGAYATVGENNEITLTGMVGSPDGKQMFKNTATG--QDPLALGIQVAEALLAQGAGDVL 300


>gi|282901179|ref|ZP_06309108.1| Porphobilinogen deaminase [Cylindrospermopsis raciborskii CS-505]
 gi|281193879|gb|EFA68847.1| Porphobilinogen deaminase [Cylindrospermopsis raciborskii CS-505]
          Length = 322

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 109/306 (35%), Positives = 159/306 (51%), Gaps = 5/306 (1%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +  RIG+R S LAL   +  +  L   +  P  +  +  +ST+GD+I +  L +IG KGL
Sbjct: 9   RIIRIGSRKSELALVQTYWVQEQLQKSY--PDIDFQVHTMSTQGDKILDVALAKIGDKGL 66

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL-- 121
           FT+E+E  +I+ EID AVHS KD+PT L +GL ++A   RE+  D  + H     + L  
Sbjct: 67  FTKELELGMINQEIDFAVHSLKDLPTNLPEGLTLAAITERENPADAVVFHQNHLGQTLAT 126

Query: 122 -ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
               SVIGTSSLRR A L       +  D RG + TR+ KL+  +  A++LA AG++RL 
Sbjct: 127 LPPGSVIGTSSLRRLAQLRHKFPHFTFKDVRGNLNTRMTKLDAGEYDALILAVAGLERLN 186

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I EIL  +    + GQGA+ IE   N+ +   ++K I H  T D    ER+FL  L
Sbjct: 187 MHHRIHEILPPDISLHAVGQGALGIECRENDLELITILKAIEHPQTRDRCLAERSFLRSL 246

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I       G TL   GIV + +G+   + +  G   DA  +G   A  +R   
Sbjct: 247 EGGCQVPIGVNTEIDGETLTLTGIVASVNGENLVKNTITGAATDAEKLGTQLANILREQG 306

Query: 301 NKNVFN 306
              +  
Sbjct: 307 ATEILE 312


>gi|304436298|ref|ZP_07396276.1| hydroxymethylbilane synthase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304370703|gb|EFM24350.1| hydroxymethylbilane synthase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 311

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 105/306 (34%), Positives = 161/306 (52%), Gaps = 3/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M      IGTR S LAL  A     ++   H  P   + +  L+TKGDRI +  L +IGG
Sbjct: 1   MNSGTITIGTRASKLALWQANYVAEAIKKEH--PSCCVELRELTTKGDRILDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+E+E+ ++   +D AVHS KDMPT++  GL I A   R D  D F+S    +++D
Sbjct: 59  KGLFTKELEQAMLDDAVDLAVHSLKDMPTEIPDGLVIGAITTRLDPGDAFVSAHYAAVED 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L + + +GTSSLRR+A LL  R D+++ D RG + TRL KL+  +  AI+LA AG+KRL 
Sbjct: 119 LPVGARVGTSSLRRRAQLLAVRPDLTICDLRGNVNTRLAKLDAGEFDAIVLAAAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I+ IL      P+ GQGA+ IE    +      ++ +       +   ERAFL  +
Sbjct: 179 FERRIRTILPRSVMLPAVGQGALAIECRAGDAAILSAIEFLRDAGMTTAAQAERAFLRRV 238

Query: 241 DGSCKSAIAGFAYCK-GSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           +G C+  +  +A       +    ++ + DG+       +G    A  +G   A+ +   
Sbjct: 239 EGGCQIPVGVYAEVDANGQISIDAMIASVDGQRICRSDAHGAGEQAEALGTALAEELLDA 298

Query: 300 SNKNVF 305
             + + 
Sbjct: 299 GGREIL 304


>gi|149199469|ref|ZP_01876504.1| Prolyl 4-hydroxylase, alpha subunit [Lentisphaera araneosa
           HTCC2155]
 gi|149137404|gb|EDM25822.1| Prolyl 4-hydroxylase, alpha subunit [Lentisphaera araneosa
           HTCC2155]
          Length = 307

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 112/301 (37%), Positives = 167/301 (55%), Gaps = 3/301 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
             RI TR S LAL  A   +S L++V   P   I +  + T+GD+I + +L +IGGKGLF
Sbjct: 2   KLRIATRGSQLALWQAEHVKSRLLEV--DPSLEIELKIIKTQGDKILDVSLAKIGGKGLF 59

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +EIE+ ++  E D AVHS KD+P +L +GL + A L RED RD F+S+  +SL +L   
Sbjct: 60  VKEIEQAMMDDEADLAVHSMKDVPAELPEGLILQAILEREDPRDAFVSNKYKSLDELPEG 119

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           +V+GTSSLRR + L R    +     RG + TRL KL+++K  AI+LA AG+ RL+    
Sbjct: 120 AVVGTSSLRRASQLYRQYP-VKTELLRGNVNTRLAKLDDDKYDAIILAAAGLIRLEFGDR 178

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I + L+ + F PSPGQGA+ IE   ++ +   L+  +NH +T   V  ER F   + GSC
Sbjct: 179 IADSLDPDKFIPSPGQGAVGIECREDDAELCALLNKLNHTETSIRVKVEREFNLAIGGSC 238

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           +     +A   G +      V + DGK ++    +G+  D    G + A  +       +
Sbjct: 239 QVPAGCYATIDGDSFELRAFVASPDGKEYYREDMSGDLKDLPGKGTEIANKLIARGAAEI 298

Query: 305 F 305
            
Sbjct: 299 I 299


>gi|163733941|ref|ZP_02141383.1| porphobilinogen deaminase [Roseobacter litoralis Och 149]
 gi|161393052|gb|EDQ17379.1| porphobilinogen deaminase [Roseobacter litoralis Och 149]
          Length = 314

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 135/303 (44%), Positives = 181/303 (59%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P +IGTR SPLA+A AFETR+ LM    +P     I+ +   GD I +R L +IGGKGLF
Sbjct: 11  PLKIGTRGSPLAMAQAFETRARLMQAFDLPEDAFSIVVIKVTGDMIQDRALKDIGGKGLF 70

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T EIE+ L+S +ID AVHS KDMPT    GL +  YLPRED+RD F+S T   + DLA  
Sbjct: 71  TREIEEDLLSEKIDIAVHSMKDMPTLQPDGLVLDTYLPREDVRDAFVSPTLSGIADLAQG 130

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           +V+GTSSLRRKA LL  R D++V++FRG ++TRL KL +  A    LA AG+ RLK ++V
Sbjct: 131 AVVGTSSLRRKAQLLNRRPDLNVVEFRGNVQTRLKKLADGVAECTFLASAGLNRLKMDEV 190

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
               +  ++  P+  QGAI IE  + +    +L+  I+H +T   +  ER+FL  LDGSC
Sbjct: 191 PATPIEADEMLPAVAQGAIGIERRMADQNTADLLSAIHHIETGQRLTAERSFLLTLDGSC 250

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           ++ IAG A   G  L   G VL  DG       R+G   D   +GR  AQ +   +    
Sbjct: 251 ETPIAGLAELDGDQLRLRGEVLRPDGSESLAGERSGPIADGAEMGRILAQELLDRAGPKF 310

Query: 305 FNF 307
           F +
Sbjct: 311 FEW 313


>gi|282895464|ref|ZP_06303601.1| Porphobilinogen deaminase [Raphidiopsis brookii D9]
 gi|281199497|gb|EFA74360.1| Porphobilinogen deaminase [Raphidiopsis brookii D9]
          Length = 322

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 109/306 (35%), Positives = 160/306 (52%), Gaps = 5/306 (1%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +  RIG+R S LAL   +  +  L   +  P  +  +  +ST+GD+I +  L +IG KGL
Sbjct: 9   RTIRIGSRKSELALVQTYWVQEQLQKSY--PDIDFQVHTMSTQGDKILDVALAKIGDKGL 66

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQ---SLKD 120
           FT+E+E  +I+ EID AVHS KD+PT L  GL ++A   RE+  D  + H      +L  
Sbjct: 67  FTKELELGMINQEIDFAVHSLKDLPTNLPAGLTLAAITARENPADAVVFHQNHLGQTLDT 126

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SVIGTSSLRR A L    S  +  D RG + TR+ KL+  +  A++LA AG++RL 
Sbjct: 127 LPPGSVIGTSSLRRLAQLRHKFSHFTFKDVRGNLNTRMTKLDAGEYDALILAVAGLERLN 186

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I +IL  +    + GQGA+ IE   N+ +   ++K I H  T D    ER+FL  L
Sbjct: 187 MHHRIHQILPPDISLHAVGQGALGIECRENDSELITILKAIEHPQTRDRCLAERSFLRSL 246

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I       G +L   GIV + +G+   + +  G   DA  +G   A  +R   
Sbjct: 247 EGGCQVPIGVNTEIDGESLTLTGIVASVNGENLVKNTITGAAADAEKLGTQLANILREQG 306

Query: 301 NKNVFN 306
              +  
Sbjct: 307 ATEILE 312


>gi|126732359|ref|ZP_01748159.1| porphobilinogen deaminase [Sagittula stellata E-37]
 gi|126707228|gb|EBA06294.1| porphobilinogen deaminase [Sagittula stellata E-37]
          Length = 316

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 137/309 (44%), Positives = 185/309 (59%), Gaps = 4/309 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGD----RITNRTLTEI 58
             P +IGTR SPLALA AFETR  LM    +P     I  + T GD       +R L EI
Sbjct: 7   NSPLKIGTRGSPLALAQAFETRERLMAAFSLPEDAFEICIIKTTGDDRAMIAADRPLKEI 66

Query: 59  GGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSL 118
           G KGLFT+EIE+ L++G ID AVHS KDMPT+  +GL +  YLPRED RD FI H   S+
Sbjct: 67  GNKGLFTKEIEEALVAGRIDIAVHSMKDMPTEQPEGLILDCYLPREDPRDAFICHDHGSI 126

Query: 119 KDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR 178
            DL + +V+G+SSLRR+A LL  R D+ V++FRG ++TRL KL++  A A  LA AG+ R
Sbjct: 127 HDLPVGAVVGSSSLRRRAQLLHRRPDLDVVEFRGNLQTRLKKLSDGVATATFLACAGLNR 186

Query: 179 LKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLA 238
           +K   V    +   D  P+  QGAI IE  +++   QE++  I+  DT   +  ERAFLA
Sbjct: 187 MKIPGVPMFPIAEVDMLPAIAQGAIGIERRIDDATTQEMLAAIHDHDTGLRLAAERAFLA 246

Query: 239 ELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRF 298
            LDGSC++ IAG A   G+TL+  G +L  DG I H    +G   +   +GR  A  +  
Sbjct: 247 RLDGSCETPIAGLAELDGATLHLRGEILRPDGSISHAGEISGAATEGAALGRTLADDLLS 306

Query: 299 ISNKNVFNF 307
            + +  F++
Sbjct: 307 RAGEGFFDW 315


>gi|269103733|ref|ZP_06156430.1| porphobilinogen deaminase [Photobacterium damselae subsp. damselae
           CIP 102761]
 gi|268163631|gb|EEZ42127.1| porphobilinogen deaminase [Photobacterium damselae subsp. damselae
           CIP 102761]
          Length = 294

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 103/290 (35%), Positives = 162/290 (55%), Gaps = 2/290 (0%)

Query: 17  LAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEEIEKKLISGE 76
           +  A   ++ L   H  P   + ++P+ TKGD I +  L ++GGKGLF +E+E  ++ G 
Sbjct: 1   MWQAEFVKAELEKAH--PGLVVELVPMVTKGDVILDTPLAKVGGKGLFVKELEVAMLEGR 58

Query: 77  IDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVIGTSSLRRKA 136
            D AVHS KD+P +  +GL +     RED RD F+S+   SL++L   S++GTSSLRR+ 
Sbjct: 59  ADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNRYNSLEELPQGSIVGTSSLRRQC 118

Query: 137 LLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKEILNIEDFPP 196
            L   R D+ V D RG + TRL KL++ +  AI+LA AG+KRLK +  I+  +  E   P
Sbjct: 119 QLRSQRPDLIVKDLRGNVNTRLRKLDDGEYDAIILACAGLKRLKMDDRIRAAIAPETSLP 178

Query: 197 SPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKSAIAGFAYCKG 256
           + GQGA+ IE  +++ + ++L+  +NH++T   V CERA    L G C+  I  +A  +G
Sbjct: 179 AVGQGAVGIECRLDDTRVRDLLAALNHQETATRVLCERAMNNRLQGGCQVPIGSYAELQG 238

Query: 257 STLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVFN 306
             ++   +V   DG        +G+  DA  +G   A+ +     K +  
Sbjct: 239 DQIWLRALVGEPDGSQIVRGEISGSANDAEALGTQLAEQLLADGAKPILE 288


>gi|153004241|ref|YP_001378566.1| porphobilinogen deaminase [Anaeromyxobacter sp. Fw109-5]
 gi|152027814|gb|ABS25582.1| porphobilinogen deaminase [Anaeromyxobacter sp. Fw109-5]
          Length = 313

 Score =  260 bits (665), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 105/300 (35%), Positives = 150/300 (50%), Gaps = 3/300 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLA   A      L    K P   + +  L TKGDRI    L E+GGKGLF 
Sbjct: 2   IRIATRRSPLAKWQANHVADLLRA--KEPGLEVRLHELVTKGDRILEVPLAEVGGKGLFV 59

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE  L++ + + AVHS KD+P +L  GL I A   RED RD   S   ++L  L   +
Sbjct: 60  KEIEDALLASDAEIAVHSMKDLPAELAPGLAIGAVPEREDPRDALCSPRYKTLAGLPRGA 119

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR A L   R D+ +   RG +ETRL K  +    A++LAYAG++RL   +  
Sbjct: 120 KVGTSSLRRGAQLKALRPDLQLEMVRGNVETRLRKA-SEALDAVVLAYAGLRRLGLAEHA 178

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
             +   E+  P+  QGA+ +E    +      +  + H +T   +  ER FL  ++G C+
Sbjct: 179 TYVFPAEEMLPAVAQGALALEARAADAPTMARLAALEHPETRVRIEAERGFLGRIEGGCQ 238

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             IAG A  +G  +    +V + DG       R+G   DA  +G   A+ +       + 
Sbjct: 239 VPIAGHATVQGGRVSMRALVASLDGTRVIRGERSGPAADARQLGIALAEELLSKGAAEIL 298


>gi|260888475|ref|ZP_05899738.1| hydroxymethylbilane synthase [Selenomonas sputigena ATCC 35185]
 gi|330838215|ref|YP_004412795.1| Porphobilinogen deaminase [Selenomonas sputigena ATCC 35185]
 gi|260861672|gb|EEX76172.1| hydroxymethylbilane synthase [Selenomonas sputigena ATCC 35185]
 gi|329745979|gb|AEB99335.1| Porphobilinogen deaminase [Selenomonas sputigena ATCC 35185]
          Length = 311

 Score =  260 bits (665), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 116/305 (38%), Positives = 173/305 (56%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+K    IGTR S LAL  A    + L + +  P  ++V   ++TKGDR+ +  L +IGG
Sbjct: 1   MKKDTIVIGTRSSKLALWQADYVEAKLRERY--PELHVVQKRMTTKGDRVLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+E+E+ +++GEID AVHS KDMPT+L +GL ++A   R D  D  +S   Q+L +
Sbjct: 59  KGLFTKELEQAMLAGEIDLAVHSLKDMPTELPEGLMLAAVTERFDPGDAVVSPRYQTLAN 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +GTSSLRR+A LL  R D+ ++  RG + TRL KL      AI+LA AG+KRL 
Sbjct: 119 LPQGAKVGTSSLRRRAQLLAKRPDLEIVSLRGNVNTRLKKLEEENFDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I EIL  E   P+ GQGA+ IE   ++     L+  ++   T  +   ERAFLA +
Sbjct: 179 FHDRITEILPREICLPAVGQGALAIEARADDEATLSLIAFLDDAATRAAARAERAFLARV 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  +  +A      L    ++ + DG+  +   + G+  DA  IGR  A+ +  + 
Sbjct: 239 EGGCQVPVGVYAEAADEALEMEAVIASIDGERLYRKKKAGSALDAEKIGRALAEELLAMG 298

Query: 301 NKNVF 305
            K + 
Sbjct: 299 GKEIL 303


>gi|162219161|ref|YP_747258.2| porphobilinogen deaminase [Nitrosomonas eutropha C91]
          Length = 308

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 113/306 (36%), Positives = 165/306 (53%), Gaps = 3/306 (0%)

Query: 1   MEK-KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M   +   I +R S LAL  A   RS L++++  P  +I I+ ++TKGD+I + +L++IG
Sbjct: 1   MSSPEKIVIASRESQLALWQANFIRSRLLELY--PQTDITILGMTTKGDQILDVSLSKIG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  L  G  D AVHS KD+P  +  G +++A   RED RD F+S+   SL+
Sbjct: 59  GKGLFIKELELALEDGRADIAVHSMKDVPMIVPSGFRLAAITEREDPRDAFVSNDFTSLE 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           +L   SV+GTSSLRR++ L      + V   RG ++TRL KL+  +  AI+LA AG+KRL
Sbjct: 119 ELPTGSVVGTSSLRRESQLRARFPHLQVRPLRGNVQTRLRKLDEGEYSAIILAAAGLKRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
           +    I  ++  E   P+ GQGA+ IE   N+P   E +K ++H  T   V  ERA    
Sbjct: 179 ELGYRISMLIPPELSLPAVGQGALGIECRDNDPDMVEWMKPLHHATTAYCVEAERAMSRV 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L GSC+  + GFA      L   G V   DG         G       +G   AQ ++  
Sbjct: 239 LGGSCQVPLGGFAEIFEGVLTLRGFVATPDGSKIIADKLCGKPESGERVGEQLAQNLKTH 298

Query: 300 SNKNVF 305
             + + 
Sbjct: 299 GAEEIL 304


>gi|313673928|ref|YP_004052039.1| hydroxymethylbilane synthase [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312940684|gb|ADR19876.1| hydroxymethylbilane synthase [Calditerrivibrio nitroreducens DSM
           19672]
          Length = 308

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 108/306 (35%), Positives = 157/306 (51%), Gaps = 4/306 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           MEK    I TR S LAL  A   +S L   ++ P   + +  + T+GD I +  L +IGG
Sbjct: 1   MEK--ITIATRGSKLALWQANHIKSLLT--NRYPEMLVELKIIKTQGDIILDVPLAKIGG 56

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE  LI  E D AVHS KD+P +L   L+I     RE   D F+S    +L +
Sbjct: 57  KGLFVKEIENALIENEADLAVHSMKDVPVELPDELEIYVNPHRESPFDAFLSVKYNNLDE 116

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +GTSSLRRK  + R R DI + D RG ++TR+ KL      AI+LA AG+ RL 
Sbjct: 117 LPRGAKLGTSSLRRKVQISRIRPDIEITDLRGNVDTRIRKLTEGTFDAIILARAGLNRLN 176

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             +  K   +  +  PS  QG + IE   ++ + + ++K +  E T      ERAFL  L
Sbjct: 177 LLEWAKYTFDDSEIVPSVCQGTLGIEVRKDDDRIKNILKFMKDEKTEIVTRAERAFLRRL 236

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C++ I G+   +G  L   G + + DG  F +    G+      +G   A+ I    
Sbjct: 237 EGGCQAPIGGYCKIEGGKLKMIGFLSSLDGDEFLKYEEYGDMDKPEVLGESVAEKILING 296

Query: 301 NKNVFN 306
            K + +
Sbjct: 297 GKKILD 302


>gi|22299189|ref|NP_682436.1| porphobilinogen deaminase [Thermosynechococcus elongatus BP-1]
 gi|39931549|sp|Q8DIE4|HEM3_THEEB RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|22295371|dbj|BAC09198.1| porphobilinogen deaminase [Thermosynechococcus elongatus BP-1]
          Length = 320

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 103/308 (33%), Positives = 156/308 (50%), Gaps = 5/308 (1%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
             +P RIG+R S LAL      ++ L   H+       ++ ++T+GD I +  L +IG K
Sbjct: 5   SSRPVRIGSRKSQLALVQTEWVQAQLQTHHR--DRAFEVVTMTTQGDNILDVALAKIGDK 62

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLFT+E+E  ++ GE D AVHS KD+PT+L  GL ++A   RED  D  +     +   +
Sbjct: 63  GLFTKELELSMLRGETDLAVHSLKDLPTQLPDGLVLAAITEREDPADALVLGAKWTGHTI 122

Query: 122 ---ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR 178
                 +VIGTSSLRR A L  +   ++  D RG + TRL KL+  +  A++LA AG++R
Sbjct: 123 DTLPEGTVIGTSSLRRLAQLRHYYPHLTFKDVRGNLNTRLAKLDAGEYDALILAVAGLRR 182

Query: 179 LKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLA 238
           L     I ++L       + GQGA+ IE    +     LVK + H +T      ERAFL 
Sbjct: 183 LGFGDRISQVLPATVSLYAVGQGALGIECRAEDADILALVKTLEHPETTARCLAERAFLR 242

Query: 239 ELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRF 298
           +L+G C+  I      +   L   G+V + DG+   + S  G+   A  +G   A  +R 
Sbjct: 243 QLEGGCQVPIGVHTVIENGQLTLTGLVASLDGQRLVKDSLTGDVATAEELGTRLALKLRE 302

Query: 299 ISNKNVFN 306
                +  
Sbjct: 303 QGASEILE 310


>gi|90421073|ref|ZP_01228976.1| porphobilinogen deaminase [Aurantimonas manganoxydans SI85-9A1]
 gi|90334708|gb|EAS48485.1| porphobilinogen deaminase [Aurantimonas manganoxydans SI85-9A1]
          Length = 311

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 141/307 (45%), Positives = 190/307 (61%), Gaps = 1/307 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RIGTR S LA A A E R+ LM  H +P     I  +ST GDRI +R L+E+GG
Sbjct: 1   MASDIIRIGTRGSQLAKAQASEVRARLMAAHDLPEEAFEIEVISTTGDRILDRPLSEVGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE  LI G +D A HS+KDM T   +GL++SAYLPRED+RD FI  TA ++ +
Sbjct: 61  KGLFTKEIEAALIDGRVDIAAHSSKDMATASPEGLEVSAYLPREDVRDAFIGRTAATIDE 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + IG++SLRR++LL R R D+ VI FRG +++RL KL   +  A LLA AG+ R+ 
Sbjct: 121 LPHGATIGSASLRRQSLLKRMRPDLKVITFRGNVQSRLRKLEEGQVDATLLALAGLNRMA 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            + V  EIL +E F P+PGQGAICI+  + + +   LV  I    T  ++  ERAFLAEL
Sbjct: 181 MQDVATEILEVERFLPAPGQGAICIQNRIGDERVHGLVAAIADPRTTVALTAERAFLAEL 240

Query: 241 DGSCKSAIAGFAYC-KGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           DGSC++ IA  A   +  T+  +G++L  DG   HE  R G   DA  +GR A + +   
Sbjct: 241 DGSCRTPIAAHAVLAEDGTVTLHGMILTPDGSRMHETRRTGIAADAEALGRLAGRDVLDA 300

Query: 300 SNKNVFN 306
           +    F+
Sbjct: 301 AGPGFFD 307


>gi|113460193|ref|YP_718250.1| porphobilinogen deaminase [Haemophilus somnus 129PT]
 gi|170718229|ref|YP_001785251.1| porphobilinogen deaminase [Haemophilus somnus 2336]
 gi|123131907|sp|Q0I178|HEM3_HAES1 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|238058918|sp|B0UWZ8|HEM3_HAES2 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|112822236|gb|ABI24325.1| hydroxymethylbilane synthase (porphobilinogen deaminase, PGB)
           [Haemophilus somnus 129PT]
 gi|168826358|gb|ACA31729.1| porphobilinogen deaminase [Haemophilus somnus 2336]
          Length = 321

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 110/317 (34%), Positives = 165/317 (52%), Gaps = 14/317 (4%)

Query: 1   ME-KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M   K  +I TR SPLAL  A   ++ L   +     ++ ++P+ TKGD I +  L +IG
Sbjct: 1   MSINKTLKIATRQSPLALWQANYVKNRLQQRYS--HLSVELVPIITKGDVILDTPLAKIG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  L++GE D AVHS KD+P +  KGL++S   PRED RD F+S+  ++L 
Sbjct: 59  GKGLFVKELENALLNGEADIAVHSMKDVPMQFPKGLELSVICPREDPRDAFVSNKYRTLD 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           +L   +++GTSSLRR+  L  WR+D+ +   RG + TRLNKL+     AI+LA AG+ RL
Sbjct: 119 ELPQGAIVGTSSLRRQCQLKNWRADLDIRSLRGNVGTRLNKLDQGDYDAIILASAGLIRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
              + I+  + I+   P+ GQGA+ IE  V++   Q L+  +  + T   V  ERA    
Sbjct: 179 GLTERIRSFIEIDTILPACGQGAVGIECRVDDRDVQSLLMPLADQTTTYCVLAERAMNFH 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVS-----------RNGNRCDAINI 288
           L G C+  I  +A  + + LY  G+V    G                         A  +
Sbjct: 239 LQGGCQVPIGAYAILENNQLYLRGLVGDVHGSQILSAEGQFELSLDFESSQSAVQKAEEL 298

Query: 289 GRDAAQYIRFISNKNVF 305
           G   A+ +       + 
Sbjct: 299 GVSIAEQLLQQGADKIL 315


>gi|91200437|emb|CAJ73484.1| strongly similar to hydroxymethylbilane synthase (porphobilinogen
           deaminase) [Candidatus Kuenenia stuttgartiensis]
          Length = 319

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 106/302 (35%), Positives = 162/302 (53%), Gaps = 2/302 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           KP  +G+R S LAL       S L  ++  P     I  +ST GD+IT+  L+ +GG G+
Sbjct: 8   KPIIVGSRGSKLALTQTNWVISELKKLN--PGVEFEIKKISTSGDKITDVPLSRLGGVGV 65

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT+E+E  LI  +ID AVHSAKD+PT++ + L + A   R D  DV IS    +L+ L  
Sbjct: 66  FTKELEVALIKEKIDLAVHSAKDIPTEVSEKLTLGAMPKRVDPSDVLISAKNVTLERLPG 125

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
           ++ IGTSSLRRKA LL  R D  ++D RG ++TRL KL  +    I++A+AG+ R+    
Sbjct: 126 NARIGTSSLRRKAQLLALRPDFEIVDLRGNLDTRLKKLEADDLDGIIVAHAGLIRIGYTG 185

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I EI+  E   P+ GQG++ IE   ++ +  +++  ++   T  +V  ERA LA+L G 
Sbjct: 186 QISEIIPFEIMLPAVGQGSLGIEIRKDDERINKILSKMDDLHTRIAVEAERALLAKLQGG 245

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKN 303
           C+  I   A      ++   ++   DG+     S  G    A  +G + AQ +       
Sbjct: 246 CQVPIGAHAKVLNDEVHLEAVICTLDGERTIRDSHKGPANQAAAVGNELAQRMLDNGGDK 305

Query: 304 VF 305
           + 
Sbjct: 306 IL 307


>gi|37522781|ref|NP_926158.1| porphobilinogen deaminase [Gloeobacter violaceus PCC 7421]
 gi|55976479|sp|Q7NGF7|HEM3_GLOVI RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|35213783|dbj|BAC91153.1| porphobilinogen deaminase [Gloeobacter violaceus PCC 7421]
          Length = 328

 Score =  260 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 107/311 (34%), Positives = 154/311 (49%), Gaps = 8/311 (2%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +   IG+R S LAL      R  L   H  P     I+ + T+GD+I +  L +IG 
Sbjct: 1   MS-RTVIIGSRDSQLALVQTHWVRDELQRAH--PDIRFEIVEMKTQGDKILDVALAKIGD 57

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTA---QS 117
           KGLFT+E+E  ++    D AVHS KD+PT L  GL + A   RED  D  I         
Sbjct: 58  KGLFTKELESAMLEKRTDLAVHSLKDLPTALPPGLILGAITEREDPSDAVIVRRGLEAAG 117

Query: 118 LKDLALHSVIGTSSLRRKALLLRWR-SDISVIDFRGKIETRLNKLNNNKAHAILLAYAGI 176
           L DL   +V+GTSSLRR A L       +   D RG + TRL KL+  +  AI+LA AG+
Sbjct: 118 LADLPEGAVVGTSSLRRLAQLKHHYGERLRFQDIRGNLNTRLRKLDEGRYDAIVLAVAGM 177

Query: 177 KRLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAF 236
           +RL   + I E+L+ +    + GQGA+ IE    + +  +L+ V+NH  T      ERA 
Sbjct: 178 RRLGWSERISEVLSPDISLHAVGQGALGIECREADGEILDLLTVLNHPPTARRCRAERAM 237

Query: 237 LAELDGSCKSAIAGFAYCKG-STLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQY 295
           L  L+G C+  I  +        L   GIV + DG+      R+G       +GR  A+ 
Sbjct: 238 LRALEGGCQVPIGVYTELDDSGRLTLQGIVASLDGRNMARACRSGPGDAPEALGRAVAED 297

Query: 296 IRFISNKNVFN 306
           ++    + + +
Sbjct: 298 LKAAGAQAILD 308


>gi|126740632|ref|ZP_01756319.1| porphobilinogen deaminase [Roseobacter sp. SK209-2-6]
 gi|126718433|gb|EBA15148.1| porphobilinogen deaminase [Roseobacter sp. SK209-2-6]
          Length = 319

 Score =  260 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 131/307 (42%), Positives = 180/307 (58%), Gaps = 4/307 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGD----RITNRTLTEIGG 60
           P +IGTR SPLALA A+ETR+ L     +P     I+ + T GD       ++ L E+GG
Sbjct: 11  PLKIGTRGSPLALAQAYETRARLAKAFDLPQEAFEIVVIKTTGDNQALIAADKPLKELGG 70

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ L+SG ID AVHS KDMP    +GL +  YLPRED+RD F+S     L+D
Sbjct: 71  KGLFTKEIEEDLLSGAIDIAVHSMKDMPVLQPEGLLLDCYLPREDVRDAFVSPKFSRLQD 130

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           LA  +V+GTSSLRR+A L+  R D+ V++FRG ++TRL KL +  A    LA AG+ RL 
Sbjct: 131 LAAGAVVGTSSLRRRAQLMNRRPDLKVVEFRGNVQTRLKKLEDGVAECTFLAMAGLNRLA 190

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E V    +   D  P+  QGAI IE   ++ +   +++ I+ + T   +  ERAFLA L
Sbjct: 191 MESVPATAIETTDMLPAVAQGAIGIERRSDDSRVAAMLEAIHDKATGQRLAAERAFLAAL 250

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG A   G TL   G VL  DG       ++    D   +GRD A  +   +
Sbjct: 251 DGSCETPIAGLAELDGGTLRMRGEVLRPDGSEAIAEDQSCAIEDGAALGRDMAAKLLDQA 310

Query: 301 NKNVFNF 307
             + F++
Sbjct: 311 GPSFFDW 317


>gi|123968087|ref|YP_001008945.1| porphobilinogen deaminase [Prochlorococcus marinus str. AS9601]
 gi|158513952|sp|A2BPX7|HEM3_PROMS RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|123198197|gb|ABM69838.1| Porphobilinogen deaminase [Prochlorococcus marinus str. AS9601]
          Length = 316

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 100/308 (32%), Positives = 160/308 (51%), Gaps = 5/308 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     +I +R S LA+      +  L     IP   + I  ++T+GD+I +  L +IG 
Sbjct: 1   MTNFKLKIASRRSKLAMVQTLWVKDQLEK--NIPNLEVSIEAMATQGDKILDVALAKIGD 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFI---SHTAQS 117
           KGLFT+E+E +++ G  D AVHS KD+PT L  GL++     RED  D  +    +    
Sbjct: 59  KGLFTKELEAQMLVGHADIAVHSLKDLPTNLPNGLKLGCITKREDPADALVVNKKNDCYK 118

Query: 118 LKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           L++L   S++GTSSLRR A L      +   D RG + TR+ KL+  +   I+LA AG+K
Sbjct: 119 LENLPEGSIVGTSSLRRLAQLRNKYPHLVFKDIRGNVITRIEKLDAGEFDCIILAAAGLK 178

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL  E  I +I+  E    + GQGA+ IE   ++ K  E++ ++  + T      ERAFL
Sbjct: 179 RLGFESRIHQIIPSEVSLHAVGQGALGIECKSDDKKVLEIISILEDKPTCQRCLAERAFL 238

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            EL+G C+  I   +  +   L   G+V + DG+   +    G+  D   +G++ A+ ++
Sbjct: 239 RELEGGCQVPIGVNSKIQNEQLCLTGMVASLDGERLIKDQYIGDINDPEEVGKELAKKLK 298

Query: 298 FISNKNVF 305
               + + 
Sbjct: 299 QQGAEEIL 306


>gi|167630035|ref|YP_001680534.1| porphobilinogen deaminase [Heliobacterium modesticaldum Ice1]
 gi|167592775|gb|ABZ84523.1| porphobilinogen deaminase [Heliobacterium modesticaldum Ice1]
          Length = 315

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 106/307 (34%), Positives = 162/307 (52%), Gaps = 4/307 (1%)

Query: 1   ME--KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEI 58
           M   ++P  IGTR S LAL         L +++  P     +  + TKGD+I +  L +I
Sbjct: 1   MSALQRPVVIGTRDSALALWQTHWVLERLKELY--PEQAFEVKHIKTKGDKILDVALAKI 58

Query: 59  GGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSL 118
           G KGLFT+E+E  +++GEID AVHS KD+PT L +G  I A   RED RD+ IS     L
Sbjct: 59  GDKGLFTKELEVAMLNGEIDMAVHSMKDLPTLLPEGCAIGAICVREDCRDILISRNGGGL 118

Query: 119 KDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR 178
           ++L   + +GT+SLRRKA + + R D+ ++D RG ++TR+ K+       ++LA AG+KR
Sbjct: 119 EELPRGAKVGTASLRRKAQIWKVRPDLELVDIRGNLQTRMRKMEEQNLDGLILAAAGVKR 178

Query: 179 LKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLA 238
           L   + I E + ++   P+ GQG++ IE    +     LV  +NH ++   V  ERA L 
Sbjct: 179 LGWAEKITEYIPVDMCLPAVGQGSVGIEIREGDEAIGRLVAALNHAESALCVRAERALLR 238

Query: 239 ELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRF 298
            L+G C+  I       G  L   G+V + DG+        G+  D    G   A+ +  
Sbjct: 239 TLEGGCQVPIGSLGRLSGGKLIVDGVVASLDGRTICRDRVEGDPADPEEAGVRLAKKLLQ 298

Query: 299 ISNKNVF 305
              + + 
Sbjct: 299 QGAREIL 305


>gi|172039291|ref|YP_001805792.1| porphobilinogen deaminase [Cyanothece sp. ATCC 51142]
 gi|171700745|gb|ACB53726.1| porphobilinogen deaminase [Cyanothece sp. ATCC 51142]
          Length = 331

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 104/307 (33%), Positives = 162/307 (52%), Gaps = 5/307 (1%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
             +  RIG+R S LAL   +  +  L   +  P     +  +ST+GD+I +  L +IG K
Sbjct: 18  STRTIRIGSRKSQLALVQTYWIQEELQKHY--PDRQFDVETMSTQGDKILDVALAKIGDK 75

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFI---SHTAQSL 118
           GLFT+E+E  ++  ++D AVHS KD+PT L +GL +     R +  D  +   +H  + L
Sbjct: 76  GLFTKELETAMLQNQVDFAVHSLKDLPTNLPEGLMLGCVTERVNPADALVVNETHQDKQL 135

Query: 119 KDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR 178
             L   SVIGTSSLRR A L      ++  D RG + TRL+KL+  +  AI+LA AG++R
Sbjct: 136 DTLPEGSVIGTSSLRRLAQLRHHYPHLTFKDVRGNVNTRLSKLDAGEYDAIILAVAGLQR 195

Query: 179 LKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLA 238
           L     I +++  +    + GQGA+ IE    +P+  +L+KV+ H +T D    ERAFL 
Sbjct: 196 LDMSDRIHQVIPDDISLHAVGQGALGIECRSGDPEILDLLKVLEHTETRDRCYAERAFLR 255

Query: 239 ELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRF 298
           +L+G C+  I      + + L   G+V + DGK   + +  G    A  +G + A  +R 
Sbjct: 256 QLEGGCQVPIGVNTKIENNILTLTGMVASLDGKTLIKDTIQGEAAQAEKLGEELALRLRD 315

Query: 299 ISNKNVF 305
                + 
Sbjct: 316 EGATEIL 322


>gi|320354663|ref|YP_004196002.1| hydroxymethylbilane synthase [Desulfobulbus propionicus DSM 2032]
 gi|320123165|gb|ADW18711.1| hydroxymethylbilane synthase [Desulfobulbus propionicus DSM 2032]
          Length = 319

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 112/301 (37%), Positives = 172/301 (57%), Gaps = 2/301 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LA+  +   ++ +   H  P   + ++ ++TKGDRI +  L ++GGKGLF 
Sbjct: 5   LRIGTRASLLAVTQSTWVKTQIEQAH--PGTRVELVKITTKGDRILDVPLAKVGGKGLFV 62

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE  L++GE+D AVHS KD+PT+L +GL I     RE   D F+S T  +L DL   +
Sbjct: 63  KEIEDALLAGEVDLAVHSMKDVPTELPEGLHIGVIPVRETPYDAFLSKTCTTLADLPQGA 122

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            IGTSSLRRK+ L+  R D+ ++D RG I+TRL KL+     AI+LA AG++RL  E  I
Sbjct: 123 TIGTSSLRRKSQLMALRPDLDIVDLRGNIDTRLRKLDEGVYDAIILAGAGLRRLHLEHRI 182

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
             +L      P+  QGA+ IE   ++ +  + ++ ++H +T  +V  ERAFL  L+G C+
Sbjct: 183 TALLEPTQMLPAISQGALGIELRQDDTELADGLRFLHHGETAVAVEAERAFLLRLEGGCQ 242

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             IA  A     ++   G++ + DG+   + +  G    A  +G   AQ +     K + 
Sbjct: 243 VPIAAHATLDSGSVTLTGLIASVDGRQILKEATTGPAEQAARLGAQLAQTLLDRGGKAIL 302

Query: 306 N 306
           +
Sbjct: 303 D 303


>gi|326561756|gb|EGE12091.1| porphobilinogen deaminase [Moraxella catarrhalis 7169]
          Length = 321

 Score =  259 bits (662), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 110/313 (35%), Positives = 164/313 (52%), Gaps = 10/313 (3%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +   I TR SPLAL  A   ++ L  ++  P  ++ ++ + TKGD+I +  L +IGG
Sbjct: 1   MTIRTLTIATRQSPLALWQANFIKAKLEQLY--PSLSVELLEMVTKGDKILDTPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L     D AVHS KD+P  L +GL + AY  R    D F+S+  + L D
Sbjct: 59  KGLFVKELEQALYDKRADIAVHSLKDVPMVLPEGLMLGAYCERHAPTDAFVSNHFEHLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L + R D+ +   RG + TRL KL+  +  AI+LA +G++RL 
Sbjct: 119 LPTGAVLGTSSLRRECQLRQARPDLDIKSLRGNVGTRLGKLDAGEYDAIILATSGLERLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             K I+  L+ E   P+ GQGA+ IE   ++   + L+  +NH  T   V  ERA    L
Sbjct: 179 LHKRIRHELDDELSLPAVGQGALAIECRSDDEAIKLLLSPLNHPKTRLCVLAERAMNRAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEV--------SRNGNRCDAINIGRDA 292
           +G C+  IAGFA  +   L   G V + DGK   +             +   A  +G D 
Sbjct: 239 EGGCQVPIAGFAVIEDGMLTLRGRVGSVDGKTLLKAQQSHKLMGEIQLDEQAAEQLGIDV 298

Query: 293 AQYIRFISNKNVF 305
           A  +      ++ 
Sbjct: 299 AHELLMQGADDIL 311


>gi|326571836|gb|EGE21842.1| porphobilinogen deaminase [Moraxella catarrhalis BC7]
          Length = 321

 Score =  259 bits (662), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 108/313 (34%), Positives = 164/313 (52%), Gaps = 10/313 (3%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +   I TR SPLAL  A   ++ L  ++  P  ++ ++ + TKGD+I +  L +IGG
Sbjct: 1   MTIRTLTIATRQSPLALWQANFIKAKLEQLY--PSLSVELLEMVTKGDKILDTPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L     D AVHS KD+P  L +GL + AY  R    D F+S+  + L D
Sbjct: 59  KGLFVKELEQALYDKRADIAVHSLKDVPMVLPEGLMLGAYCERHAPTDAFVSNRFEHLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L + R D+ +   RG + TRL KL+  +  A++LA +G++RL 
Sbjct: 119 LPTGAVLGTSSLRRECQLRQARPDLDIKSLRGNVGTRLGKLDAGEYDAVILATSGLERLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I+  L+ E   P+ GQGA+ IE   ++   + L+  +NH  T   V  ERA    L
Sbjct: 179 LHERIRHELDDELSLPAVGQGALAIECRSDDEAIKLLLSPLNHPKTRLCVLAERAMNRAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEV--------SRNGNRCDAINIGRDA 292
           +G C+  IAGFA  +   L   G V + DGK   +             +   A  +G D 
Sbjct: 239 EGGCQVPIAGFAVIEDGMLTLRGRVGSVDGKTLLKAQQSHKLMGEIQLDEQAAEQLGIDV 298

Query: 293 AQYIRFISNKNVF 305
           A  +      ++ 
Sbjct: 299 AHELLMQGADDIL 311


>gi|296112247|ref|YP_003626185.1| porphobilinogen deaminase [Moraxella catarrhalis RH4]
 gi|295919941|gb|ADG60292.1| porphobilinogen deaminase [Moraxella catarrhalis RH4]
          Length = 321

 Score =  259 bits (662), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 109/313 (34%), Positives = 164/313 (52%), Gaps = 10/313 (3%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +   I TR SPLAL  A   ++ L  ++  P  ++ ++ + TKGD+I +  L +IGG
Sbjct: 1   MTIRTLTIATRQSPLALWQANFIKAKLEQLY--PSLSVELLEMVTKGDKILDTPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L     D AVHS KD+P  L +GL + AY  R    D F+S+  + L D
Sbjct: 59  KGLFVKELEQALYDKRADIAVHSLKDVPMVLPEGLMLGAYCERHAPTDAFVSNRFEHLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L + R D+ +   RG + TRL KL+  +  AI+LA +G++RL 
Sbjct: 119 LPTGAVLGTSSLRRECQLRQARPDLDIKSLRGNVGTRLGKLDAGEYDAIILATSGLERLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I+  L+ E   P+ GQGA+ IE   ++   + L+  +NH  T   V  ERA    L
Sbjct: 179 LHERIRHELDDELSLPAVGQGALAIECRSDDEAIKLLLSPLNHPKTRLCVLAERAMNRAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEV--------SRNGNRCDAINIGRDA 292
           +G C+  IAGFA  +   L   G V + DGK   +             +   A  +G D 
Sbjct: 239 EGGCQVPIAGFAVIEDGMLTLRGRVGSVDGKTLLKAQQSRKLMGEIQLDEQAAEQLGIDV 298

Query: 293 AQYIRFISNKNVF 305
           A  +      ++ 
Sbjct: 299 AHELLMQGADDIL 311


>gi|326569020|gb|EGE19089.1| porphobilinogen deaminase [Moraxella catarrhalis BC1]
          Length = 321

 Score =  259 bits (662), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 109/313 (34%), Positives = 164/313 (52%), Gaps = 10/313 (3%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +   I TR SPLAL  A   ++ L  ++  P  ++ ++ + TKGD+I +  L +IGG
Sbjct: 1   MTIRTLTIATRQSPLALWQANFIKAKLEQLY--PSLSVELLEMVTKGDKILDTPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L     D AVHS KD+P  L +GL + AY  R    D F+S+  + L D
Sbjct: 59  KGLFVKELEQALYDKRADIAVHSLKDVPMVLPEGLMLGAYCERHAPTDAFVSNHFEHLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  L + R D+ +   RG + TRL KL+  +  AI+LA +G++RL 
Sbjct: 119 LPTGAILGTSSLRRECQLRQARPDLDIKSLRGNVGTRLGKLDAGEYDAIILATSGLERLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             K I+  L+ E   P+ GQGA+ IE   ++   + L+  +NH  T   V  ERA    L
Sbjct: 179 LHKRIRHELDDELSLPAVGQGALAIECRSDDEAIKLLLSPLNHPKTRLCVLAERAMNRAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEV--------SRNGNRCDAINIGRDA 292
           +G C+  IAGFA  +   L   G V + DGK   +             +   A  +G D 
Sbjct: 239 EGGCQVPIAGFAVIEDGMLTLRGRVGSVDGKTLLKAQQSRKLMGEIQLDEQAAEQLGIDV 298

Query: 293 AQYIRFISNKNVF 305
           A  +      ++ 
Sbjct: 299 AHELLMQGADDIL 311


>gi|326560715|gb|EGE11083.1| porphobilinogen deaminase [Moraxella catarrhalis 46P47B1]
          Length = 321

 Score =  259 bits (662), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 109/313 (34%), Positives = 164/313 (52%), Gaps = 10/313 (3%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +   I TR SPLAL  A   ++ L  ++  P  ++ ++ + TKGD+I +  L +IGG
Sbjct: 1   MTIRTLTIATRQSPLALWQANFIKAKLEQLY--PSLSVELLEMVTKGDKILDTPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L     D AVHS KD+P  L +GL + AY  R    D F+S+  + L D
Sbjct: 59  KGLFVKELEQALYDKRADIAVHSLKDVPMVLPEGLMLGAYCERHAPTDAFVSNRFEHLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L + R D+ +   RG + TRL KL+  +  AI+LA +G++RL 
Sbjct: 119 LPTGAVLGTSSLRRECQLRQARPDLDIKSLRGNVGTRLGKLDAGEYDAIILATSGLERLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I+  L+ E   P+ GQGA+ IE   ++   + L+  +NH  T   V  ERA    L
Sbjct: 179 LHERIRHELDDELSLPAVGQGALAIECRSDDEAIKLLLSPLNHPKTRLCVLAERAMNRAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEV--------SRNGNRCDAINIGRDA 292
           +G C+  IAGFA  +   L   G V + DGK   +             +   A  +G D 
Sbjct: 239 EGGCQVPIAGFAVIEDGMLTLRGRVGSVDGKTLLKAQQSHKLMGEIQLDEQAAEQLGIDV 298

Query: 293 AQYIRFISNKNVF 305
           A  +      ++ 
Sbjct: 299 AHELLMQGADDIL 311


>gi|303229236|ref|ZP_07316032.1| hydroxymethylbilane synthase [Veillonella atypica ACS-134-V-Col7a]
 gi|302516091|gb|EFL58037.1| hydroxymethylbilane synthase [Veillonella atypica ACS-134-V-Col7a]
          Length = 312

 Score =  259 bits (662), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 106/305 (34%), Positives = 171/305 (56%), Gaps = 2/305 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            +   RIGTR S LAL  +   +S L  ++  P   + ++  +TKGDRI ++ L E+GGK
Sbjct: 1   MRNHIRIGTRKSALALWQSEYVKSELQRLY--PGITVELVHFNTKGDRILDKPLAEVGGK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLFT E+E  + +G+ID AVHS KDMPT+L  GL + A   RE   D  +S   ++L  L
Sbjct: 59  GLFTAELEAAMHAGDIDIAVHSLKDMPTELPDGLTLGAISKREVPFDALVSPKYKTLDQL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              + IGTSSLRR+A LL  R D+ +   RG ++TRL K+       ++LA AG+KRL  
Sbjct: 119 PEGARIGTSSLRRQAQLLHRRPDLQIEVIRGNVQTRLGKIETEGLDGVVLAQAGLKRLGL 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           +  I ++   ++  P+ GQGA+ IE   ++ +  E++  I+ E T  +V  ER+FL +L+
Sbjct: 179 DDRITQVFTADEMIPAVGQGALAIECRSDDTEMLEILSKIDDEPTRLAVEGERSFLNQLN 238

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  +  +   +   L    ++ + DGK  +E   +G     + +G++ A+ +     
Sbjct: 239 GGCQVPMGVYGTVEKGQLILKALIASLDGKTVYEGELSGPAKKGVMLGKNLAKALYEEGG 298

Query: 302 KNVFN 306
           K++  
Sbjct: 299 KHIVE 303


>gi|326574375|gb|EGE24318.1| porphobilinogen deaminase [Moraxella catarrhalis CO72]
 gi|326575506|gb|EGE25431.1| porphobilinogen deaminase [Moraxella catarrhalis 101P30B1]
          Length = 321

 Score =  259 bits (662), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 110/313 (35%), Positives = 164/313 (52%), Gaps = 10/313 (3%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +   I TR SPLAL  A   ++ L  ++  P  ++ ++ + TKGD+I +  L +IGG
Sbjct: 1   MTIRTLTIATRQSPLALWQANFIKAKLEQLY--PSLSVELLEMVTKGDKILDTPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L     D AVHS KD+P  L +GL + AY  R    D F+S+  + L D
Sbjct: 59  KGLFVKELEQALYDKRADIAVHSLKDVPMVLPEGLMLGAYCERHAPTDAFVSNRFEHLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L + R D+ +   RG + TRL KL+  +  AI+LA +G++RL 
Sbjct: 119 LPTGAVLGTSSLRRECQLRQARPDLDIKSLRGNVGTRLGKLDAGEYDAIILATSGLERLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             K I+  L+ E   P+ GQGA+ IE   ++   + L+  +NH  T   V  ERA    L
Sbjct: 179 LHKRIRHELDDELSLPAVGQGALAIECRSDDEAIKLLLSPLNHPKTRLCVLAERAMNRAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEV--------SRNGNRCDAINIGRDA 292
           +G C+  IAGFA  +   L   G V + DGK   +             +   A  +G D 
Sbjct: 239 EGGCQVPIAGFAVIEDGMLTLRGRVGSVDGKTLLKAQQSHKLMGEIQLDEQAAEQLGIDV 298

Query: 293 AQYIRFISNKNVF 305
           A  +      ++ 
Sbjct: 299 AHELLMQGADDIL 311


>gi|326562302|gb|EGE12628.1| porphobilinogen deaminase [Moraxella catarrhalis 103P14B1]
 gi|326563079|gb|EGE13352.1| porphobilinogen deaminase [Moraxella catarrhalis 12P80B1]
 gi|326571711|gb|EGE21724.1| porphobilinogen deaminase [Moraxella catarrhalis BC8]
 gi|326578075|gb|EGE27935.1| porphobilinogen deaminase [Moraxella catarrhalis O35E]
          Length = 321

 Score =  259 bits (662), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 109/313 (34%), Positives = 164/313 (52%), Gaps = 10/313 (3%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +   I TR SPLAL  A   ++ L  ++  P  ++ ++ + TKGD+I +  L +IGG
Sbjct: 1   MTIRTLTIATRQSPLALWQANFIKAKLEQLY--PSLSVELLEMVTKGDKILDTPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L     D AVHS KD+P  L +GL + AY  R    D F+S+  + L D
Sbjct: 59  KGLFVKELEQALYDKRADIAVHSLKDVPMVLPEGLMLGAYCERHAPTDAFVSNHFEHLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  L + R D+ +   RG + TRL KL+  +  AI+LA +G++RL 
Sbjct: 119 LPTGAILGTSSLRRECQLRQARPDLDIKSLRGNVGTRLGKLDAGEYDAIILATSGLERLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             K I+  L+ E   P+ GQGA+ IE   ++   + L+  +NH  T   V  ERA    L
Sbjct: 179 LHKRIRHELDDELSLPAVGQGALAIECRSDDEAIKLLLSPLNHPKTRLCVLAERAMNRAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEV--------SRNGNRCDAINIGRDA 292
           +G C+  IAGFA  +   L   G V + DGK   +             +   A  +G D 
Sbjct: 239 EGGCQVPIAGFAVIEDGMLTLRGRVGSVDGKTLLKAQQSHKLMGEIQLDEQAAEQLGIDV 298

Query: 293 AQYIRFISNKNVF 305
           A  +      ++ 
Sbjct: 299 AHELLMQGADDIL 311


>gi|303230554|ref|ZP_07317308.1| hydroxymethylbilane synthase [Veillonella atypica ACS-049-V-Sch6]
 gi|302514795|gb|EFL56783.1| hydroxymethylbilane synthase [Veillonella atypica ACS-049-V-Sch6]
          Length = 312

 Score =  259 bits (662), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 107/305 (35%), Positives = 171/305 (56%), Gaps = 2/305 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            +   RIGTR S LAL  +   +S L  ++  P   + ++  +TKGDRI N+ L E+GGK
Sbjct: 1   MRNHIRIGTRKSALALWQSEYVKSELQRLY--PGVTVELVHFNTKGDRILNKPLAEVGGK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLFT E+E  + +G+ID AVHS KDMPT+L  GL + A   RE   D  +S   ++L  L
Sbjct: 59  GLFTAELEAAMHAGDIDIAVHSLKDMPTELPDGLTLGAISKREVPFDALVSPKYKTLDQL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              + IGTSSLRR+A LL  R D+ +   RG ++TRL K+       ++LA AG+KRL  
Sbjct: 119 PEGARIGTSSLRRQAQLLHRRPDLQIEVIRGNVQTRLGKIETEGLDGVVLAQAGLKRLGL 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           +  I ++   ++  P+ GQGA+ IE   ++ +  E++  I+ E T  +V  ER+FL +L+
Sbjct: 179 DDRITQVFTADEMIPAVGQGALAIECRSDDTEMLEILSKIDDEPTRLAVEGERSFLNQLN 238

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  +  +   +   L    ++ + DGK  +E   +G     + +G++ A+ +     
Sbjct: 239 GGCQVPMGVYGTVEKGQLNLKALIASLDGKTVYEGELSGPAKKGVMLGKNLAKALYEEGG 298

Query: 302 KNVFN 306
           K++  
Sbjct: 299 KHIVE 303


>gi|239905446|ref|YP_002952185.1| porphobilinogen deaminase [Desulfovibrio magneticus RS-1]
 gi|239795310|dbj|BAH74299.1| porphobilinogen deaminase [Desulfovibrio magneticus RS-1]
          Length = 311

 Score =  259 bits (661), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 106/305 (34%), Positives = 162/305 (53%), Gaps = 2/305 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            ++   I TR S LAL  A      L   H  P   + ++P+ TKGD I +  L ++GGK
Sbjct: 1   MREKLVIATRGSKLALWQANHVADRLRQTH--PGLAVDLLPIKTKGDIILDVPLAKVGGK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +EIE+ L+ G  D AVHS KD+P +   GL +     RED  D  +S    SL  L
Sbjct: 59  GLFVKEIEEALLDGRADLAVHSMKDVPAEQPAGLVVGIVPEREDPCDRLLSVAYDSLAAL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              + +GTSSLRRKA LL  R D++++D RG ++TR+ KL + +  AI++A AG+ RL+ 
Sbjct: 119 PQGATVGTSSLRRKAQLLALRPDLAIVDLRGNLDTRVKKLLDGQFDAIIVAAAGLNRLEL 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
                  L   +F P+  QGA+ IE  +++P+   ++   +H ++ D+V  ER FL  L+
Sbjct: 179 SAPKAVRLGPPEFLPAAAQGALGIEYRLDDPETAAMLAFFDHPESHDAVAAERGFLGHLE 238

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  IA  A   G  ++  G+V   +       + +G R  A  +G   A+ +     
Sbjct: 239 GGCQVPIAAHAVIDGDMIHLEGLVADPETGQTFREAASGPRSQATALGVAVAEAVLARGA 298

Query: 302 KNVFN 306
           K V +
Sbjct: 299 KAVLD 303


>gi|71909286|ref|YP_286873.1| porphobilinogen deaminase [Dechloromonas aromatica RCB]
 gi|123733070|sp|Q479S8|HEM3_DECAR RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|71848907|gb|AAZ48403.1| Porphobilinogen deaminase [Dechloromonas aromatica RCB]
          Length = 311

 Score =  259 bits (661), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 109/307 (35%), Positives = 162/307 (52%), Gaps = 3/307 (0%)

Query: 1   MEK-KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M +     I +R S LA+  A   R  L  ++  P   +VI+ ++TKGD+I +R L EIG
Sbjct: 1   MSRPSKIVIASRESRLAMWQAVHVRDRLSSLN--PGAEVVILGMTTKGDQILDRPLAEIG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  +  G+   AVHS KD+P  + +G  ++A   RE+ RD F+S+    L 
Sbjct: 59  GKGLFIKELEVAMQEGKAHLAVHSMKDVPMVMPEGFVLAAISARENPRDAFVSNKYNGLD 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           DL   +++GTSSLRR+++L      + +   RG ++TRL KL+  +  AI+LA AG+ RL
Sbjct: 119 DLPAGAIVGTSSLRRESILRAKYPQLVIKSLRGNLDTRLKKLDAGEYDAIILAAAGLIRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
             E  IK +L  E   P+PGQGA+ IE         ++V  +N  +T   V  ERAF   
Sbjct: 179 GMENRIKSVLTAEQSLPAPGQGALGIELIDGAADMADVVAPLNDPETAHCVKAERAFSRA 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L GSC+  + G+A      L+  G V  +DG+        GN  D   +G   A  +R  
Sbjct: 239 LGGSCQVPLGGYAIIDNGQLWLRGFVATADGQEVVSAELRGNPADDEALGLQLAAELRAK 298

Query: 300 SNKNVFN 306
               +  
Sbjct: 299 GADAILE 305


>gi|21328661|gb|AAM48667.1| porphobilinogen deaminase [uncultured marine proteobacterium]
          Length = 316

 Score =  259 bits (661), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 134/305 (43%), Positives = 187/305 (61%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K P  IGTR SPLALA A+ETR+ L     +P     I+ + T GDR+T+R L EIGGKG
Sbjct: 9   KTPLNIGTRGSPLALAQAYETRARLAKAFDLPFEAFEIVVIMTTGDRVTDRPLKEIGGKG 68

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT EIE+ ++ G ID AVHS KDMP     GL +  YLPRED+RD FIS +  +L DL+
Sbjct: 69  LFTREIEQAMLDGSIDIAVHSMKDMPVLQPDGLVLDTYLPREDVRDAFISLSGGALSDLS 128

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +V+GTSSLRR+A L   R D+ V++FRG ++TRL KL N  A A  LA AG+KRL  +
Sbjct: 129 PGAVVGTSSLRRQAQLKLRRPDLQVVEFRGNLQTRLKKLENQVAEATFLAMAGLKRLNMD 188

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           +V ++ + ++D  P+  QGAI IE  +N+ +  +++  I+  +T   +  ERAFLA LDG
Sbjct: 189 EVPRQAIEVDDMLPAVAQGAIGIERRINDGRMADMLAAIHDRETGQRLAAERAFLAALDG 248

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
           SC++ IAG +  +GST+   G VL  DG             D    G++ A  +   + +
Sbjct: 249 SCETPIAGLSELQGSTMRLRGEVLRPDGSDAIHDDMVVPIEDGAQAGKEMAAKLLEQAGR 308

Query: 303 NVFNF 307
             F++
Sbjct: 309 GFFDW 313


>gi|301062020|ref|ZP_07202731.1| hydroxymethylbilane synthase [delta proteobacterium NaphS2]
 gi|300443871|gb|EFK07925.1| hydroxymethylbilane synthase [delta proteobacterium NaphS2]
          Length = 316

 Score =  259 bits (661), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 115/300 (38%), Positives = 170/300 (56%), Gaps = 2/300 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LAL  +   +  L   H     ++ +I + T GD+I +  L++IGGKGLF 
Sbjct: 3   IRIGTRGSKLALTQSEWIKEQLEIRHS--GIHVDLIKIKTTGDKILDTPLSKIGGKGLFV 60

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ L+   ID AVHS KD+P +L + L +S + PRED  D  I+   + L  L   +
Sbjct: 61  KEIEEALLQNRIDVAVHSMKDVPAELPEALMLSTFPPREDPSDALIAQENRRLDQLPEGA 120

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR A LL  R D++++  RG ++TRL KL + +  A++LA AG+ RL    VI
Sbjct: 121 RVGTSSLRRGAQLLHLRPDLTLVPLRGNVDTRLGKLKSGEVEAVILATAGLNRLGLSGVI 180

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            + +      P+ GQGA+ +E   ++ +    +  +NH+DT  +V  ER FL  L+G C+
Sbjct: 181 TQRIPFHQLLPAVGQGALGLEVRRDDRETIRRLDFLNHDDTRTAVTAERGFLKTLEGGCQ 240

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             IAGFA   G  L F G+V   DG   ++    G+R DA  IG +AA+ +      +V 
Sbjct: 241 VPIAGFAQIVGDNLSFEGLVAELDGSRIYKEIATGSRDDAEKIGIEAAKTLLSSGAGDVL 300


>gi|33866317|ref|NP_897876.1| porphobilinogen deaminase [Synechococcus sp. WH 8102]
 gi|39931373|sp|Q7U5C2|HEM3_SYNPX RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|33639292|emb|CAE08300.1| Porphobilinogen deaminase [Synechococcus sp. WH 8102]
          Length = 317

 Score =  259 bits (661), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 102/308 (33%), Positives = 157/308 (50%), Gaps = 5/308 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI +R S LA+      ++ L   H  P   I +  ++T+GD+I +  L +IG 
Sbjct: 1   MALTELRIASRRSQLAMVQTNWVKAELEKAH--PGLTITVEAMATQGDKILDVALAKIGD 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+E+E +++ G  + AVHS KD+PT L +GL +     RED  D  + +   +   
Sbjct: 59  KGLFTKELEAQMLVGRAEIAVHSLKDLPTNLPEGLMLGCITEREDPADALVVNAKNANHK 118

Query: 121 L---ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           L      +V+GTSSLRR A L      +S  D RG + TRL KL++     ++LA AG++
Sbjct: 119 LDTLPEGAVVGTSSLRRLAQLRHHYPHLSFKDVRGNVITRLEKLDSGDYDCLILAAAGLE 178

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL     I +I+  +    + GQGA+ IE   + P+  E++KV+ H  T      ERAFL
Sbjct: 179 RLGFGNRIHQIIPGDISLHAVGQGALGIECVEDKPEVLEIIKVLEHTTTSRRCLAERAFL 238

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            EL+G C+  I   +      L   G+V + DGK       +G+  D  +IG + A  ++
Sbjct: 239 RELEGGCQVPIGVNSQINNEELTLTGMVASLDGKRLIRDEASGSAADPESIGIELAGKLK 298

Query: 298 FISNKNVF 305
                 + 
Sbjct: 299 HQGAGAIL 306


>gi|114308050|gb|ABI59293.1| hydroxymethylbilane synthase [Nitrosomonas eutropha C91]
          Length = 334

 Score =  259 bits (661), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 113/306 (36%), Positives = 165/306 (53%), Gaps = 3/306 (0%)

Query: 1   MEK-KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M   +   I +R S LAL  A   RS L++++  P  +I I+ ++TKGD+I + +L++IG
Sbjct: 27  MSSPEKIVIASRESQLALWQANFIRSRLLELY--PQTDITILGMTTKGDQILDVSLSKIG 84

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  L  G  D AVHS KD+P  +  G +++A   RED RD F+S+   SL+
Sbjct: 85  GKGLFIKELELALEDGRADIAVHSMKDVPMIVPSGFRLAAITEREDPRDAFVSNDFTSLE 144

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           +L   SV+GTSSLRR++ L      + V   RG ++TRL KL+  +  AI+LA AG+KRL
Sbjct: 145 ELPTGSVVGTSSLRRESQLRARFPHLQVRPLRGNVQTRLRKLDEGEYSAIILAAAGLKRL 204

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
           +    I  ++  E   P+ GQGA+ IE   N+P   E +K ++H  T   V  ERA    
Sbjct: 205 ELGYRISMLIPPELSLPAVGQGALGIECRDNDPDMVEWMKPLHHATTAYCVEAERAMSRV 264

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L GSC+  + GFA      L   G V   DG         G       +G   AQ ++  
Sbjct: 265 LGGSCQVPLGGFAEIFEGVLTLRGFVATPDGSKIIADKLCGKPESGERVGEQLAQNLKTH 324

Query: 300 SNKNVF 305
             + + 
Sbjct: 325 GAEEIL 330


>gi|116075276|ref|ZP_01472536.1| porphobilinogen deaminase [Synechococcus sp. RS9916]
 gi|116067473|gb|EAU73227.1| porphobilinogen deaminase [Synechococcus sp. RS9916]
          Length = 316

 Score =  259 bits (661), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 106/308 (34%), Positives = 156/308 (50%), Gaps = 5/308 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI +R S LA+      ++ L   H  P   I +  ++T+GD+I +  L +IG 
Sbjct: 1   MALEQLRIASRRSQLAMVQTNWVKAELEKAH--PGLAISVEAMATQGDKILDVALAKIGD 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+E+E +++ G  + AVHS KD+PT L +GL +     RED  D    +   +   
Sbjct: 59  KGLFTKELEAQMLVGRAEIAVHSLKDLPTNLPEGLMLGCITEREDPADALAVNAKNAQYK 118

Query: 121 LAL---HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           L      SV+GTSSLRR A L      +   D RG + TRL KL++ +   ++LA AG+ 
Sbjct: 119 LDTLPAGSVVGTSSLRRLAQLRHHYPHLEFKDVRGNVITRLEKLDSGEYDCLILAAAGLT 178

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL     I +I+  E    + GQGA+ IE    +P+  EL+KV+ H  T      ER+FL
Sbjct: 179 RLGFGDRIHQIIPSEISLHAVGQGALGIECVEGSPEVLELIKVLEHAPTAARCLAERSFL 238

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            EL+G C+  I       G TL   G+V + DGK       +G   DA  IG+  A  ++
Sbjct: 239 RELEGGCQVPIGVNTVIDGDTLTLTGMVASLDGKRLIRDQASGTTADAEAIGKQLADTLK 298

Query: 298 FISNKNVF 305
                 + 
Sbjct: 299 GQGAGEIL 306


>gi|124025263|ref|YP_001014379.1| porphobilinogen deaminase [Prochlorococcus marinus str. NATL1A]
 gi|158512743|sp|A2C0V4|HEM3_PROM1 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|123960331|gb|ABM75114.1| Porphobilinogen deaminase [Prochlorococcus marinus str. NATL1A]
          Length = 315

 Score =  258 bits (660), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 102/309 (33%), Positives = 153/309 (49%), Gaps = 5/309 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI +R S LA+      R  L   H  P   I I  ++T+GD+I +  L +IG 
Sbjct: 1   MTLDQLRIASRRSQLAMVQTNWVRDELQRAH--PDLAITIEAMATQGDKILDVALAKIGD 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+E+E +++ G  + AVHS KD+PT L +GL +     RED  D  + +    +  
Sbjct: 59  KGLFTKELEAQMLLGHAEIAVHSLKDLPTNLPEGLILGCITEREDPSDALVVNEKNQIHK 118

Query: 121 L---ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           L      SV+GTSSLRR A L      +   D RG + TRL KL++ +   ++LA AG++
Sbjct: 119 LETLPEGSVVGTSSLRRLAQLRYHYPHLVFKDVRGNVITRLEKLDSGEYDCLILAAAGLQ 178

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL     I +++  +    + GQGA+ IE      K  +++K + HE T      ER+FL
Sbjct: 179 RLGFANRIHQLIPTDISLHAVGQGALGIECVSGQQKVLDILKTLEHESTSKRCLAERSFL 238

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            EL+G C+  I        + L   G+V + DGK      + G+   A  IG D A  ++
Sbjct: 239 RELEGGCQVPIGVRTEINNNELILEGMVASLDGKRLIRDIKKGSVSSAEEIGIDLANELK 298

Query: 298 FISNKNVFN 306
                 +  
Sbjct: 299 GRGAGEILE 307


>gi|225848376|ref|YP_002728539.1| porphobilinogen deaminase [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225644642|gb|ACN99692.1| porphobilinogen deaminase [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 308

 Score =  258 bits (660), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 110/304 (36%), Positives = 178/304 (58%), Gaps = 6/304 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
             RIGTR S LAL  A    + +  +H      + ++ ++T GD+I +  L +IGGKGLF
Sbjct: 2   KVRIGTRKSQLALWQANYIANLINQIH---GVEVELVKITTSGDKILDVPLAKIGGKGLF 58

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +EIE  ++ GEID AVHS KD+PT+L +GL I A   RED RD F+S   +SLKDL   
Sbjct: 59  VKEIEDAMLKGEIDIAVHSLKDVPTQLPEGLDIIAITEREDPRDAFLSTKYKSLKDLPAG 118

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           +V+GTSSLRRK+ +++ R D+ + D RG ++TR+ KL   +  AI+LAYAG+KRL  +  
Sbjct: 119 AVVGTSSLRRKSQIMKMRDDLIINDLRGNVDTRIRKLEEGQYDAIILAYAGLKRLGLDSK 178

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
              I + ++  P+  QG + IE  V++ + +++++ IN+++++     ER+FL  L+G C
Sbjct: 179 ASYIFSPQEMIPAVCQGFLGIEARVDDERIKKILEPINNQESFIRATAERSFLKTLEGGC 238

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNG---NRCDAINIGRDAAQYIRFISN 301
           +  +  +   K   ++  G +   +GK F + S +    N   A  +G+  A  +     
Sbjct: 239 QVPLGAYCEIKDDFIHITGFIADLEGKTFIKESLSEKLTNINQAKELGQRLANILLKRGG 298

Query: 302 KNVF 305
           K++ 
Sbjct: 299 KDIL 302


>gi|161594062|ref|NP_899724.2| porphobilinogen deaminase [Chromobacterium violaceum ATCC 12472]
 gi|55976482|sp|Q7P207|HEM3_CHRVO RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
          Length = 309

 Score =  258 bits (660), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 111/301 (36%), Positives = 166/301 (55%), Gaps = 2/301 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
              I +R S LA+  A   ++ L  ++  P   + I+ ++T+GD+I ++TL++IGGKGLF
Sbjct: 3   KIVIASRESRLAMWQAEHIQARLQALY--PHLTVEILGMTTQGDQILDKTLSKIGGKGLF 60

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +E+E+ L+ G  D AVHS KD+P  L  G  ++A   RED RD F+S+  Q L +L   
Sbjct: 61  VKELEQALMDGRADLAVHSLKDVPMTLPDGFALAAVCEREDPRDAFVSNRYQHLSELPAG 120

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           SV+GTSSLRR+A L      ++V   RG ++TRL KL++ +  AI+LA AG+KRL   + 
Sbjct: 121 SVVGTSSLRREAQLRARFPQLAVKPLRGNVQTRLKKLDDGEFDAIILAAAGLKRLGLAER 180

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I+  L   +  P+ GQGA+ IE   +      L+  +NH DT      ERA   EL GSC
Sbjct: 181 IQGELAPSESLPAAGQGALGIEIRADRADLSALLAPLNHPDTRACTAAERALAKELGGSC 240

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           +  +  FA     TL   G+V   DG +    S +G    A  +GR  A+ +     + +
Sbjct: 241 QVPLGAFATLADGTLTLGGLVAHPDGSVVLTASASGPADYADALGRAVAKKLIDAGARPL 300

Query: 305 F 305
            
Sbjct: 301 I 301


>gi|323451650|gb|EGB07526.1| hypothetical protein AURANDRAFT_27306 [Aureococcus anophagefferens]
          Length = 333

 Score =  258 bits (660), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 131/306 (42%), Positives = 187/306 (61%), Gaps = 3/306 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIP---PHNIVIIPLSTKGDRITNRTLTEIGGK 61
           P RIGTR SPLALA A+ TR  LM            I +  + T+GD I ++ L+EIGGK
Sbjct: 19  PLRIGTRGSPLALAQAYMTRELLMKNFPEELGGEGAIQLCIMKTQGDMILDKALSEIGGK 78

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLFT+E++  L+  E+D  VHS KD+PT L     +   L RED RDVFIS TA+SLKDL
Sbjct: 79  GLFTKELDVALLGDEVDICVHSMKDVPTWLPAKTVLPCMLEREDTRDVFISPTAKSLKDL 138

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              SVIG++SLRR++ +L     +  ++FRG ++TRL KL+     A LLAYAG+KR+  
Sbjct: 139 KDGSVIGSASLRRQSQILAINPTLKCVNFRGNVQTRLRKLDEGVVDATLLAYAGLKRMDM 198

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
              +  +L  ++  P+  QGAI I+   ++ +A + +  +NHE+T+  V+CERAFLA LD
Sbjct: 199 ADEVTAVLEWDEMLPAVAQGAIGIQCRDDDARALKYIAALNHEETFTCVSCERAFLAALD 258

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G+CK+ IAG A      L F G+V + DG+  +  ++ G   DA  IGR+A + I+  + 
Sbjct: 259 GNCKTPIAGQARIVDGELLFDGLVSSLDGQQMYRATKTGAPADAEKIGREAGEGIKAEAG 318

Query: 302 KNVFNF 307
              F +
Sbjct: 319 IEFFEW 324


>gi|258514534|ref|YP_003190756.1| porphobilinogen deaminase [Desulfotomaculum acetoxidans DSM 771]
 gi|257778239|gb|ACV62133.1| porphobilinogen deaminase [Desulfotomaculum acetoxidans DSM 771]
          Length = 309

 Score =  258 bits (660), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 111/303 (36%), Positives = 164/303 (54%), Gaps = 2/303 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            +   +GTR S LAL  A      L + +  P ++  I  + T GD I +  L +IG KG
Sbjct: 1   MREIVVGTRDSQLALWQANWVVDRLRERN--PGYSFRIQGIKTHGDNILDVALAKIGDKG 58

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT+E+E  L+S EID AVHS KD+PT L  GL + A   RE   DV +S     L  L 
Sbjct: 59  LFTKELEVALLSDEIDLAVHSMKDLPTDLPGGLAVGAVCEREYPGDVLVSSQGYVLDKLP 118

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +VIGTSSLRR A LL +R D+ +++ RG + TRL K++  K   ++LAYAGI+RL  +
Sbjct: 119 EGAVIGTSSLRRTAQLLHYRQDLRIVNIRGNLNTRLRKMDEEKLDGVVLAYAGIQRLGLK 178

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I E + +E   P+ GQG+I IE    + +  ++V+ I H  +  +V+ ER FL  L+G
Sbjct: 179 DRITERIPMEICLPAVGQGSIGIEIRHLDEEIMDIVETIEHRPSRIAVSAERNFLKRLEG 238

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  I  +    G+ + F G++ + DGK        G   +A  IG   A+ +     +
Sbjct: 239 GCQVPIGAYGLVIGNEIKFEGLIASLDGKHLVRDVIAGPVNEAAKIGVKLAESLLKKGGR 298

Query: 303 NVF 305
            + 
Sbjct: 299 EIL 301


>gi|323701815|ref|ZP_08113485.1| porphobilinogen deaminase [Desulfotomaculum nigrificans DSM 574]
 gi|323533119|gb|EGB22988.1| porphobilinogen deaminase [Desulfotomaculum nigrificans DSM 574]
          Length = 309

 Score =  258 bits (660), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 103/304 (33%), Positives = 159/304 (52%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            K+  ++G+R S LAL       + L   +  P  +  I+ + TKGD++ +  L +IG K
Sbjct: 1   MKRKIKVGSRDSALALWQTRWVVAQLEQQN--PHLSFEIVTMKTKGDKMLDVALAKIGDK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLFT+E+E  +++ EID AVHS KDMPT L  GL I A   R++  D  IS   + L +L
Sbjct: 59  GLFTKELELAMLNKEIDFAVHSLKDMPTALPAGLTIGAVCKRDNPGDALISKDGRKLAEL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              + IGTSSLRR A LL +R D  +   RG + TR+ K+ + +  AI+LA AGI R+  
Sbjct: 119 PQGARIGTSSLRRCAQLLNYRPDFRLEALRGNLNTRMKKMASQQLDAIILAAAGIYRMGW 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
             +I EI+      P+ GQGAI +E   ++ +  +L++ + H+ T  + + ER+ L  L+
Sbjct: 179 SDMIAEIIPFNVCLPAVGQGAIAVECREDDIEINQLLQGVEHQPTRVATDAERSLLRRLE 238

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I  +       L    IV   DG+        G    A  +G + A  +  +  
Sbjct: 239 GGCQVPIGAYGEVIEDRLSLQAIVATLDGQRLIRAQGEGALNQAEELGIEVADKLLSMGG 298

Query: 302 KNVF 305
           K + 
Sbjct: 299 KEIL 302


>gi|242278118|ref|YP_002990247.1| porphobilinogen deaminase [Desulfovibrio salexigens DSM 2638]
 gi|259647794|sp|C6BYB7|HEM3_DESAD RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|242121012|gb|ACS78708.1| porphobilinogen deaminase [Desulfovibrio salexigens DSM 2638]
          Length = 308

 Score =  258 bits (659), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 110/304 (36%), Positives = 166/304 (54%), Gaps = 2/304 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            +   I TR S LAL  A      L + +  P   + ++ + TKGD+I +  L ++GGKG
Sbjct: 1   MRKITIATRGSKLALWQANHISDLLREEY--PGIEVQLLKIKTKGDKILDVPLAKVGGKG 58

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +EIE+ L+ G  D AVHS KD+PT+L +GL++    PRE   D  +S    SLKDL 
Sbjct: 59  LFVKEIEEALLDGRADLAVHSMKDVPTELPEGLEVGIIPPREAETDTLLSVKYDSLKDLP 118

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +V+GTSSLRR++ +L  R D+ +   RG ++TR+ KL N +  AI++A AG+ RLK  
Sbjct: 119 AGAVVGTSSLRRQSQVLALRDDLKIESLRGNLDTRVGKLLNGEFDAIVVATAGLNRLKLS 178

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
               EIL    F P+  QGA+ IE  + + + Q+++  ++ E T   V  ER FL  LDG
Sbjct: 179 APKSEILGPPTFLPAVAQGALGIEYRIEDTEIQDILAFLHDEMTARQVKAERGFLTGLDG 238

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  IA ++  +   +   G V   DG     + + G   DA +IG   A+ +     K
Sbjct: 239 GCQVPIAAWSQLESDQVKLTGFVADIDGSSPIRMEKTGPAEDAWDIGLALAEEVLAAGAK 298

Query: 303 NVFN 306
            + +
Sbjct: 299 EILD 302


>gi|88705502|ref|ZP_01103212.1| Porphobilinogen deaminase [Congregibacter litoralis KT71]
 gi|88700015|gb|EAQ97124.1| Porphobilinogen deaminase [Congregibacter litoralis KT71]
          Length = 308

 Score =  258 bits (659), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 100/300 (33%), Positives = 166/300 (55%), Gaps = 2/300 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
             I TR SPLAL  A+  R +L++ H  P   + ++ ++++GD+I +  L ++GGKGLF 
Sbjct: 5   VVIATRESPLALWQAYFVRDTLLETH--PGITVELLGMTSRGDQILDVPLAKVGGKGLFV 62

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+ G    AVHS KD+P +  +GL+++    RE+  D F+S+  ++L  L   +
Sbjct: 63  KELETALLDGRAHIAVHSMKDVPMEFPEGLELAVICEREEPADAFVSNRYENLDALPAGA 122

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ V   RG + TRL KL+  +  A++LA AG+ RL+  + I
Sbjct: 123 IVGTSSLRRECQLRANRPDLEVRFLRGNVNTRLRKLDEGEYDAVILACAGLIRLEMGERI 182

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  + + D  P+ GQGA+ IE   ++   ++L++ ++H  T + V  ERA    L G C+
Sbjct: 183 RARIPVTDSLPAGGQGAVGIEIRSDDSATRKLLEPLHHGPTAERVLAERALNRRLQGGCE 242

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             IA +A  +G  L+  G+V   DG         G+R +   +G   A  +       + 
Sbjct: 243 VPIASYAVHEGDELWLRGLVGRPDGSHTLRADARGSREEPEALGIAVADSLLEAGAAEIL 302


>gi|148241995|ref|YP_001227152.1| porphobilinogen deaminase [Synechococcus sp. RCC307]
 gi|158513324|sp|A5GSE0|HEM3_SYNR3 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|147850305|emb|CAK27799.1| Porphobilinogen deaminase [Synechococcus sp. RCC307]
          Length = 317

 Score =  258 bits (659), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 102/308 (33%), Positives = 150/308 (48%), Gaps = 5/308 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI +R S LA+      R  L + H  P   I I  ++T+GD+I +  L +IG 
Sbjct: 1   MTASSLRIASRRSQLAMVQTEWVRDELANAH--PGLEISIEAMATQGDKILDVALAKIGD 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSL-- 118
           KGLFT+E+E +++    D AVHS KD+PT L +GL +     RED  D  + H       
Sbjct: 59  KGLFTKELEAQMLVNRADIAVHSLKDLPTNLPEGLMLGCITEREDPADALVMHAKNKDLT 118

Query: 119 -KDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
              L   +V+GTSSLRR A L      ++  D RG + TRL KL++ +   ++LA AG+ 
Sbjct: 119 LATLPEGAVVGTSSLRRLAQLRYHYPHLTFKDVRGNVITRLEKLDSGQFDCLILAAAGLG 178

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL     I E+++      + GQGA+ IE    +    E +KV+ H  T      ERAFL
Sbjct: 179 RLGLGDRIHELIDPSISLHAVGQGALGIECRDGDAAVLEQIKVLEHRPTSLRCLAERAFL 238

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
             L+G C+  I      +G  L   G+V + DGK          +  A ++G   A+ +R
Sbjct: 239 RTLEGGCQVPIGVNTRFEGDELVLTGMVASLDGKQLIRDELRAPQDQAEDLGNRLAELLR 298

Query: 298 FISNKNVF 305
                 + 
Sbjct: 299 SQGAGEIL 306


>gi|117924047|ref|YP_864664.1| hydroxymethylbilane synthase [Magnetococcus sp. MC-1]
 gi|117607803|gb|ABK43258.1| hydroxymethylbilane synthase [Magnetococcus sp. MC-1]
          Length = 314

 Score =  258 bits (659), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 112/306 (36%), Positives = 169/306 (55%), Gaps = 3/306 (0%)

Query: 1   MEKKPF-RIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M      RIGTR S LA+  A   +S L   H  P   + +  + TKGD+I +  L ++G
Sbjct: 1   MSDPQLVRIGTRGSALAVWQAEWVKSQLQAHH--PGIIVELELIKTKGDKILDVPLAKVG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E+ ++ G +D AVHS KD+P +   GL +   L RED RD  +S   QSL 
Sbjct: 59  GKGLFVKELEEAMLDGRVDLAVHSMKDVPAEFPDGLMLGPILKREDPRDALLSIHYQSLA 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           +L   ++IG+SSLRR++ +   R D+ +   RG + TR+ KL   +  AI+LA AG+KRL
Sbjct: 119 ELPQGALIGSSSLRRQSQIKAKRPDLRLDWLRGNVGTRIQKLVEGQFDAIILAAAGVKRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
              + + + L  E+  P+ GQGA+ IE  V++ +   L+  + H++T   V  ERAFLA+
Sbjct: 179 GLTEHVVQYLEPEEMLPAVGQGAVGIEHRVDDARIATLLAPLYHKETHSCVTAERAFLAK 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  IAG+A     TL   G+V   +G    +    G R DA  +G+  A  +   
Sbjct: 239 LEGGCQVPIAGYATLHEDTLTLRGLVAEVEGGRVVQAQCQGPRADAYRMGQQLATQLLEA 298

Query: 300 SNKNVF 305
               + 
Sbjct: 299 GGGAIL 304


>gi|308273123|emb|CBX29726.1| Porphobilinogen deaminase [uncultured Desulfobacterium sp.]
          Length = 323

 Score =  258 bits (659), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 119/304 (39%), Positives = 167/304 (54%), Gaps = 2/304 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K+   IGTR S LAL  A   +S L+   K    ++ +  + TKGDRI +  L ++GGKG
Sbjct: 17  KRKIIIGTRGSKLALWQAEWVKSYLVQ--KFTDLSVELKIIKTKGDRILDVALAKVGGKG 74

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +EIE+ L    ID AVHS KDMP  L  GL I A   RE+ RDV IS     L  L 
Sbjct: 75  LFVKEIEQSLADSSIDIAVHSMKDMPADLHDGLCIGAIPERENPRDVLISGKGLLLSQLP 134

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +++GTSSLRR A + R R D+ +   RG ++TR+NKL   +  AI+LA AG+KRL  E
Sbjct: 135 EGALVGTSSLRRIAQIKRIRPDLVIAPLRGNLDTRINKLEMGEIDAIILAAAGVKRLGLE 194

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           K+I E LN +   P+ GQGA+CIE   ++      +  +NH  T   V  ERAFL  ++G
Sbjct: 195 KIITEYLNEDTMLPAVGQGALCIEIRKDDHDISGFINEMNHFVTRAVVLGERAFLKRIEG 254

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  IAG+   +       G+V   DGK     ++ G+   + +IG   A  +  +  K
Sbjct: 255 GCQVPIAGYGKVENDIFIIRGLVADPDGKTIITDTQRGSLESSESIGAALADRLISMGAK 314

Query: 303 NVFN 306
            + +
Sbjct: 315 RLLD 318


>gi|255262067|ref|ZP_05341409.1| porphobilinogen deaminase [Thalassiobium sp. R2A62]
 gi|255104402|gb|EET47076.1| porphobilinogen deaminase [Thalassiobium sp. R2A62]
          Length = 326

 Score =  258 bits (659), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 134/303 (44%), Positives = 179/303 (59%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P  IGTR SPLALA A+ETR+ L     +P     I+ + T GDRI +R L EIGGKGLF
Sbjct: 23  PLNIGTRGSPLALAQAYETRARLSAAFDLPSEAFTIVVIKTTGDRIIDRPLKEIGGKGLF 82

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T EIE  ++ G+ID AVHS KDMP     GL I  YLPRED RD FI+     LKDLA  
Sbjct: 83  TREIEDAMLQGDIDIAVHSMKDMPVLQPDGLLIDTYLPREDNRDAFIALDGSGLKDLAEG 142

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           + +GTSSLRR A L+  R D+++++FRG ++TRL KL +  A A  LA AG+ RLK + V
Sbjct: 143 ATVGTSSLRRHAQLMNRRPDLNIVEFRGNLQTRLKKLGDGVAEATFLAMAGLNRLKMDDV 202

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
            +  +  +D  P+  QGAI IE   ++ +  E+++ I+   T   +  ERAFL  LDGSC
Sbjct: 203 PRTAIETDDMLPAVAQGAIGIERRADDSRMAEMLEAIHDGPTGQRLAAERAFLKALDGSC 262

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           ++ IAG A   G  LY  G VL  DG      + +G   D   +GR  A  +   + +  
Sbjct: 263 ETPIAGLAELNGGILYLRGEVLRVDGSDTVYDAASGPIEDGAEMGRVMAAKLLAEAGEGF 322

Query: 305 FNF 307
           F++
Sbjct: 323 FDW 325


>gi|288818572|ref|YP_003432920.1| porphobilinogen deaminase [Hydrogenobacter thermophilus TK-6]
 gi|288787972|dbj|BAI69719.1| porphobilinogen deaminase [Hydrogenobacter thermophilus TK-6]
 gi|308752163|gb|ADO45646.1| porphobilinogen deaminase [Hydrogenobacter thermophilus TK-6]
          Length = 304

 Score =  258 bits (659), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 115/300 (38%), Positives = 174/300 (58%), Gaps = 6/300 (2%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LAL  A   +  L  +     H + ++ ++T GD+I +  L +IGGKGLF 
Sbjct: 3   LRIGTRKSKLALWQANFVKEKLEKM----GHQVDLVHITTSGDKILDVPLAKIGGKGLFV 58

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ L+  EID AVHS KD+P  L +GL+I A   RE+  DV IS     L++L  ++
Sbjct: 59  KEIEEALMKKEIDLAVHSLKDVPMNLPEGLKIGAVTERENPFDVLISKDHLPLEELPSNA 118

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+  + R R D+ V   RG ++TR+ KL+    HA++LAYAG+KR+  E  I
Sbjct: 119 KVGTSSLRRQVQIKRRRGDLRVEMLRGNVDTRIRKLDEGLYHAVILAYAGVKRMGLEDRI 178

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            ++  +EDF P+ GQG++ IE   ++   +E+V   +H ++     CERAFL EL G C+
Sbjct: 179 TQV--LEDFIPAVGQGSLAIEIRQDDSAVEEIVSCFDHYESRLRAECERAFLRELQGGCQ 236

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             I  +++ +G T++  G V   +G  F E  R+G   +A  IG+  A  +       + 
Sbjct: 237 VPIGAYSWIEGDTIFIKGFVSDLEGIKFIEGMRSGEAKEAQQIGKSLAHDLLREGADQIL 296


>gi|254525987|ref|ZP_05138039.1| porphobilinogen deaminase [Prochlorococcus marinus str. MIT 9202]
 gi|221537411|gb|EEE39864.1| porphobilinogen deaminase [Prochlorococcus marinus str. MIT 9202]
          Length = 318

 Score =  258 bits (658), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 104/308 (33%), Positives = 159/308 (51%), Gaps = 5/308 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     +I +R S LA+      +  L     IP  ++ I  ++T+GD+I +  L +IG 
Sbjct: 1   MTNFKLKIASRRSKLAMVQTLWVKDQLER--NIPNLDVSIEAMATQGDKILDVALAKIGD 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFI---SHTAQS 117
           KGLFT+E+E +++ G  D AVHS KD+PT L  GL++     RED  D  +    +    
Sbjct: 59  KGLFTKELEAQMLVGHADIAVHSLKDLPTNLPTGLKLGCITKREDPADALVVSKKNDCYK 118

Query: 118 LKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           L+ L   S++GTSSLRR A L      +   D RG + TR+ KL+  +   I+LA AG+K
Sbjct: 119 LETLPEGSIVGTSSLRRLAQLRNKYPHLVFKDIRGNVITRIEKLDAGEFDCIILAAAGLK 178

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL  E  I +I+  E    + GQGA+ IE   ++ K  E++ V+  + T      ERAFL
Sbjct: 179 RLGFESRIHQIIPSEISLHAVGQGALGIECKSDDKKVLEIINVLEDKPTSQRCLAERAFL 238

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            EL+G C+  I   +      LY  G+V + DGK   +    GN  +   +G + A+ ++
Sbjct: 239 RELEGGCQVPIGVNSNIDNGQLYLTGMVASLDGKKLIKDQVIGNINNPELVGIELAKRLK 298

Query: 298 FISNKNVF 305
           F     + 
Sbjct: 299 FQGADKIL 306


>gi|94969590|ref|YP_591638.1| porphobilinogen deaminase [Candidatus Koribacter versatilis
           Ellin345]
 gi|123256362|sp|Q1INI6|HEM3_ACIBL RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|94551640|gb|ABF41564.1| hydroxymethylbilane synthase [Candidatus Koribacter versatilis
           Ellin345]
          Length = 311

 Score =  258 bits (658), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 103/302 (34%), Positives = 169/302 (55%), Gaps = 6/302 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
             RIG+R S LAL  A    + L +      H + +  + T GD+I +  L ++G KG+F
Sbjct: 3   TLRIGSRGSQLALWQANHISALLRER----GHEVELEIIKTTGDKILDVALAKVGTKGMF 58

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T+EIE+ L +G++D AVHS KD+PT+L +G +++A   RE+ RDVF+S    S+  L   
Sbjct: 59  TKEIEEALAAGKVDVAVHSLKDLPTELPQGFELAAVTKRENPRDVFLSVKYDSISGLPQG 118

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           + +GTSSLRR+A +   R D+ +   RG ++TR+ KL   +  AI+LA+AG+ RL K ++
Sbjct: 119 AKVGTSSLRRQAQIKAIRPDLEIFPLRGNVDTRVRKLEQGEYDAIILAFAGLNRLGKTQL 178

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           +KEI++ +   P+ GQGA+ IE  + + + +E++  +N  D   +   ERA L +L G C
Sbjct: 179 VKEIISEDVMCPAAGQGALGIEIRLGDTRMREILSFLNDYDARATTTAERALLNQLGGGC 238

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           +  I  FA  K   ++   I    DG      S++G   D  ++G +  + +       +
Sbjct: 239 QVPIGAFAEVKDGQVHLTAICARPDGSEILRESKSG--ADPAHLGEEVGKTLLARGATKI 296

Query: 305 FN 306
             
Sbjct: 297 LE 298


>gi|86139102|ref|ZP_01057673.1| porphobilinogen deaminase [Roseobacter sp. MED193]
 gi|85824333|gb|EAQ44537.1| porphobilinogen deaminase [Roseobacter sp. MED193]
          Length = 319

 Score =  258 bits (658), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 129/307 (42%), Positives = 176/307 (57%), Gaps = 4/307 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGD----RITNRTLTEIGG 60
           P +IGTR SPLALA A+ETR  L +   +P     I+ + T GD       ++ L E+GG
Sbjct: 11  PLKIGTRGSPLALAQAYETRRRLAEAFDLPHEAFEIVVIKTSGDNQALIAADKPLKELGG 70

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ L+SG ID AVHS KDMP    +GL +  YLPRED+RD F+S     L+D
Sbjct: 71  KGLFTKEIEEDLLSGAIDIAVHSMKDMPVAQPEGLLLDCYLPREDVRDAFVSPKFSRLQD 130

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+A L+  R D+ V++FRG ++TRL KLN   A    LA AG+ RL 
Sbjct: 131 LEPGAVVGTSSLRRRAQLMNRRPDLKVVEFRGNVQTRLKKLNEGVAECTFLAMAGLNRLA 190

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
              V    +   D  P+  QGAI IE   ++ +   +++ I+   T   +  ERAFLA L
Sbjct: 191 MADVPATAIETNDMLPAVAQGAIGIERRGDDSRTAAMLEAIHDVTTGKRLAAERAFLAAL 250

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG A   G TL   G VL  DG       ++    D   +GR+ A  +   +
Sbjct: 251 DGSCETPIAGLAELDGGTLRLRGEVLRPDGSEALAEDQSCAIEDGGELGREMAAKLLATA 310

Query: 301 NKNVFNF 307
               F++
Sbjct: 311 GPGFFDW 317


>gi|304388235|ref|ZP_07370355.1| hydroxymethylbilane synthase [Neisseria meningitidis ATCC 13091]
 gi|304337762|gb|EFM03911.1| hydroxymethylbilane synthase [Neisseria meningitidis ATCC 13091]
          Length = 311

 Score =  258 bits (658), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 105/305 (34%), Positives = 166/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K   I +R S LA+  A   +  L  ++  P   + I+ ++T+GD+I +RTL+++GG
Sbjct: 1   MNPKKLVIASRESLLAMWQAKHIQGRLKALY--PDCEVEILGMTTRGDQILDRTLSKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L  G  D AVHS KD+P  L +G  ++A   R +  D F+S+    L++
Sbjct: 59  KGLFVKELEQALYDGRADLAVHSIKDVPMDLPEGFALAAIGERANPFDAFVSNQYTRLEE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           +   +V+GTSSLRR+A L      + +   RG ++TRL+KL+N +  AI+LA AG++RLK
Sbjct: 119 MPEGAVVGTSSLRREAQLRARYPHLLIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I+ IL+  D  P+ GQGA+ IE   +     E++K +NH  T   V  ERA    L
Sbjct: 179 LDGRIRMILSESDSLPAAGQGALGIEIAAHREDLYEVLKPLNHGVTNACVTAERALARAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC+  +A +   +   L   G+V   DG +            A  +GR  A+ +    
Sbjct: 239 GGSCQVPLAAYCTEENGLLTLRGLVGHPDGSVVLRADAQAPAEYADALGRAVAKKLADDG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 ARELI 303


>gi|261393090|emb|CAX50687.1| porphobilinogen deaminase (PBG; hydroxymethylbilane synthase; HMBS;
           pre-uroporphyrinogen synthase) [Neisseria meningitidis
           8013]
          Length = 311

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 103/305 (33%), Positives = 167/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K   I +R S LA+  A   +  L  ++  P   + I+ ++T+GD+I ++TL+++GG
Sbjct: 1   MNPKKLVIASRESLLAMWQAKHIQGRLKALY--PDCEVEILGMTTRGDQILDKTLSKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L  G  D AVHS KD+P  L +G  ++A   R +  D F+S+    L++
Sbjct: 59  KGLFVKELEQALYDGRADLAVHSIKDVPMDLPEGFALAAIGERANPFDAFVSNQYARLEE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           +   +V+GTSSLRR+A L      + +   RG ++TRL+KL+N +  AI+LA AG++RL+
Sbjct: 119 MPKGAVVGTSSLRREAQLRARYPHLVIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I+ IL+  D  P+ GQGA+ IE   +     E++K +NH+ T   V  ERA    L
Sbjct: 179 LDGRIRMILSESDSLPAAGQGALGIEIAAHREDLYEVLKPLNHDTTHACVTAERALARAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC+  +A +   +   L   G+V   DG +            A  +GR  A+ +    
Sbjct: 239 GGSCQVPLAAYCTEENGLLTLRGLVGHPDGSVVLRADAQAPAEYADALGRAVAKKLADDG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 ARELI 303


>gi|325141763|gb|EGC64215.1| porphobilinogen deaminase [Neisseria meningitidis 961-5945]
 gi|325197751|gb|ADY93207.1| porphobilinogen deaminase [Neisseria meningitidis G2136]
          Length = 311

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 104/305 (34%), Positives = 167/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K   I +R S LA+  A   +  L  ++  P   + I+ ++T+GD+I ++TL+++GG
Sbjct: 1   MNPKKLVIASRESLLAMWQAKHIQGRLKALY--PDCEVEILGMTTRGDQILDKTLSKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L  G  D AVHS KD+P  L +G  ++A   R +  D F+S+    L++
Sbjct: 59  KGLFVKELEQALYDGRADLAVHSIKDVPMDLPEGFALAAIGERANPFDAFVSNQYARLEE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           +   +V+GTSSLRR+A L      + +   RG ++TRL+KL+N +  AI+LA AG++RLK
Sbjct: 119 MPKGAVVGTSSLRREAQLRARYPHLLIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I+ IL+  D  P+ GQGA+ IE   +     E++K +NH+ T   V  ERA    L
Sbjct: 179 LDGRIRMILSESDSLPAAGQGALGIEIAAHREDLYEVLKPLNHDTTHACVTAERALARAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC+  +A +   +   L   G+V   DG +            A  +GR  A+ +    
Sbjct: 239 GGSCQVPLAAYCTEENGLLTLRGLVGHPDGSVVLRADAQAPAEYADALGRAVAKKLADDG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 ARELI 303


>gi|325133945|gb|EGC56601.1| porphobilinogen deaminase [Neisseria meningitidis M13399]
 gi|325143900|gb|EGC66212.1| porphobilinogen deaminase [Neisseria meningitidis M01-240013]
 gi|325206609|gb|ADZ02062.1| porphobilinogen deaminase [Neisseria meningitidis M04-240196]
          Length = 311

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 102/305 (33%), Positives = 166/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K   I +R S LA+  A   +  L  ++  P   + I+ ++T+GD+I ++TL+++GG
Sbjct: 1   MNPKKLVIASRESLLAMWQAKHIQGRLKALY--PDCEVEILGMTTRGDQILDKTLSKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L  G  D AVHS KD+P  L +G  ++A   R +  D F+S+    L++
Sbjct: 59  KGLFVKELEQALYDGRADLAVHSIKDVPMDLPEGFALAAIGERANPFDAFVSNQYTRLEE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           +   +V+GTSSLRR+A L      + +   RG ++TRL+KL+N +  AI+LA AG++RL+
Sbjct: 119 MPEGAVVGTSSLRREAQLRARYPHLLIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I+ IL+  +  P+ GQGA+ IE   +     E++K +NH  T   V  ERA    L
Sbjct: 179 LDGRIRMILSESESLPAAGQGALGIEIAAHREDLYEVLKPLNHGVTNACVTAERALARAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC+  +A +   +   L   G+V   DG +            A  +GR  A+ +    
Sbjct: 239 GGSCQVPLAAYCTEENGLLTLRGLVGHPDGSVVLRADAQAPAEYADALGRAVAKKLADDG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 ARELI 303


>gi|291288798|ref|YP_003505614.1| porphobilinogen deaminase [Denitrovibrio acetiphilus DSM 12809]
 gi|290885958|gb|ADD69658.1| porphobilinogen deaminase [Denitrovibrio acetiphilus DSM 12809]
          Length = 308

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 117/306 (38%), Positives = 170/306 (55%), Gaps = 5/306 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           MEK    I TR S LAL  A+ TR  L   H      + +  + TKGD+I +  L +IGG
Sbjct: 1   MEK--VVIATRGSNLALWQAYYTRDRLQKEH---GVEVELNIIKTKGDKILDVPLAKIGG 55

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE+ LI G+ D AVHS KD+P ++ +GL++ A        D F+S     + +
Sbjct: 56  KGLFVKEIEQALIDGKADIAVHSMKDVPMEMPEGLELYASPEGASPYDCFVSVKYNEVVE 115

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRRK  LL+ R D+ + D RG + TRL KL   +   I+LA AG+ RL+
Sbjct: 116 LPQGAVVGTSSLRRKLQLLKMRPDLVIKDLRGNVNTRLAKLEAGEFDGIVLAKAGLVRLE 175

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
              VIKE    +   P+  QGA+  +   N+ + +EL++ +    T   V+ ERAFL  L
Sbjct: 176 LGHVIKETFTADQMLPACCQGALGFQIRANDTRMKELLRFMKDPATETKVSMERAFLRRL 235

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C++ IAG +   GS +   GIV A DG+ F E    G+  DA  +G + A+ +    
Sbjct: 236 EGGCQAPIAGHSVLTGSKICMKGIVAALDGRTFIEQFIEGHAEDAEKLGLELAERVLNAG 295

Query: 301 NKNVFN 306
            K++  
Sbjct: 296 AKDILE 301


>gi|313496556|gb|ADR57922.1| HemC [Pseudomonas putida BIRD-1]
          Length = 313

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 110/305 (36%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H      + ++P+ ++GD++ +  L +IGG
Sbjct: 1   MSTREIRIATRKSALALWQAEYVKARLEQAHT--GLQVTLVPMVSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  E D AVHS KD+P    +GL +     RED RD F+S+T  SL+ 
Sbjct: 59  KGLFVKELETALLDNEADIAVHSMKDVPMDFPEGLGLYCICEREDPRDAFVSNTFDSLEA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++H DT D V  ERA    L
Sbjct: 179 FEDRITSTISVDDSLPAGGQGAVGIECRSADVEIHALLAPLHHVDTADRVMAERALNKRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  L+  G+V    G           R  A  +G   A+ +    
Sbjct: 239 NGGCQVPIACYAVLEGDQLWLRGLVGQPSGGTLLVADARAPRAAAEALGVQVAEDLLGQG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AEAIL 303


>gi|56698469|ref|YP_168844.1| porphobilinogen deaminase [Ruegeria pomeroyi DSS-3]
 gi|56680206|gb|AAV96872.1| porphobilinogen deaminase [Ruegeria pomeroyi DSS-3]
          Length = 319

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 134/307 (43%), Positives = 188/307 (61%), Gaps = 4/307 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGD----RITNRTLTEIGG 60
           P +IGTR SPLALA A+ETR  L     +P     I+ +ST GD       +R L EIG 
Sbjct: 11  PLKIGTRGSPLALAQAYETRHRLGAAFDLPEDAFEIVVISTTGDNRAMIEADRPLKEIGN 70

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ ++ G+ID AVHS KDMP +   GL +  +LPRED+RD FIS    +++D
Sbjct: 71  KGLFTKEIEEAMLRGDIDIAVHSTKDMPVEQPAGLVLDTFLPREDVRDAFISPGHSAIRD 130

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L L +V+GTSSLRRKA LL  R D+ V++FRG ++TRL KL+   A    LA AGI+RL 
Sbjct: 131 LPLGAVVGTSSLRRKAQLLNRRPDLKVVEFRGNVQTRLRKLSEGVAECTFLAMAGIRRLN 190

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             +V    ++ +D  P+  QGAI IE  +++ +A E++  I+H +T   +  ERA LA L
Sbjct: 191 MAEVPATAISPDDMLPAIAQGAIGIERRMDDTRAAEMLTAIHHGETGQRLAAERALLAAL 250

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG A   G+TL   G VL  DG     + R+G+  D   +G + A+ +   +
Sbjct: 251 DGSCETPIAGLAELDGTTLRLRGEVLRPDGSEAITLDRSGDVADGPALGTEMARELLAQA 310

Query: 301 NKNVFNF 307
               F++
Sbjct: 311 GPGFFDW 317


>gi|157412912|ref|YP_001483778.1| porphobilinogen deaminase [Prochlorococcus marinus str. MIT 9215]
 gi|167008816|sp|A8G3L1|HEM3_PROM2 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|157387487|gb|ABV50192.1| Porphobilinogen deaminase [Prochlorococcus marinus str. MIT 9215]
          Length = 318

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 103/308 (33%), Positives = 158/308 (51%), Gaps = 5/308 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     +I +R S LA+      +  L     IP  ++ I  ++T+GD+I +  L +IG 
Sbjct: 1   MTNFKLKIASRRSKLAMVQTLWVKDQLER--NIPNLDVSIEAMATQGDKILDVALAKIGD 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFI---SHTAQS 117
           KGLFT+E+E +++ G  D AVHS KD+PT L  GL++     RED  D  +    +    
Sbjct: 59  KGLFTKELEAQMLVGHADIAVHSLKDLPTNLPNGLKLGCITKREDPADALVVSKKNDYYK 118

Query: 118 LKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           L+ L   S++GTSSLRR A L      +   D RG + TR+ KL+  +   I+LA AG+K
Sbjct: 119 LETLPEGSIVGTSSLRRLAQLRNKYPHLVFKDIRGNVITRIEKLDAGEFDCIILAAAGLK 178

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL  E  I +I+  E    + GQGA+ IE   ++ K  E++ V+  + T      ERAFL
Sbjct: 179 RLGFESRIHQIIPSEISLHAVGQGALGIECKSDDKKVLEIINVLEDKPTSQRCLAERAFL 238

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            EL+G C+  I   +      LY  G+V + DGK   +    GN  +   +G + A+ ++
Sbjct: 239 RELEGGCQVPIGVNSNIDNGQLYLTGMVASLDGKKLIKDQVIGNINNPELVGIELAKRLK 298

Query: 298 FISNKNVF 305
                 + 
Sbjct: 299 LQGADKIL 306


>gi|148545465|ref|YP_001265567.1| porphobilinogen deaminase [Pseudomonas putida F1]
 gi|167008818|sp|A5VWX3|HEM3_PSEP1 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|148509523|gb|ABQ76383.1| hydroxymethylbilane synthase [Pseudomonas putida F1]
          Length = 313

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 110/305 (36%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H      + ++P+ ++GD++ +  L +IGG
Sbjct: 1   MSTREIRIATRKSALALWQAEYVKARLEQAHT--GLQVTLVPMVSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  E D AVHS KD+P    +GL +     RED RD F+S+T  SL+ 
Sbjct: 59  KGLFVKELETALLDNEADIAVHSMKDVPMDFPEGLGLYCICEREDPRDAFVSNTFDSLET 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++H DT D V  ERA    L
Sbjct: 179 FEDRITSTISVDDSLPAGGQGAVGIECRSADVEIHALLAPLHHVDTADRVIAERALNKRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  L+  G+V    G           R  A  +G   A+ +    
Sbjct: 239 NGGCQVPIACYAVLEGDQLWLRGLVGQPSGGTLLVADARAPRAAAEALGVQVAEDLLGQG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AEAIL 303


>gi|15676445|ref|NP_273584.1| porphobilinogen deaminase [Neisseria meningitidis MC58]
 gi|11386833|sp|Q9K0P6|HEM3_NEIMB RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|7225764|gb|AAF40968.1| porphobilinogen deaminase [Neisseria meningitidis MC58]
 gi|254671891|emb|CBA04160.1| Porphobilinogen deaminase [Neisseria meningitidis alpha275]
 gi|308388723|gb|ADO31043.1| putative porphobilinogen deaminase [Neisseria meningitidis
           alpha710]
 gi|316985397|gb|EFV64345.1| porphobilinogen deaminase [Neisseria meningitidis H44/76]
 gi|319409917|emb|CBY90242.1| porphobilinogen deaminase (PBG; hydroxymethylbilane synthase; HMBS;
           pre-uroporphyrinogen synthase) [Neisseria meningitidis
           WUE 2594]
 gi|325127627|gb|EGC50543.1| porphobilinogen deaminase [Neisseria meningitidis N1568]
 gi|325139808|gb|EGC62341.1| porphobilinogen deaminase [Neisseria meningitidis CU385]
 gi|325200773|gb|ADY96228.1| porphobilinogen deaminase [Neisseria meningitidis H44/76]
          Length = 311

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 104/305 (34%), Positives = 166/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K   I +R S LA+  A   +  L  ++  P   + I+ ++T+GD+I ++TL+++GG
Sbjct: 1   MNPKKLVIASRESLLAMWQAKHIQGRLKALY--PDCEVEILGMTTRGDQILDKTLSKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L  G  D AVHS KD+P  L +G  ++A   R +  D F+S+    L++
Sbjct: 59  KGLFVKELEQALYDGRADLAVHSIKDVPMDLPEGFALAAIGERANPFDAFVSNQYTRLEE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           +   +V+GTSSLRR+A L      + +   RG ++TRL+KL+N +  AI+LA AG++RLK
Sbjct: 119 MPEGAVVGTSSLRREAQLRARYPHLLIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I+ IL+  D  P+ GQGA+ IE   +     E++K +NH  T   V  ERA    L
Sbjct: 179 LDGRIRMILSESDSLPAAGQGALGIEIAAHREDLYEVLKPLNHGVTNACVTAERALARAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC+  +A +   +   L   G+V   DG +            A  +GR  A+ +    
Sbjct: 239 GGSCQVPLAAYCTEENGLLTLRGLVGHPDGSVVLRADAQAPAEYADALGRAVAKKLADDG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 ARELI 303


>gi|78778881|ref|YP_396993.1| porphobilinogen deaminase [Prochlorococcus marinus str. MIT 9312]
 gi|123741491|sp|Q31C38|HEM3_PROM9 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|78712380|gb|ABB49557.1| hydroxymethylbilane synthase [Prochlorococcus marinus str. MIT
           9312]
          Length = 316

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 103/308 (33%), Positives = 161/308 (52%), Gaps = 5/308 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     +I +R S LA+      +  L     IP   + I  ++T+GD+I +  L +IG 
Sbjct: 1   MTNFKLKIASRRSKLAMVQTLWVKDQLEK--NIPNLEVSIEAMATQGDKILDVALAKIGD 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFI---SHTAQS 117
           KGLFT+E+E +++ G+ D AVHS KD+PT L  GL++     RED  D  +    +    
Sbjct: 59  KGLFTKELEAQMLVGQADIAVHSLKDLPTNLPSGLKLGCITKREDPADALVVSKKNDCYK 118

Query: 118 LKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           L+ L   S++GTSSLRR A L      ++  D RG + TR+ KL+  +   I+LA AG+K
Sbjct: 119 LETLPAGSIVGTSSLRRLAQLRNKYPHLNFKDIRGNVITRIEKLDAGEFDCIILAAAGLK 178

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL  E  I +I+  E    + GQGA+ IE   ++ K  E++ V+  + T      ERAFL
Sbjct: 179 RLGFESRIHQIIPNEISLHAVGQGALGIECKSDDKKVLEIISVLEDKPTSQRCLAERAFL 238

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            EL+G C+  I   +  +   LY  G+V + DG+   +    GN  D   +G++ A+ ++
Sbjct: 239 RELEGGCQVPIGVNSSIQNEQLYLTGMVASLDGERLIKDQYIGNIDDPEQVGKELAKKLK 298

Query: 298 FISNKNVF 305
                 + 
Sbjct: 299 LQGADKIL 306


>gi|87302648|ref|ZP_01085465.1| porphobilinogen deaminase [Synechococcus sp. WH 5701]
 gi|87282992|gb|EAQ74949.1| porphobilinogen deaminase [Synechococcus sp. WH 5701]
          Length = 317

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 103/309 (33%), Positives = 145/309 (46%), Gaps = 5/309 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI +R S LA+      R  L   H  P   I I  ++T+GD+I +  L +IG 
Sbjct: 1   MAGTTLRIASRRSQLAMVQTHWVRDELTRAH--PDLEISIEAMATQGDKILDVALAKIGD 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+E+E +++    D AVHS KD+PT L  GL +     RED  D  + H       
Sbjct: 59  KGLFTKELEAQMLVDRADIAVHSLKDLPTNLPDGLMLGCITEREDPADALVLHERHRGCS 118

Query: 121 L---ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           L      SV+GTSSLRR A L          D RG + TRL KL++     ++LA AG+ 
Sbjct: 119 LETLPEGSVVGTSSLRRLAQLRHHFPHFQFKDVRGNVITRLEKLDSGDYDCLILAAAGLG 178

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL     I  +++      + GQGA+ IE    +    E +KV+ H  T      ERAFL
Sbjct: 179 RLGLGHRIDALIDPSISLHAVGQGALGIECRHGDSAVLEQIKVLEHLPTARRCLAERAFL 238

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            +L+G C+  I   +  +G  L   G+V + DG         G + D   +G   AQ +R
Sbjct: 239 RQLEGGCQVPIGVNSRFEGEELVLTGMVASLDGLRLIRDEARGPQQDPEAVGTSLAQLLR 298

Query: 298 FISNKNVFN 306
                 +  
Sbjct: 299 SQGAGEILE 307


>gi|148238945|ref|YP_001224332.1| porphobilinogen deaminase [Synechococcus sp. WH 7803]
 gi|147847484|emb|CAK23035.1| Porphobilinogen deaminase [Synechococcus sp. WH 7803]
          Length = 319

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 102/308 (33%), Positives = 157/308 (50%), Gaps = 5/308 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI +R S LA+      ++ L   H  P   I +  ++T+GD+I +  L +IG 
Sbjct: 3   MALEHLRIASRRSQLAMVQTNWVKAELEKAH--PGLAISVEAMATQGDKILDVALAKIGD 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+E+E +++ G  + AVHS KD+PT L +GL +     RED  D  + ++  +   
Sbjct: 61  KGLFTKELEAQMLVGRAEIAVHSLKDLPTNLPEGLMLGCITEREDPADALVVNSKNAEHT 120

Query: 121 L---ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           L      SV+GTSSLRR A L      +   D RG + TRL KL+  +   ++LA AG+ 
Sbjct: 121 LETLPEGSVVGTSSLRRLAQLRHHFPHLQFKDVRGNVITRLEKLDAGQYDCLILAAAGLS 180

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL     I +I+       + GQGA+ IE   + P+  ++++V+ H  T      ERAFL
Sbjct: 181 RLGFGDRIHQIIPGHISLHAVGQGALGIECVCDRPEVLKIIQVLEHAPTAGRCLAERAFL 240

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            EL+G C+  I   +   G+ L   G+V + DG+      R G+  D   IGR  A  ++
Sbjct: 241 RELEGGCQVPIGVNSRIDGTELILTGMVASLDGQRLIRDERRGSLTDPEAIGRALAADLK 300

Query: 298 FISNKNVF 305
                 + 
Sbjct: 301 SRGAGEIL 308


>gi|218767661|ref|YP_002342173.1| porphobilinogen deaminase [Neisseria meningitidis Z2491]
 gi|11386831|sp|Q9JVS4|HEM3_NEIMA RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|121051669|emb|CAM07972.1| putative porphobilinogen deaminase [Neisseria meningitidis Z2491]
          Length = 311

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 104/305 (34%), Positives = 166/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K   I +R S LA+  A   +  L  ++  P   + I+ ++T+GD+I ++TL+++GG
Sbjct: 1   MNPKKLVIASRESLLAMWQAKHIQGRLKALY--PDCEVEILGMTTRGDQILDKTLSKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L  G  D AVHS KD+P  L +G  ++A   R +  D F+S+    L++
Sbjct: 59  KGLFVKELEQALYDGRADLAVHSIKDVPMDLPEGFALAAIGERANPFDAFVSNQYARLEE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           +   +V+GTSSLRR+A L      + +   RG ++TRL+KL+N +  AI+LA AG++RLK
Sbjct: 119 MPEGAVVGTSSLRREAQLRARYPHLLIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I+ IL+  D  P+ GQGA+ IE   +     E++K +NH  T   V  ERA    L
Sbjct: 179 LDGRIRMILSESDSLPAAGQGALGIEIAAHREDLYEVLKPLNHGVTNACVTAERALARAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC+  +A +   +   L   G+V   DG +            A  +GR  A+ +    
Sbjct: 239 GGSCQVPLAAYCTEENGLLTLRGLVGHPDGSVVLRADAQAPAEYADALGRAVAKKLADDG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 ARELI 303


>gi|317154529|ref|YP_004122577.1| porphobilinogen deaminase [Desulfovibrio aespoeensis Aspo-2]
 gi|316944780|gb|ADU63831.1| porphobilinogen deaminase [Desulfovibrio aespoeensis Aspo-2]
          Length = 310

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 109/304 (35%), Positives = 161/304 (52%), Gaps = 2/304 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            K   I TR S LAL  A   +  L   H  P   + ++ + TKGD+I +  L ++GGKG
Sbjct: 1   MKQLTIATRGSALALWQANHIKDRLEAEH--PGLTVHLLKIKTKGDKILDVPLAKVGGKG 58

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +EIE+ L+ G    AVHS KD+PT+L +GL++     RE   D  +S   + L  L 
Sbjct: 59  LFVKEIEEALLDGRAQLAVHSMKDVPTELPEGLEVGVIPEREASTDSLLSVKYEGLAGLP 118

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +V+GTSSLRR++ L   R D+ +   RG ++TR+ KL   +  AI++A AG+ RL+  
Sbjct: 119 RGAVVGTSSLRRQSQLATLRPDLKIESLRGNLDTRVRKLLAGEFDAIVVATAGLNRLELT 178

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
               EIL   DF P+  QGA+ IE H  N +   +++ +NHE +   V  ER FL  LDG
Sbjct: 179 APKHEILGPPDFLPAVAQGALGIEYHSANAEVAAMLQFLNHEPSKRQVLAERGFLTGLDG 238

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  IA ++   G  L   G V   DG     ++  G   +A +IG   A+ +     K
Sbjct: 239 GCQVPIAAWSVIDGERLRLTGFVADVDGSRPIRMTAEGPVDNAWDIGAALAEKVLAAGGK 298

Query: 303 NVFN 306
            + +
Sbjct: 299 AILD 302


>gi|26986930|ref|NP_742355.1| porphobilinogen deaminase [Pseudomonas putida KT2440]
 gi|38258017|sp|Q88RE5|HEM3_PSEPK RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|24981540|gb|AAN65819.1|AE016210_7 porphobilinogen deaminase [Pseudomonas putida KT2440]
          Length = 313

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 110/305 (36%), Positives = 164/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H      + ++P+ ++GD++ +  L +IGG
Sbjct: 1   MSTREIRIATRKSALALWQAEYVKARLEQAHT--GLQVTLVPMVSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  E D AVHS KD+P    +GL +     RED RD F+S+T  SL+ 
Sbjct: 59  KGLFVKELETALLDNEADIAVHSMKDVPMDFPEGLGLYCICEREDPRDAFVSNTFDSLEA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++H DT D V  ERA    L
Sbjct: 179 FEDRITSTISVDDSLPAGGQGAVGIECRSADVEIHALLAPLHHVDTADRVIAERALNKRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA +A  +G  L+  G+V    G           R  A  +G   A+ +    
Sbjct: 239 NGGCQVPIACYAVLEGDQLWLRGLVGQPSGGTLLVADARAPRAAAEALGVQVAEDLLGQG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AEAIL 303


>gi|320529107|ref|ZP_08030199.1| porphobilinogen deaminase [Selenomonas artemidis F0399]
 gi|320138737|gb|EFW30627.1| porphobilinogen deaminase [Selenomonas artemidis F0399]
          Length = 311

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 107/306 (34%), Positives = 166/306 (54%), Gaps = 3/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M      IGTR S LAL  A      L   H  P   +V+  ++TKGD+I +  L +IGG
Sbjct: 1   MNSGTITIGTRASKLALWQAKFVAGELQKRH--PSVTVVLKEMTTKGDKILDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+E+E+ +++G+ID AVHS KDMPT++  GL I A   R D  D F+S+   ++++
Sbjct: 59  KGLFTKELEQAMLAGDIDIAVHSLKDMPTEIPAGLIIGAITARLDPGDAFVSNQYAAIEE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +GTSSLRR+A LL  R D+ ++D RG + TRL KL+  +  A++LA AG++RL 
Sbjct: 119 LPAGARVGTSSLRRRAQLLAVRPDLVLLDLRGNVNTRLEKLDAGEFDAVVLAAAGLRRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I+ +L      P+ GQGA+ IE   ++ +    +  +   D   +   ERAFL  +
Sbjct: 179 LGDRIRSVLPRAMMLPAVGQGALAIECRADDAEICAAIGFMCDADMTAAAAAERAFLGRV 238

Query: 241 DGSCKSAIAGFAYC-KGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           +G C+  +  +A    G  LY   ++ + DG        +G    A  IG   A+ +  +
Sbjct: 239 EGGCQIPVGVYAEIGDGDMLYVDAMIASVDGMRVCRSRASGRPAQAAQIGVALAEELLDM 298

Query: 300 SNKNVF 305
             + + 
Sbjct: 299 GGREIL 304


>gi|298493147|ref|YP_003723324.1| porphobilinogen deaminase ['Nostoc azollae' 0708]
 gi|298235065|gb|ADI66201.1| porphobilinogen deaminase ['Nostoc azollae' 0708]
          Length = 322

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 105/306 (34%), Positives = 158/306 (51%), Gaps = 5/306 (1%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +P RIG+R S LAL   +  +  L      P     +  +ST+GD+I +  L +IG KGL
Sbjct: 9   RPIRIGSRKSQLALVQTYWVQEQLQK--SFPNITFEVHTMSTQGDKILDVALAKIGDKGL 66

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT+E+E ++I+ EID AVHS KD+PT L +GL ++A   RE+  D  + H     + +  
Sbjct: 67  FTKELELRMINKEIDFAVHSLKDLPTNLPEGLTLAAITERENPADAVVLHKKHKDQQIET 126

Query: 124 ---HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
               +VIGTSSLRR A L       +  D RG + TR+ KL+  +  A++LA AG++RL 
Sbjct: 127 LPAGAVIGTSSLRRLAQLRYKFPHFTFKDVRGNLITRIGKLDAGEYDALILAVAGLERLD 186

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I +IL  +    + GQGA+ IE   ++ +   L+K I H  T D    ER+FL  L
Sbjct: 187 MSHRIDQILPPDISLHAVGQGALGIECRSDDTEVISLLKAIEHSQTRDRCLAERSFLRVL 246

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I          L   G+V + DG+   + +  G   DA  +G   A+ +R   
Sbjct: 247 EGGCQVPIGVDTQINSKELTLKGLVASVDGQKLVKDTVTGTAADAEKLGAQLARILRQKG 306

Query: 301 NKNVFN 306
              +  
Sbjct: 307 ATEILE 312


>gi|289548019|ref|YP_003473007.1| porphobilinogen deaminase [Thermocrinis albus DSM 14484]
 gi|289181636|gb|ADC88880.1| porphobilinogen deaminase [Thermocrinis albus DSM 14484]
          Length = 300

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 121/301 (40%), Positives = 183/301 (60%), Gaps = 6/301 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LAL  A   +  L D+     H + ++P++T GD+IT+  L +IGGKGLF 
Sbjct: 3   IRIGTRRSQLALWQANYVKRKLEDM----GHTVELVPITTTGDKITDAPLAKIGGKGLFV 58

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ L+ G+ID AVHS KD+PTKL  GL + A   RE   DV IS   Q L++L   +
Sbjct: 59  KEIEEALLRGDIDVAVHSLKDVPTKLPDGLTLGAITERELPYDVLISRDGQRLENLPTGA 118

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+GTSSLRRK  + R R D+ + D RG ++TR+ KL+  +  AI+LAYAGI+R+  E  I
Sbjct: 119 VVGTSSLRRKVQIKRMRRDLVIKDLRGNVDTRIRKLDEGQYDAIVLAYAGIRRMGWENRI 178

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            +I  +EDF P+ GQG++ +E   ++ K +E++ +++H ++   V  ERAFL  ++G C+
Sbjct: 179 VQI--LEDFIPAVGQGSMAVEIREDDEKIREVISLLDHRESRIRVEAERAFLEVMEGGCQ 236

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             +   A+  GS L+  G +   +G+ F E    GN   A  +GR+ A+ I     +++ 
Sbjct: 237 VPMGAIAWLDGSRLFMKGFLSDLEGENFVEAYVEGNVEKAQLLGRELAEKILSQGGRSIL 296

Query: 306 N 306
            
Sbjct: 297 E 297


>gi|260435886|ref|ZP_05789856.1| porphobilinogen deaminase [Synechococcus sp. WH 8109]
 gi|260413760|gb|EEX07056.1| porphobilinogen deaminase [Synechococcus sp. WH 8109]
          Length = 317

 Score =  257 bits (656), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 105/308 (34%), Positives = 151/308 (49%), Gaps = 5/308 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI +R S LA+      ++ L   H  P   I +  ++T+GD+I +  L +IG 
Sbjct: 1   MALTELRIASRRSQLAMVQTNWVKAELEKAH--PGLKITVEAMATQGDKILDVALAKIGD 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+E+E +++    D AVHS KD+PT L +GL +     RED  D  + +T      
Sbjct: 59  KGLFTKELEAQMLVDRADIAVHSLKDLPTNLPEGLMLGCITEREDPADALVVNTKNHAYK 118

Query: 121 L---ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           L      SV+GTSSLRR A L      +   D RG + TRL KL+N     ++LA AG+ 
Sbjct: 119 LDTLPEGSVVGTSSLRRLAQLRHHYPHLIFKDVRGNVITRLEKLDNGDYDCLILAAAGLG 178

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL     I +++  +    + GQGA+ IE     P+  E +KV+ H  T      ERAFL
Sbjct: 179 RLGFGDRIHQLIPGDISLHAVGQGALGIECVEGKPEVLEAIKVLEHTPTSQRCLAERAFL 238

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            EL+G C+  I      +G  L   G+V + DGK       +G   DA  IG   A  ++
Sbjct: 239 RELEGGCQVPIGVNTRFEGDQLILTGMVASLDGKRLIRDQASGAASDAEAIGIALANTLK 298

Query: 298 FISNKNVF 305
                 + 
Sbjct: 299 GQGAGEIL 306


>gi|126695860|ref|YP_001090746.1| porphobilinogen deaminase [Prochlorococcus marinus str. MIT 9301]
 gi|158513419|sp|A3PBM0|HEM3_PROM0 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|126542903|gb|ABO17145.1| Porphobilinogen deaminase [Prochlorococcus marinus str. MIT 9301]
          Length = 316

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 102/308 (33%), Positives = 159/308 (51%), Gaps = 5/308 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     +I +R S LA+      +  L     IP   + I  ++T+GD+I +  L +IG 
Sbjct: 1   MTNFKLKIASRRSKLAMVQTLWVKDQLER--NIPNLEVSIEAMATQGDKILDVALAKIGD 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFI---SHTAQS 117
           KGLFT+E+E +++ G  D AVHS KD+PT L  GL++     RED  D  +    +    
Sbjct: 59  KGLFTKELEAQMLVGHADIAVHSLKDLPTNLPNGLKLGCITKREDPADALVVNKKNDCYK 118

Query: 118 LKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           L+ L   S++GTSSLRR A L      +   D RG + TR+ KL+  +   I+LA AG+K
Sbjct: 119 LETLPEGSIVGTSSLRRLAQLRNKYPHLIFKDIRGNVITRIEKLDAGEFDCIILAAAGLK 178

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL  E  I +I+  E    + GQGA+ IE   ++ K  E++ ++  + T      ERAFL
Sbjct: 179 RLGFESRIHQIIPSEISLHAVGQGALGIECKSDDKKVLEIINILEDKPTSQRCLAERAFL 238

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            EL+G C+  I   +  +   L   G+V + DG+   +    GN  D   IG++ A+ ++
Sbjct: 239 RELEGGCQVPIGVNSNIQNEKLCLTGMVASLDGERLIKDQHIGNINDPEEIGKELAKKLK 298

Query: 298 FISNKNVF 305
               + + 
Sbjct: 299 QQGAEEIL 306


>gi|317969656|ref|ZP_07971046.1| porphobilinogen deaminase [Synechococcus sp. CB0205]
          Length = 317

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 104/309 (33%), Positives = 154/309 (49%), Gaps = 5/309 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI +R S LA+      R  L   H      I I  ++T+GD+I +  L +IG 
Sbjct: 1   MAGSQLRIASRRSQLAMVQTHWVRDELAKAHA--GLEITIEAMATQGDKILDVALAKIGD 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFI---SHTAQS 117
           KGLFT+E+E +++    D AVHS KD+PT L +GL +     RED  D  +    H  ++
Sbjct: 59  KGLFTKELEAQMLVDRADIAVHSLKDLPTNLPEGLMLGCITEREDPADALVVHEKHKDKT 118

Query: 118 LKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           L  L   +V+GTSSLRR A L      ++  D RG + TRL KL++ +   ++LA AG+ 
Sbjct: 119 LATLPEGAVVGTSSLRRLAQLRHHYPHLTFKDVRGNVITRLEKLDSGEFDCLILAAAGLG 178

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL     I E+++      + GQGA+ IE    + K  E +KV+ H  T      ERAFL
Sbjct: 179 RLGLSDRIHELIDPSISLHAVGQGALGIECRDGDAKVLEQIKVLEHVPTARRCLAERAFL 238

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            EL+G C+  I      +G  L   G+V + DGK        G++ +   +G D A  ++
Sbjct: 239 RELEGGCQVPIGVNTRFEGDELVLTGMVASLDGKRLIRDQVQGDQTNPEALGIDLAHKLK 298

Query: 298 FISNKNVFN 306
                 +  
Sbjct: 299 AQGAGEILE 307


>gi|158337071|ref|YP_001518246.1| porphobilinogen deaminase [Acaryochloris marina MBIC11017]
 gi|158307312|gb|ABW28929.1| porphobilinogen deaminase [Acaryochloris marina MBIC11017]
          Length = 314

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 103/304 (33%), Positives = 149/304 (49%), Gaps = 5/304 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIG+R S LAL      +  L      P +   +  +ST+GD I +  L +IG KGLFT
Sbjct: 2   IRIGSRKSQLALVQTHWVQGELQK--HFPEYEFEVCTMSTQGDNILDVALAKIGDKGLFT 59

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTA---QSLKDLA 122
           +E+E  ++  E D AVHS KD+PT L +GL +     R D  D  + H       L  L 
Sbjct: 60  KELEVSMLRKETDLAVHSLKDLPTNLPEGLCLGVVTERVDPADALVVHENFKAYQLDTLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +VIGTSSLRR A L      +   D RG + TRL KL+  +   I+LA AG++RL   
Sbjct: 120 EGAVIGTSSLRRLAQLRYNYPHLEFKDIRGNLNTRLQKLDEGEYDGIILAVAGLQRLGFG 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I +++       + GQGA+ IE    + +    +K + HE +      ER+FL EL+G
Sbjct: 180 DRIHQVIPANISLHAVGQGALGIECREGDEEIMAFIKALEHEPSAHRCTAERSFLHELEG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  I      K   L   G+V + DGK   + + +G    A  +G D AQ +R    +
Sbjct: 240 GCQVPIGVNTSLKEGQLTLVGMVASLDGKRLIKDTVSGPIASATQLGIDLAQKVREQGAQ 299

Query: 303 NVFN 306
            +  
Sbjct: 300 EILE 303


>gi|126658960|ref|ZP_01730102.1| porphobilinogen deaminase [Cyanothece sp. CCY0110]
 gi|126619758|gb|EAZ90485.1| porphobilinogen deaminase [Cyanothece sp. CCY0110]
          Length = 317

 Score =  257 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 104/307 (33%), Positives = 161/307 (52%), Gaps = 5/307 (1%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
             +  RIG+R S LAL   +  +  L   +  P     +  +ST+GD+I +  L +IG K
Sbjct: 4   SSRAIRIGSRKSQLALVQTYWIQEQLQKHY--PDRQFDVETMSTQGDKILDVALAKIGDK 61

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFI---SHTAQSL 118
           GLFT+E+E  ++  ++D AVHS KD+PT L  GL +     R +  D  +    H  + L
Sbjct: 62  GLFTKELETAMLQNQVDFAVHSLKDLPTNLPDGLMLGCVTERVNPADALVVNEKHKDKQL 121

Query: 119 KDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR 178
             L   SVIGTSSLRR A L      ++  D RG + TRL+KL+  +  AI+LA AG++R
Sbjct: 122 DTLPEGSVIGTSSLRRLAQLRHHYPHLTFKDVRGNVNTRLSKLDAGEYDAIILAVAGLQR 181

Query: 179 LKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLA 238
           L     I +++  +    + GQGA+ IE    +P+  +L+K + H +T D    ERAFL 
Sbjct: 182 LDMSDRIHQVIPDDISLHAVGQGALGIECRTGDPEILDLLKALEHPETRDRCYAERAFLR 241

Query: 239 ELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRF 298
           EL+G C+  I      + + L   G+V + DGK   + +  G +  A  +G++ A  +R 
Sbjct: 242 ELEGGCQVPIGVNTKIENNFLTLTGMVASLDGKTLIKDTIEGEQDQAEKLGQELAMRLRD 301

Query: 299 ISNKNVF 305
                + 
Sbjct: 302 AGATEIL 308


>gi|212703312|ref|ZP_03311440.1| hypothetical protein DESPIG_01355 [Desulfovibrio piger ATCC 29098]
 gi|212673272|gb|EEB33755.1| hypothetical protein DESPIG_01355 [Desulfovibrio piger ATCC 29098]
          Length = 311

 Score =  257 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 109/306 (35%), Positives = 158/306 (51%), Gaps = 3/306 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            +K   I TR S LAL  A   ++ L  +   P  NI +  + T+GD I +  L+++GGK
Sbjct: 1   MRKNLVIATRGSQLALWQAEHVKACLESLE--PGLNISLRVIKTRGDIILDVPLSKVGGK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +EIE+ L+ G  D AVHS KD+P  L +GL +     RE   D  +S+   SL +L
Sbjct: 59  GLFVKEIEEALLDGSADLAVHSIKDVPMVLPEGLVLGCVPQREICVDCLLSNRYGSLDEL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              + +GTSSLRR+A LL  R D+ ++  RG ++TRL K+   +  AI+LA AG+KRL  
Sbjct: 119 PPGARVGTSSLRRQAQLLNLRPDLEILSLRGNVDTRLRKMKEGEYDAIVLASAGLKRLGL 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
                       F P+ GQGA+ IE   ++ +  EL+  + H  T   V  ER FLA LD
Sbjct: 179 SADRMHHFEAASFVPAVGQGALGIECRGDDGEVLELLSRMEHRPTRICVEAERGFLAGLD 238

Query: 242 GSCKSAIAGFAY-CKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           G C+  IAG A           G+V   DG +     + G    A   G   A+++    
Sbjct: 239 GGCQVPIAGHAEMLDDDRFILDGLVAEVDGSVILREQQEGTAATARETGFALARHLLDKG 298

Query: 301 NKNVFN 306
            K++ +
Sbjct: 299 GKDILD 304


>gi|150387913|ref|YP_001317962.1| porphobilinogen deaminase [Alkaliphilus metalliredigens QYMF]
 gi|229836103|sp|A6TJD5|HEM3_ALKMQ RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|149947775|gb|ABR46303.1| porphobilinogen deaminase [Alkaliphilus metalliredigens QYMF]
          Length = 316

 Score =  257 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 116/304 (38%), Positives = 172/304 (56%), Gaps = 2/304 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            +  +IG+R S LAL  A    + L +  K P +   II ++T GDRI ++TL +IGGKG
Sbjct: 1   MRTIKIGSRASQLALVQAEIIINMLKE--KFPQYTYEIIKITTLGDRILDKTLDKIGGKG 58

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +EI+K L   +ID A+HS KDMP +  + L + A   RED RDV I+   +SL++L 
Sbjct: 59  LFVKEIQKALAEEKIDLAIHSMKDMPGETPEELVLGAITKREDPRDVLITRENKSLEELP 118

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +VIG+SSLRR+A ++  R DI V+  RG + TRL K+       ++LA AG+ RL  +
Sbjct: 119 KGAVIGSSSLRRQAQVMALRGDIKVVPIRGNVGTRLGKIETESLDGVILAAAGLNRLGLK 178

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I   L IEDF P+ GQGA+  E    + +  E++  INHE+T+  V  ERAFL  L+G
Sbjct: 179 EKISSYLEIEDFTPAVGQGALGCEARRKDIEMLEMLLAINHEETYRCVMAERAFLKLLEG 238

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C   I  +   +G  L+  G+V +SDG+   +    G+  D   +G    + +     K
Sbjct: 239 GCHVPIGAYGQQQGQELHMTGMVASSDGRRVIKEQVMGDIADFQALGIQLGETLIEKGAK 298

Query: 303 NVFN 306
            +  
Sbjct: 299 EILE 302


>gi|72383664|ref|YP_293019.1| porphobilinogen deaminase [Prochlorococcus marinus str. NATL2A]
 gi|123773715|sp|Q46GS7|HEM3_PROMT RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|72003514|gb|AAZ59316.1| hydroxymethylbilane synthase [Prochlorococcus marinus str. NATL2A]
          Length = 315

 Score =  257 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 102/309 (33%), Positives = 152/309 (49%), Gaps = 5/309 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI +R S LA+      R  L   H  P   I I  ++T+GD+I +  L +IG 
Sbjct: 1   MTLDQLRIASRRSQLAMVQTNWVRDELQREH--PDLVITIEAMATQGDKILDVALAKIGD 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+E+E +++ G  + AVHS KD+PT L  GL +     RED  D  + +    +  
Sbjct: 59  KGLFTKELEAQMLLGHAEIAVHSLKDLPTNLPDGLILGCITKREDPSDALVVNEKNQIHK 118

Query: 121 L---ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           L      SV+GTSSLRR A L      +   D RG + TRL KL++ +   ++LA AG++
Sbjct: 119 LETLPEGSVVGTSSLRRLAQLRYHYPHLVFKDVRGNVITRLEKLDSGEYDCLILAAAGLQ 178

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL     I +++  +    + GQGA+ IE      K  +++K + HE T      ER+FL
Sbjct: 179 RLGFANRIHQLIPTDISLHAVGQGALGIECVSGQQKVLDILKTLEHESTSKRCLAERSFL 238

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            EL+G C+  I        + L   G+V + DGK      + G+   A  IG D A  ++
Sbjct: 239 RELEGGCQVPIGVRTEINNNELILEGMVASLDGKRLIRDIKKGSVSSAEEIGIDLANELK 298

Query: 298 FISNKNVFN 306
                 +  
Sbjct: 299 GRGAGEILE 307


>gi|254671436|emb|CBA08950.1| Porphobilinogen deaminase [Neisseria meningitidis alpha153]
          Length = 311

 Score =  256 bits (654), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 102/305 (33%), Positives = 167/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K   I +R S LA+  A   +  L  ++  P   + I+ ++T+GD+I ++TL+++GG
Sbjct: 1   MNPKKLVIASRESLLAMWQAKHIQGRLKALY--PDCEVEILGMTTRGDQILDKTLSKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L  G  D AVHS KD+P  L +G  ++A   R +  D F+S+    L++
Sbjct: 59  KGLFVKELEQALQDGRADLAVHSIKDVPMDLPEGFALAAIGERANPFDAFVSNQYARLEE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           +   +++GTSSLRR+A L      + +   RG ++TRL+KL+N +  AI+LA AG++RL+
Sbjct: 119 MPKGAIVGTSSLRREAQLRARYPHLVIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            ++ I+ IL+  D  P+ GQGA+ IE   +     E++K +NH  T   V  ERA    L
Sbjct: 179 LDERIRMILSESDSLPAAGQGALGIEIAAHREDLYEVLKPLNHGVTNACVTAERALARAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC+  +A +   +   L   G+V   DG +            A  +GR  A+ +    
Sbjct: 239 GGSCQVPLAAYCTEENGLLTLRGLVGHPDGSVVLRADAQAPAEYADALGRAVAKKLADDG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 ARELI 303


>gi|269213761|ref|ZP_05982800.2| hydroxymethylbilane synthase [Neisseria cinerea ATCC 14685]
 gi|269145303|gb|EEZ71721.1| hydroxymethylbilane synthase [Neisseria cinerea ATCC 14685]
          Length = 325

 Score =  256 bits (654), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 104/306 (33%), Positives = 169/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K   I +R S LA+  A   +  L  ++  P   + I+ ++T+GD+I +RTL+++GG
Sbjct: 15  MNPKKLVIASRESLLAMWQAKHIQGRLKALY--PDCKVEILGMTTRGDQILDRTLSKVGG 72

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L  G  D AVHS KD+P  L +G  ++A   R +  D F+S+    L++
Sbjct: 73  KGLFVKELEQALYDGRADLAVHSIKDVPMDLPEGFALAAIGERANPFDAFVSNQYARLEE 132

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           +   +V+GTSSLRR+A L      + +   RG ++TRL+KL+N +  AI+LA AG++RL+
Sbjct: 133 MPKGAVVGTSSLRREAQLRARYPHLVIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLE 192

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            ++ I+ IL+  D  P+ GQGA+ IE   +     E++K +NH+ T   V  ERA    L
Sbjct: 193 LDERIRMILSESDSLPAAGQGALGIEIAAHREDLYEVLKPLNHDTTHACVTAERALARAL 252

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC+  +A +   +   L   G+V   DG +  +         A  +GR  A+ +    
Sbjct: 253 GGSCQVPLAAYCTEENGLLTLRGLVGHPDGSVILQADAQAPAEYADALGRAVAKKLADDG 312

Query: 301 NKNVFN 306
            + +  
Sbjct: 313 ARELIE 318


>gi|161869466|ref|YP_001598634.1| porphobilinogen deaminase [Neisseria meningitidis 053442]
 gi|161595019|gb|ABX72679.1| porphobilinogen deaminase [Neisseria meningitidis 053442]
          Length = 316

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 103/305 (33%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K   I +R S LA+  A   +  L  ++  P   + I+ ++T+GD+I ++TL+++GG
Sbjct: 6   MNPKKLVIASRESLLAMWQAKHIQGRLKALY--PDCEVEILGMTTRGDQILDKTLSKVGG 63

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L  G  D AVHS KD+P  L +G  ++    R +  D F+S+    L++
Sbjct: 64  KGLFVKELEQALYDGRADLAVHSIKDVPMDLPEGFALATIGERANPFDAFVSNQYTRLEE 123

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           +   +V+GTSSLRR+A L      + +   RG ++TRL+KL+N +  AI+LA AG++RLK
Sbjct: 124 MPEGAVVGTSSLRREAQLRARYPHLLIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLK 183

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I+ IL+  D  P+ GQGA+ IE   +     E++K +NH  T   V  ERA    L
Sbjct: 184 LDGRIRMILSESDSLPAAGQGALGIEIAAHREDLYEVLKPLNHGVTNACVTAERALARAL 243

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC+  +A +   +   L   G+V   DG +            A  +GR  A+ +    
Sbjct: 244 GGSCQVPLAAYCTEENGLLTLRGLVGHPDGSVVLRADAQAPAEYADALGRAVAKKLADDG 303

Query: 301 NKNVF 305
            + + 
Sbjct: 304 AQELI 308


>gi|166367009|ref|YP_001659282.1| porphobilinogen deaminase [Microcystis aeruginosa NIES-843]
 gi|166089382|dbj|BAG04090.1| porphobilinogen deaminase [Microcystis aeruginosa NIES-843]
          Length = 319

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 104/305 (34%), Positives = 159/305 (52%), Gaps = 5/305 (1%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +  RIG+R S LAL   +  ++ L   H  P     +  +ST+GD+I +  L +IG KGL
Sbjct: 8   RSLRIGSRKSQLALVQTYWVQAELSKHH--PHRQFEVETMSTQGDKILDVALAKIGDKGL 65

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL-- 121
           FT+E+E  ++   ID AVHS KD+PT L +GL +     R +  D  + ++      L  
Sbjct: 66  FTKELEVGMLDRSIDLAVHSLKDLPTNLPEGLILGCVTERVNPADALVVNSQNQDYQLDT 125

Query: 122 -ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
               +V+GTSSLRR A L      ++  D RG + TRL KL+  +  AI+LA AG++RL 
Sbjct: 126 LPEGAVVGTSSLRRLAQLRYHYPHLTFKDVRGNVNTRLAKLDAGEYDAIILAVAGLERLG 185

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               + +++  E    + GQGA+ IE    +P+  E++KV+ H  + D    ERAFL EL
Sbjct: 186 LGDRVHQVIPAEISLHAVGQGALGIECRDADPEVLEVLKVLEHAPSRDRCYAERAFLREL 245

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I      +   L   G+V + DGK   + S +G+      +GRD A  +R   
Sbjct: 246 EGGCQVPIGVNTAIEDGILTLTGMVASLDGKRLIKDSVSGDPSHGEVLGRDLAHKVREAG 305

Query: 301 NKNVF 305
              + 
Sbjct: 306 AGEIL 310


>gi|121634334|ref|YP_974579.1| porphobilinogen deaminase [Neisseria meningitidis FAM18]
 gi|120866040|emb|CAM09778.1| putative porphobilinogen deaminase [Neisseria meningitidis FAM18]
 gi|325131787|gb|EGC54488.1| porphobilinogen deaminase [Neisseria meningitidis M6190]
 gi|325137677|gb|EGC60254.1| porphobilinogen deaminase [Neisseria meningitidis ES14902]
          Length = 311

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 104/305 (34%), Positives = 168/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K   I +R S LA+  A   +  L  ++  P   + I+ ++T+GD+I ++TL+++GG
Sbjct: 1   MNPKKLVIASRESLLAMWQAKHIQGRLKALY--PDCEVEILGMTTRGDQILDKTLSKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L  G  D AVHS KD+P  L +G  ++A   R +  D F+S+    L++
Sbjct: 59  KGLFVKELEQALYDGRADLAVHSIKDVPMDLPEGFALAAIGERANPFDAFVSNQYARLEE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           +   +V+GTSSLRR+A L      + +   RG ++TRL+KL+N +  AI+LA AG++RLK
Sbjct: 119 MPKGAVVGTSSLRREAQLRARYPHLLIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I+ IL+  D  P+ GQGA+ IE   +     E++K +NH+ T   V  ERA    L
Sbjct: 179 LDGRIRMILSESDSLPAAGQGALGIEIAAHREDLYEVLKPLNHDTTHACVTAERALARAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC+  +A +   +   L   G+V   DG +  +         A  +GR  A+ +    
Sbjct: 239 GGSCQVPLAAYCTEENGLLTLRGLVGHPDGSVVLQADAQAPAEYADALGRAVAKKLADDG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 ARELI 303


>gi|325202672|gb|ADY98126.1| porphobilinogen deaminase [Neisseria meningitidis M01-240149]
          Length = 311

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 103/305 (33%), Positives = 167/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K   I +R S LA+  A   +  L  ++  P   + I+ ++T+GD+I ++TL+++GG
Sbjct: 1   MNPKKLVIASRESLLAMWQAKHIQGRLKALY--PDCEVEILGMTTRGDQILDKTLSKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L  G  D AVHS KD+P  L +G  ++A   R +  D F+S+    L++
Sbjct: 59  KGLFVKELEQALYDGRADLAVHSIKDVPMDLPEGFALAAIGERANPFDAFVSNQYARLEE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           +    V+GTSSLRR+A L      + +   RG ++TRL+KL+N +  AI+LA AG++RL+
Sbjct: 119 MPKGVVVGTSSLRREAQLRARYPHLLIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I+ IL+  D  P+ GQGA+ IE   +     E++K +NH+ T   V  ERA    L
Sbjct: 179 LDGRIRMILSESDSLPAAGQGALGIEIAAHREDLYEVLKPLNHDTTHACVTAERALARAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC+  +A +   +   L   G+V   DG +  +         A  +GR  A+ +    
Sbjct: 239 GGSCQVPLAAYCTEENGLLTLRGLVGHPDGSVILQADAQAPAEYADALGRAVAKKLADDG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 ARELI 303


>gi|260425851|ref|ZP_05779830.1| porphobilinogen deaminase [Citreicella sp. SE45]
 gi|260420343|gb|EEX13594.1| porphobilinogen deaminase [Citreicella sp. SE45]
          Length = 319

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 136/309 (44%), Positives = 184/309 (59%), Gaps = 4/309 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGD----RITNRTLTEI 58
            +P RIGTR SPLALA A ETR  L D   + P    I+ + T GD       +R L EI
Sbjct: 9   DQPLRIGTRGSPLALAQAHETRDRLCDTFALSPEAFEIVVIRTTGDDRSMIAADRPLKEI 68

Query: 59  GGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSL 118
           G KGLFT+EIE++L++G ID AVHS KDMPT   +GL +  YLPRED+RD FIS     L
Sbjct: 69  GNKGLFTKEIEEQLMTGGIDIAVHSMKDMPTLQPEGLMLDCYLPREDVRDAFISPGHGGL 128

Query: 119 KDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR 178
            DL   +V+GTSSLRR+A LL  R D+ V++FRG ++TRL KL +  A A  LA AG+ R
Sbjct: 129 GDLPAGTVVGTSSLRRRAQLLNRRPDLRVVEFRGNLQTRLKKLEDGVAAATFLAMAGLNR 188

Query: 179 LKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLA 238
           +   ++    ++ ++  P+  QGAI IE   ++ +A E++  I+  DT   +  ERAFLA
Sbjct: 189 MGMTQLPMTAMSPDEMLPAVAQGAIGIERRSDDSRAAEMLAAIHDRDTALRLGAERAFLA 248

Query: 239 ELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRF 298
           ELDGSC++ IAG A   G+ L   G +LA DG   H     G   +   +GR  AQ +  
Sbjct: 249 ELDGSCETPIAGLAELDGTALRLRGELLAPDGSASHAGEIAGPADNGPELGRLLAQQLLA 308

Query: 299 ISNKNVFNF 307
            +  + F +
Sbjct: 309 RAGADFFAW 317


>gi|317129820|ref|YP_004096102.1| porphobilinogen deaminase [Bacillus cellulosilyticus DSM 2522]
 gi|315474768|gb|ADU31371.1| porphobilinogen deaminase [Bacillus cellulosilyticus DSM 2522]
          Length = 310

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 112/306 (36%), Positives = 168/306 (54%), Gaps = 6/306 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            +   +G+R S LA+         L  +     +   I  + TKGD+I + TL+++GGKG
Sbjct: 1   MRKIIVGSRKSNLAMTQTKWVIEQLKSLGL--NYEFEIKEIVTKGDKILDVTLSKVGGKG 58

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +EIEK +  GEID AVHS KD+P ++  G+ + A   R D RD FIS++ + L DL 
Sbjct: 59  LFVKEIEKAMYDGEIDIAVHSMKDLPAEIADGMAVGAIPKRVDPRDAFISNSGKGLMDLP 118

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK- 181
             S++GTSSLRR A +L  R D+ +   RG I+TRL K       AI+LA AGI+R+   
Sbjct: 119 AGSIVGTSSLRRSAQVLAKRPDLEIQWIRGNIDTRLRKCREENFDAIILAAAGIERVGWT 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
             ++ E L  E   P+ GQGA+ IE   ++ +   L+  IN  DT  +V  ERAFL  ++
Sbjct: 179 SDIVTEFLEPEVCLPAVGQGALGIECRADDKEVLALLAKINDSDTEKTVTAERAFLHTVE 238

Query: 242 GSCKSAIAGFAYCKGS-TLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           G C+  +AG+A  + +  +    +V + DG+     S  G   D + IG++ AQ +    
Sbjct: 239 GGCQVPVAGYATLQDNGEIALTALVGSPDGQQIFRESIAGT--DPVAIGKEVAQRMLKAG 296

Query: 301 NKNVFN 306
            K V +
Sbjct: 297 AKKVLD 302


>gi|194477303|ref|YP_002049482.1| porphobilinogen deaminase [Paulinella chromatophora]
 gi|171192310|gb|ACB43272.1| porphobilinogen deaminase [Paulinella chromatophora]
          Length = 313

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 103/308 (33%), Positives = 153/308 (49%), Gaps = 5/308 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI +R S LA+      R  L   H  P   I I  ++T+GD+I +  L +IG 
Sbjct: 1   MVSSFLRIASRRSQLAMVQTHWVRDQLAQAH--PSLEITIETMATQGDKILDVALAKIGD 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK- 119
           KGLFT+E+E +++    D AVHS KD+PT L  GL +     RED  D  + +     + 
Sbjct: 59  KGLFTKELEAQMLVNRADIAVHSLKDLPTNLPDGLVLGCVTEREDPADALVINKKYQDRL 118

Query: 120 --DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
              L   S++GTSSLRR A L      +   D RG + TRL KL++ +   ++LA AG++
Sbjct: 119 LDTLPNGSIVGTSSLRRLAQLRHHFPHLVFKDIRGNVITRLEKLDSGEFDCLILAAAGLQ 178

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL     I EI++      + GQGA+ IE    +    + +KV+ H  T      ERAFL
Sbjct: 179 RLGLGSRIHEIIDSSISLHAVGQGALGIECRDGDLDILKQIKVLEHAPTNYRCLAERAFL 238

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            EL+G C+  I      KG+ L   G+V + DGK        G+  +  +IG   A  ++
Sbjct: 239 RELEGGCQVPIGVNTRIKGNQLILTGMVASLDGKRLIRDEVYGDLINPEDIGIKLANILK 298

Query: 298 FISNKNVF 305
               +++ 
Sbjct: 299 EQGAEDIL 306


>gi|148244854|ref|YP_001219548.1| porphobilinogen deaminase [Candidatus Vesicomyosocius okutanii HA]
 gi|226740640|sp|A5CW34|HEM3_VESOH RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|146326681|dbj|BAF61824.1| porphobilinogen deaminase [Candidatus Vesicomyosocius okutanii HA]
          Length = 304

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 104/304 (34%), Positives = 168/304 (55%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
             K  +I TR SPLAL  A   +S L  ++  P   ++++ ++TKGD+I N +L++IGGK
Sbjct: 1   MNKTLKIATRQSPLALWQAQHVKSRLEKIY--PNLTVILVKITTKGDQILNSSLSKIGGK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  ++ G  D AVHS KD+P ++ +  ++ A L  E+  D F+S+   S+ DL
Sbjct: 59  GLFIKELEISIMKGMSDIAVHSMKDVPYEIPQEFELGAILKCENPFDAFVSNHFSSIDDL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
             ++ +GT S+RR   L   R D+ +ID RG + TRL KL++ +  AI+LA AG+ RL  
Sbjct: 119 PKNAKVGTCSMRRILQLKVIRPDLQIIDLRGNVNTRLKKLDDGEFDAIILACAGLIRLGF 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
              IK+ +      P+ GQGAI IE   N+ +  +L+K +   +T   +  ERA   +L+
Sbjct: 179 GNRIKQQIPENQNLPAVGQGAIGIEIRENDKEILDLIKPLIDIETSYRIIAERAMNTQLE 238

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C   +AGFA      +   G+V   D  +  +    G+   A  +G + A  +  +  
Sbjct: 239 GGCSVPVAGFATINNKQITLTGLVGNIDTGVILKEKIFGHVSQAEILGIELANKLILLGA 298

Query: 302 KNVF 305
           K++ 
Sbjct: 299 KDIL 302


>gi|325129681|gb|EGC52495.1| porphobilinogen deaminase [Neisseria meningitidis OX99.30304]
 gi|325203630|gb|ADY99083.1| porphobilinogen deaminase [Neisseria meningitidis M01-240355]
          Length = 311

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 103/305 (33%), Positives = 168/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K   I +R S LA+  A   +  L  ++  P   + I+ ++T+GD+I ++TL+++GG
Sbjct: 1   MNPKKLVIASRESLLAMWQAKHIQGRLKALY--PDCEVEILGMTTRGDQILDKTLSKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L  G  D AVHS KD+P  L +G  ++A   R +  D F+S+    L++
Sbjct: 59  KGLFVKELEQALYDGRADLAVHSIKDVPMDLPEGFALAAIGERANPFDAFVSNQYARLEE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           +   +V+GTSSLRR+A L      + +   RG ++TRL+KL+N +  AI+LA AG++RL+
Sbjct: 119 MPKGAVVGTSSLRREAQLRARYPHLVIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I+ IL+  D  P+ GQGA+ IE   +     E++K +NH+ T   V  ERA    L
Sbjct: 179 LDGRIRMILSESDSLPAAGQGALGIEIAAHREDLYEVLKPLNHDTTHACVTAERALARAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC+  +A +   +   L   G+V   DG +  +         A  +GR  A+ +    
Sbjct: 239 GGSCQVPLAAYCTEENGLLTLRGLVGHPDGSVILQADAQAPAEYADALGRAVAKKLADDG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 ARELI 303


>gi|33863541|ref|NP_895101.1| porphobilinogen deaminase [Prochlorococcus marinus str. MIT 9313]
 gi|39931399|sp|Q7V697|HEM3_PROMM RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|33640990|emb|CAE21448.1| Porphobilinogen deaminase [Prochlorococcus marinus str. MIT 9313]
          Length = 317

 Score =  256 bits (653), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 98/308 (31%), Positives = 154/308 (50%), Gaps = 5/308 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI +R S LA+      ++ L   H  P  +I +  ++T+GD+I +  L +IG 
Sbjct: 1   MVLTQLRIASRRSQLAMVQTNWVQAELEQAH--PGLSISVEAMATQGDKILDVALAKIGD 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+E+E +++ G  D AVHS KD+PT L +GL +     RED  D  + +   +   
Sbjct: 59  KGLFTKELEAQMLVGRADIAVHSLKDLPTNLPEGLMLGCVTEREDPADALVVNQKNAEHQ 118

Query: 121 L---ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           L      +++GTSSLRR A L      +   D RG + TRL KL+      ++LA AG+ 
Sbjct: 119 LDTLPEGAIVGTSSLRRLAQLRHHYPHLVFKDVRGNVITRLEKLDAGNYDCLILAAAGLT 178

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL     I +++  E    + GQGA+ IE    +P+  E +K + H+ T      ERA L
Sbjct: 179 RLGFGDRIHQLIPSEISLHAVGQGALGIECVEGHPEVLEAIKALEHKPTAQRCLAERALL 238

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            EL+G C+  I   +  + + L   G+V + DGK      + G       IG++ A+ ++
Sbjct: 239 RELEGGCQVPIGVNSRIEANELLLTGMVASLDGKRLIRDQQRGPIDRCEAIGKELAETLK 298

Query: 298 FISNKNVF 305
                 + 
Sbjct: 299 SQGAGEIL 306


>gi|124022436|ref|YP_001016743.1| porphobilinogen deaminase [Prochlorococcus marinus str. MIT 9303]
 gi|158512753|sp|A2C7L8|HEM3_PROM3 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|123962722|gb|ABM77478.1| Porphobilinogen deaminase [Prochlorococcus marinus str. MIT 9303]
          Length = 317

 Score =  256 bits (653), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 98/308 (31%), Positives = 155/308 (50%), Gaps = 5/308 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI +R S LA+      ++ L   H  P  +I +  ++T+GD+I +  L +IG 
Sbjct: 1   MVLTQLRIASRRSQLAMVQTNWVQAELEQAH--PGLSISVEAMATQGDKILDVALAKIGD 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+E+E +++ G  D AVHS KD+PT L +GL +     RED  D  + +   +   
Sbjct: 59  KGLFTKELEAQMLIGRADIAVHSLKDLPTNLPEGLMLGCVTEREDPADALVVNQKNAEHQ 118

Query: 121 L---ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           L      +++GTSSLRR A L      +   D RG + TRL KL+      ++LA AG+ 
Sbjct: 119 LDTLPEGAIVGTSSLRRLAQLRHHYPHLVFKDVRGNVITRLEKLDAGNYDCLILAAAGLT 178

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL     I +++  E    + GQGA+ IE    +P+  E++K + H+ T      ERA L
Sbjct: 179 RLGFGDRIHQLIPSEISLHAVGQGALGIECVEGHPEVLEVIKALEHKPTAQRCLAERALL 238

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            EL+G C+  I   +  + + L   G+V + DGK      + G       IG++ A+ ++
Sbjct: 239 RELEGGCQVPIGVNSRIEANELLLTGMVASLDGKRLIRDQQRGPIDRCEAIGKELAETLK 298

Query: 298 FISNKNVF 305
                 + 
Sbjct: 299 SQGAGEIL 306


>gi|86158914|ref|YP_465699.1| porphobilinogen deaminase [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85775425|gb|ABC82262.1| porphobilinogen deaminase [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 314

 Score =  256 bits (653), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 99/300 (33%), Positives = 151/300 (50%), Gaps = 3/300 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLA   A      L D  + P   + +  L T+GD+I    L ++GGKGLF 
Sbjct: 2   IRIATRRSPLAKWQANHVSQLLRD--REPGLEVRLHELVTRGDKILEVPLADVGGKGLFV 59

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE  L++ + + AVHS KD+P  L  GL +++   RED RD   S   ++L  L   +
Sbjct: 60  KEIEDALLNRDAEVAVHSMKDLPAVLAPGLVLASVPQREDPRDALCSPRWKTLAALPKGA 119

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR A L   R D+ +   RG +ETRL K +     A++LAYAG++RL   +  
Sbjct: 120 RVGTSSLRRSAQLKALRPDLQMEVVRGNVETRLRKASEGL-DAVVLAYAGLRRLGLAEHA 178

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
             +   E+  P+  QGA+ +E   ++    + +  +   +T   +  ER FLA ++G C+
Sbjct: 179 TYVFPPEEMLPAVAQGALALEARADDAPTLKRLAALEDPETRVRIEAERGFLARIEGGCQ 238

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             IAG A   G  +    +V + DG       R G   +A  +G   A+ +       + 
Sbjct: 239 VPIAGHATLAGGKITIRALVASLDGTRVIRGERTGAYAEARALGESLAEELLSRGADQIL 298


>gi|307154737|ref|YP_003890121.1| porphobilinogen deaminase [Cyanothece sp. PCC 7822]
 gi|306984965|gb|ADN16846.1| porphobilinogen deaminase [Cyanothece sp. PCC 7822]
          Length = 320

 Score =  256 bits (653), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 111/306 (36%), Positives = 162/306 (52%), Gaps = 5/306 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            +  RIG+R S LAL   +  +  L   +  P     +  +ST+GD+I +  L +IG KG
Sbjct: 7   TRTVRIGSRKSQLALVQTYWVQGELQKHY--PDRQFDVETMSTQGDKILDVALAKIGDKG 64

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFI---SHTAQSLK 119
           LFT+E+E  +I  +ID AVHS KD+PT L  GL +     R D  D  +    H  + L 
Sbjct: 65  LFTKELEVGMIDHQIDLAVHSLKDLPTNLPSGLILGCVTERVDPADGLVVNEKHKDKQLD 124

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
            L   +VIGTSSLRR A L      ++  D RG + TRL+KL+  +  AI+LA AG+ RL
Sbjct: 125 TLPEGAVIGTSSLRRLAQLRHHFPHLTFKDVRGNVNTRLSKLDAGEYDAIILAVAGLTRL 184

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
                I +I+  E    + GQGA+ IE   ++ +  +L+KV+ H+ T D    ERAFL E
Sbjct: 185 GMSDRIHQIIPSEISLHAVGQGALGIECRADDVEVLDLLKVLEHQATRDRCYAERAFLRE 244

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L+G C+  I      +G TL   G+V + DG+   + S  G   DA  +G++ A  +R  
Sbjct: 245 LEGGCQVPIGVNTSVEGDTLTLTGMVASLDGQKLIKDSITGKASDADQLGQELAIRMRNA 304

Query: 300 SNKNVF 305
               + 
Sbjct: 305 GAGEIL 310


>gi|325135871|gb|EGC58483.1| porphobilinogen deaminase [Neisseria meningitidis M0579]
 gi|325207582|gb|ADZ03034.1| porphobilinogen deaminase [Neisseria meningitidis NZ-05/33]
          Length = 311

 Score =  256 bits (653), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 103/305 (33%), Positives = 168/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K   I +R S LA+  A   +  L  ++  P   + I+ ++T+GD+I ++TL+++GG
Sbjct: 1   MNPKKLVIASRESLLAMWQAKHIQGRLKALY--PDCEVEILGMTTRGDQILDKTLSKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L  G  D AVHS KD+P  L +G  ++A   R +  D F+S+    L++
Sbjct: 59  KGLFVKELEQALYDGRADLAVHSIKDVPMDLPEGFALAAIGERANPFDAFVSNQYARLEE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           +   +V+GTSSLRR+A L      + +   RG ++TRL+KL+N +  AI+LA AG++RL+
Sbjct: 119 MPKGAVVGTSSLRREAQLRARYPHLLIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I+ IL+  D  P+ GQGA+ IE   +     E++K +NH+ T   V  ERA    L
Sbjct: 179 LDGRIRMILSESDSLPAAGQGALGIEIAAHREDLYEVLKPLNHDTTHACVTAERALARAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC+  +A +   +   L   G+V   DG +  +         A  +GR  A+ +    
Sbjct: 239 GGSCQVPLAAYCTEENGLLTLRGLVGHPDGSVILQADAQAPAEYADALGRAVAKKLADDG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 ARELI 303


>gi|88807654|ref|ZP_01123166.1| porphobilinogen deaminase [Synechococcus sp. WH 7805]
 gi|88788868|gb|EAR20023.1| porphobilinogen deaminase [Synechococcus sp. WH 7805]
          Length = 317

 Score =  256 bits (653), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 102/308 (33%), Positives = 155/308 (50%), Gaps = 5/308 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI +R S LA+      ++ L   H  P   I +  ++T+GD+I +  L +IG 
Sbjct: 1   MALEHLRIASRRSQLAMVQTNWVKAELESAH--PGMAISVEAMATQGDKILDVALAKIGD 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+E+E +++ G  + AVHS KD+PT L +GL +     RED  D  + ++  +   
Sbjct: 59  KGLFTKELEAQMLVGRAEIAVHSLKDLPTNLPEGLMLGCITEREDPADALVVNSKNADHT 118

Query: 121 L---ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           L      SV+GTSSLRR A L      +   D RG + TRL KL+  +   ++LA AG+ 
Sbjct: 119 LETLPEGSVVGTSSLRRLAQLRHHFPHLQFKDVRGNVITRLEKLDAGQYDCLILAAAGLS 178

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL     I +I+       + GQGA+ IE   + P+  ++++V+ H  T      ERAFL
Sbjct: 179 RLGFGDRIHQIIPGHISLHAVGQGALGIECVCDRPEVLKIIQVLEHAPTAGRCLAERAFL 238

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            EL+G C+  I   +   G  L   G+V + DG       R G+  D   IGR  A  ++
Sbjct: 239 RELEGGCQVPIGVNSRIDGQELILTGMVASLDGLRLIRDERRGSLTDPEAIGRALAADLK 298

Query: 298 FISNKNVF 305
                 + 
Sbjct: 299 SRGAGEIL 306


>gi|254804423|ref|YP_003082644.1| Porphobilinogen deaminase [Neisseria meningitidis alpha14]
 gi|254667964|emb|CBA04229.1| Porphobilinogen deaminase [Neisseria meningitidis alpha14]
          Length = 311

 Score =  255 bits (652), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 104/305 (34%), Positives = 169/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K   I +R S LA+  A   +  L  ++  P   + I+ ++T+GD+I ++TL+++GG
Sbjct: 1   MNPKKLVIASRESLLAMWQAKHIQGRLKALY--PDCEVEILGMTTRGDQILDKTLSKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L  G  D AVHS KD+P  L +G  ++A   R +  D F+S+    L++
Sbjct: 59  KGLFVKELEQALYDGRADLAVHSIKDVPMDLPEGFALAAIGERANPFDAFVSNQYARLEE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           +   +V+GTSSLRR+A L      + +   RG ++TRL+KL+N +  AI+LA AG++RLK
Sbjct: 119 MPKGAVVGTSSLRREAQLRARYPHLLIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I+ IL+  D  P+ GQGA+ IE   +     E++K +NH+ T   V  ERA    L
Sbjct: 179 LDGRIRMILSESDSLPAAGQGALGIEIAAHREDLYEVLKPLNHDTTHACVTAERALARAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC+  +A +   +   L   G+V   DG +  +     +   A  +GR  A+ +    
Sbjct: 239 GGSCQVPLAAYCTEENGLLTLRGLVGHPDGSVVLQADAQASAEYADALGRAVAKKLADDG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 ARELI 303


>gi|159026408|emb|CAO88937.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 319

 Score =  255 bits (652), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 104/305 (34%), Positives = 159/305 (52%), Gaps = 5/305 (1%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +  RIG+R S LAL   +  ++ L   H  P     +  +ST+GD+I +  L +IG KGL
Sbjct: 8   RSLRIGSRKSQLALVQTYWVQAELSKHH--PHRQFEVETMSTQGDKILDVALAKIGDKGL 65

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL-- 121
           FT+E+E  ++   ID AVHS KD+PT L +GL +     R +  D  + ++      L  
Sbjct: 66  FTKELEVGMLDRSIDLAVHSLKDLPTNLPEGLILGCVTERVNPADALVVNSENQDYQLDT 125

Query: 122 -ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
               +V+GTSSLRR A L      ++  D RG + TRL KL+  +  AI+LA AG++RL 
Sbjct: 126 LPEGAVVGTSSLRRLAQLRYHYPHLTFKDVRGNVNTRLAKLDAGEYDAIILAVAGLERLG 185

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               + +++  E    + GQGA+ IE    +P+  E++KV+ H  + D    ERAFL EL
Sbjct: 186 LGDRVHQVIPAEISLHAVGQGALGIECRDADPEVLEVLKVLEHAPSRDRCYAERAFLREL 245

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I      +   L   G+V + DGK   + S +G+      +GRD A  +R   
Sbjct: 246 EGGCQVPIGVNTAIEDGILTLTGMVASLDGKRLIKDSVSGDPSHGEVLGRDLAHKVRDAG 305

Query: 301 NKNVF 305
              + 
Sbjct: 306 AGEIL 310


>gi|238018694|ref|ZP_04599120.1| hypothetical protein VEIDISOL_00538 [Veillonella dispar ATCC 17748]
 gi|237865165|gb|EEP66455.1| hypothetical protein VEIDISOL_00538 [Veillonella dispar ATCC 17748]
          Length = 319

 Score =  255 bits (652), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 111/312 (35%), Positives = 173/312 (55%), Gaps = 8/312 (2%)

Query: 1   MEKKP------FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRT 54
           M KK        RIGTR S LAL  A    + L  ++  P   + ++  +TKGDRI  + 
Sbjct: 1   MRKKANAMRDHIRIGTRKSALALWQAEHISAELQRLY--PNITVELVHFNTKGDRILEKP 58

Query: 55  LTEIGGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHT 114
           L ++GGKGLFT E+E+ +  G+ID AVHS KDMPT+L +GL + A   RE   D  +S  
Sbjct: 59  LAQVGGKGLFTAELEEAMHKGDIDIAVHSLKDMPTELPEGLTLGAISAREVPYDALVSPV 118

Query: 115 AQSLKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYA 174
            ++L  L   + +GTSSLRR+A LL  R D+ V   RG ++TRL+K+   K   ++LA A
Sbjct: 119 YKTLDKLPEGACVGTSSLRRQAQLLHVRPDLKVEVIRGNVQTRLSKIETEKLDGVILAQA 178

Query: 175 GIKRLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCER 234
           G+KRL  +  I ++   ++  P+ GQGA+ IE   ++ +  E++  IN E T  +V  ER
Sbjct: 179 GLKRLGLDDQITQVFKADEMIPAVGQGALAIECRADDTEMLEMLAPINDEATRYAVEGER 238

Query: 235 AFLAELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQ 294
           +FL +L+G C+  +          L    ++ + DGK  +E   +G    A  +G++ A+
Sbjct: 239 SFLRQLNGGCQVPMGVHGTINKGQLILKAMIASLDGKTVYEGEISGPAKKAEILGKNLAK 298

Query: 295 YIRFISNKNVFN 306
            +     K++ +
Sbjct: 299 ALYEEGGKHIVD 310


>gi|313668981|ref|YP_004049265.1| porphobilinogen deaminase [Neisseria lactamica ST-640]
 gi|313006443|emb|CBN87906.1| putative porphobilinogen deaminase [Neisseria lactamica 020-06]
          Length = 326

 Score =  255 bits (652), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 106/305 (34%), Positives = 168/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K   I +R S LA+  A   +  L  ++  P   + I+ ++T+GDRI +RTL+++GG
Sbjct: 16  MNPKKLVIASRESLLAMWQAKHIQGRLKALY--PDCEVEILGMTTRGDRILDRTLSKVGG 73

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L  G  D AVHS KD+P  L +G  ++A   R +  D F+S+    L++
Sbjct: 74  KGLFVKELEQALQDGRADLAVHSIKDVPMDLPEGFALAAIGERANPFDAFVSNRYARLEE 133

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           +   +V+GTSSLRR+A L      +++   RG ++TRL+KL+N +  AI+LA AG++RL+
Sbjct: 134 MPKGAVVGTSSLRREAQLRARYPHLAIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLE 193

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I+ IL+  D  P+ GQGA+ IE   +     E++K +NH  T   V  ERA    L
Sbjct: 194 LDGRIRMILSESDSLPAAGQGALGIEIAAHREDLYEVLKPLNHGVTNACVTAERALARAL 253

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC+  +A +   +   L   G+V   DG I  +         A  +GR  A+ +    
Sbjct: 254 GGSCQVPLAAYCTEENGLLTLRGLVGHPDGSIVLQADAQAPAEYADALGRAVAKKLADDG 313

Query: 301 NKNVF 305
            + + 
Sbjct: 314 ARELI 318


>gi|78212229|ref|YP_381008.1| porphobilinogen deaminase [Synechococcus sp. CC9605]
 gi|123729770|sp|Q3ALS9|HEM3_SYNSC RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|78196688|gb|ABB34453.1| porphobilinogen deaminase [Synechococcus sp. CC9605]
          Length = 317

 Score =  255 bits (652), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 103/308 (33%), Positives = 150/308 (48%), Gaps = 5/308 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI +R S LA+      ++ L   H  P   I +  ++T+GD+I +  L +IG 
Sbjct: 1   MALTELRIASRRSQLAMVQTNWVKAELEKAH--PGLKITVEAMATQGDKILDVALAKIGD 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+E+E +++    D AVHS KD+PT L +GL +     RED  D  + +       
Sbjct: 59  KGLFTKELEAQMLVDRADIAVHSLKDLPTNLPEGLMLGCITEREDPADALVVNAKNQAYK 118

Query: 121 L---ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           L      SV+GTSSLRR A L      +   D RG + TRL KL++     ++LA AG+ 
Sbjct: 119 LETLPEGSVVGTSSLRRLAQLRHHYPHLIFKDVRGNVITRLEKLDSGDYDCLILAAAGLG 178

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL     I +++  E    + GQGA+ IE     P+  E +KV+ H  T      ERAFL
Sbjct: 179 RLGFSDRIHQLIPGEISLHAVGQGALGIECVEGKPEVLEAIKVLEHTPTSQRCLAERAFL 238

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            EL+G C+  I      +G  L   G+V + DGK       +G   +A  IG   A  ++
Sbjct: 239 RELEGGCQVPIGVNTRFEGDQLILTGMVASLDGKRLIRDQTSGEASEAEAIGIALANTLK 298

Query: 298 FISNKNVF 305
                 + 
Sbjct: 299 GQGAGEIL 306


>gi|262199948|ref|YP_003271157.1| porphobilinogen deaminase [Haliangium ochraceum DSM 14365]
 gi|262083295|gb|ACY19264.1| porphobilinogen deaminase [Haliangium ochraceum DSM 14365]
          Length = 320

 Score =  255 bits (651), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 105/317 (33%), Positives = 160/317 (50%), Gaps = 13/317 (4%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M ++   I TR S LAL  A   R  +  V   P   + ++ + T+GD+I +  L++IGG
Sbjct: 1   MSERTIHISTRGSQLALWQAHHVRDEIRRVR--PAWQVELVIIKTQGDKILDVPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           K LF +EIE+ L+ G  D AVHS KD+P +L  GL ++A   RED  D   +   + L +
Sbjct: 59  KALFVKEIEQALLDGRADVAVHSMKDVPAELAPGLFMAATSRREDPYDALCTRDGRGLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           LA  + +GTSSLRR+  +L  R D+ +   RG + TRL KL++    A++LA AG+KRL 
Sbjct: 119 LAEGATLGTSSLRRQCQILARRPDLRIEMLRGNVPTRLGKLDDGSFDAVILAAAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQEL-----VKVINHEDTWDSVNCERA 235
             + I + L+     P+ GQG + IET   +  A         + ++       V  ERA
Sbjct: 179 HGERISQRLDGGVCVPAVGQGVLGIETRQGDAPADRELVEALREALHDPAEERRVVAERA 238

Query: 236 FLAELDGSCKSAIAGFAYCKGS------TLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
            +A L GSC++ +A  A  +G       TL   G+    DG         G   DA  +G
Sbjct: 239 MMAALGGSCQTPLAAHASYRGDSDPVAGTLVIEGLCGRPDGSEILRAQVEGRAEDAQALG 298

Query: 290 RDAAQYIRFISNKNVFN 306
              A+ +R    + + +
Sbjct: 299 SSLAEELRGQGAQAIID 315


>gi|78185247|ref|YP_377682.1| porphobilinogen deaminase [Synechococcus sp. CC9902]
 gi|123770934|sp|Q3AWQ4|HEM3_SYNS9 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|78169541|gb|ABB26638.1| hydroxymethylbilane synthase [Synechococcus sp. CC9902]
          Length = 317

 Score =  255 bits (651), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 104/308 (33%), Positives = 154/308 (50%), Gaps = 5/308 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI +R S LA+      ++ L   H  P   I +  ++T+GD+I +  L +IG 
Sbjct: 1   MALTELRIASRRSQLAMVQTNWVKAELEKAH--PGLTITVEAMATQGDKILDVALAKIGD 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+E+E +++ G  D AVHS KD+PT L +GL +     RED  D  + H      +
Sbjct: 59  KGLFTKELEAQMLVGRADIAVHSLKDLPTNLPEGLMLGCITEREDPADALVLHAKNKHLN 118

Query: 121 L---ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           L      +V+GTSSLRR A L      +   D RG + TRL KL++     ++LA AG+ 
Sbjct: 119 LATLPEGAVVGTSSLRRLAQLRHHYPHLEFKDVRGNVITRLEKLDSGAYDCLILAAAGLG 178

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL     I + +  +    + GQGA+ IE   N P   E++KV+ H  T      ERAFL
Sbjct: 179 RLGFADRIDQSIPGDISLHAVGQGALGIECVENQPDVMEIIKVLEHGPTSQRCLAERAFL 238

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            EL+G C+  I      +G  L   G+V + DGK       +G   D  +IG + A  ++
Sbjct: 239 RELEGGCQVPIGVNTRFEGDQLILTGMVASLDGKRLIREQASGPSTDPESIGLELAATLK 298

Query: 298 FISNKNVF 305
            +    + 
Sbjct: 299 GLGAGEIL 306


>gi|222150055|ref|YP_002551012.1| porphobilinogen deaminase [Agrobacterium vitis S4]
 gi|221737037|gb|ACM38000.1| porphobilinogen deaminase [Agrobacterium vitis S4]
          Length = 309

 Score =  255 bits (651), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 164/306 (53%), Positives = 212/306 (69%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KPFRIGTR SPLALA A ETR  L   H + P    I+ LST GDRIT+R+L EIGG
Sbjct: 1   MQTKPFRIGTRGSPLALAQAHETRERLATAHGLSPDMFEIVVLSTTGDRITDRSLAEIGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT E+E++L+SG +D AVHS+KDMPT L  GL+ISAYLPRED+RD FI  TA  L +
Sbjct: 61  KGLFTLELEQQLLSGGLDFAVHSSKDMPTALPDGLEISAYLPREDMRDAFIGRTAPKLLE 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           LA  +VIG++SLRR+AL+ R R D+ VI +RG +ETRL KL   +  A LLA AG+KRL 
Sbjct: 121 LAEGAVIGSASLRRQALIRRLRPDLQVITYRGAVETRLRKLAAGEVDATLLAVAGLKRLD 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           KE VI + L++E FPP+P QGAICIE  V++ + Q+L+  INH  T+D+V+CERAFLA L
Sbjct: 181 KETVITQYLDLESFPPAPAQGAICIEARVDDRRIQDLLAPINHRPTFDAVSCERAFLAAL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG+A   G  +   G +L  DG++ H V   G   D + +G  A + +R  +
Sbjct: 241 DGSCRTPIAGYAISDGEMIRLTGTILTPDGQVSHSVEAEGRCADGLALGWSAGEKVRDKA 300

Query: 301 NKNVFN 306
               F 
Sbjct: 301 GPGFFE 306


>gi|291279209|ref|YP_003496044.1| porphobilinogen deaminase [Deferribacter desulfuricans SSM1]
 gi|290753911|dbj|BAI80288.1| porphobilinogen deaminase [Deferribacter desulfuricans SSM1]
          Length = 305

 Score =  255 bits (651), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 106/303 (34%), Positives = 164/303 (54%), Gaps = 3/303 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
                IGTR S LAL  A   +S +   H     ++ +  + T GD+I +  L +IGGKG
Sbjct: 1   MNKLVIGTRGSKLALWQANHIKSLIESTHH---IDVELKIIKTTGDKILDTPLAKIGGKG 57

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +EIE++L++  +D AVHS KD+P +L  GL++  +  RE+  D F+S    SL +L 
Sbjct: 58  LFVKEIEEELLNKNVDIAVHSMKDVPVELPDGLEVGVFPVREEPYDAFLSVKYNSLDELP 117

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +VIGTSSLRRK  L+R    + + D RG ++TR+ KL   +  AI+LA AG+KRL   
Sbjct: 118 DGAVIGTSSLRRKIQLMRKYPHLVIKDLRGNVDTRIRKLTEGQYDAIILAKAGLKRLGLL 177

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + +K+ ++     P+  QG + IE   ++   Q+++  +NHE+T      ERAFL  L+G
Sbjct: 178 EHVKQTIDDTLMIPAVCQGTLGIEYREDDQDVQKVIGFLNHEETVFRTKAERAFLKRLEG 237

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  +   A   G  L   G +   DG  +      G++ DA+ +G   A+ I     K
Sbjct: 238 GCQVPLGCIANLVGDRLILKGFLANLDGSKYIYEEIEGDKTDAVKLGLKLAKNILGQGGK 297

Query: 303 NVF 305
            + 
Sbjct: 298 EII 300


>gi|317486609|ref|ZP_07945428.1| porphobilinogen deaminase [Bilophila wadsworthia 3_1_6]
 gi|316922143|gb|EFV43410.1| porphobilinogen deaminase [Bilophila wadsworthia 3_1_6]
          Length = 308

 Score =  255 bits (651), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 116/306 (37%), Positives = 161/306 (52%), Gaps = 5/306 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           MEK    I TR S LAL  A   + SL  VH  P   + +  + TKGD I +  L ++GG
Sbjct: 1   MEK--LVIATRGSRLALWQANHVKDSLEAVH--PGLAVELNIIKTKGDIILDVPLAKVGG 56

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE+ L+SG  D AVHS KD+P +L +GL +     RED  D+F+S    SL++
Sbjct: 57  KGLFVKEIEEALLSGAADIAVHSMKDVPMELPEGLILGIVPEREDPTDLFLSVDYDSLEN 116

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+A +L  R D+ V+  RG ++TRL KL   +  AI++A AG+KRL 
Sbjct: 117 LPAGAVVGTSSLRRQAQVLAQRPDLEVVSLRGNVDTRLRKLTEGQFAAIIMATAGMKRLG 176

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
                +  L    F P+ GQGA+ IE   +     E++  + H  T   V  ER  LA L
Sbjct: 177 LSVPKECPLAPPAFIPAVGQGALGIEFREDRKDLAEMLSFMEHRPTRICVEAERGLLAGL 236

Query: 241 DGSCKSAIAGFAY-CKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           DG C+  IAG A      T    G+V   DG +       G   +A  +G   A+ +   
Sbjct: 237 DGGCQVPIAGHAEMLDDGTFELEGLVGEVDGSVIIRRKVTGRADEARAVGFALARSLAED 296

Query: 300 SNKNVF 305
               + 
Sbjct: 297 GGAEIL 302


>gi|67924108|ref|ZP_00517554.1| Porphobilinogen deaminase [Crocosphaera watsonii WH 8501]
 gi|67854033|gb|EAM49346.1| Porphobilinogen deaminase [Crocosphaera watsonii WH 8501]
          Length = 318

 Score =  255 bits (651), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 104/307 (33%), Positives = 161/307 (52%), Gaps = 5/307 (1%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
             +  RIG+R S LAL   +  +  L   +  P     +  +ST+GD+I +  L +IG K
Sbjct: 4   SSRAIRIGSRKSQLALVQTYWIQEQLQKHY--PDRQFDVETMSTQGDKILDVALAKIGDK 61

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFI---SHTAQSL 118
           GLFT+E+E  ++  ++D AVHS KD+PT L +GL +     R +  D  +    H  + L
Sbjct: 62  GLFTKELETAMLQNQVDFAVHSLKDLPTNLPEGLMLGCVTERVNPADALVVHEKHRDKQL 121

Query: 119 KDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR 178
             L   SVIGTSSLRR A L      ++  D RG + TRL KL++ +  AI+LA AG++R
Sbjct: 122 DTLPEGSVIGTSSLRRLAQLRHHYPHLTFKDVRGNVNTRLGKLDSGEYDAIILAVAGLQR 181

Query: 179 LKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLA 238
           L     I +++  +    + GQGA+ IE    +P+  EL+KV+   +T D    ERAFL 
Sbjct: 182 LDMSDRIHQVIPDDISLHAVGQGALGIECRTGDPEILELLKVLEDTETRDRCYAERAFLR 241

Query: 239 ELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRF 298
           +L+G C+  I      + + L   G+V + DGK   + +  G    A ++G+  A  +R 
Sbjct: 242 QLEGGCQVPIGVNTKIENNVLTLIGMVASLDGKTLIKDTIEGEPSQAESLGQTLATRLRD 301

Query: 299 ISNKNVF 305
                + 
Sbjct: 302 AGATEIL 308


>gi|258591837|emb|CBE68140.1| Porphobilinogen deaminase (PBG) (Hydroxymethylbilane synthase)
           (HMBS) (Pre-uroporphyrinogen synthase) [NC10 bacterium
           'Dutch sediment']
          Length = 315

 Score =  255 bits (651), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 112/305 (36%), Positives = 160/305 (52%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     ++GTR SPLAL  A      L    + P  ++ I+P+ T GD+  +  L+++GG
Sbjct: 1   MRSHTVKLGTRGSPLALCQAGLVTEELRR--RWPDLDVTIVPIKTSGDKFLDVVLSQVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE+ L+ G ID AVHS KD+P +L  GL   A + RED  D  ++       D
Sbjct: 59  KGLFVKEIEEALLDGRIDLAVHSLKDLPAELAPGLCEGAVMRREDPLDALVARNGLRFTD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + IGTSSLRR+   L  R D+ +   RG ++TRLNKL      A++LA AG+ RL 
Sbjct: 119 LPRGARIGTSSLRRQVQFLHCRPDLQIESLRGNVQTRLNKLETLGLEAVVLAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I E L  +   P+ GQGA+ IE   ++ +  E V+ +NH +T  +   ERAFL  L
Sbjct: 179 LQDRITERLQPDLCLPAIGQGALVIEIREDDRQTAERVETLNHRETRQATTAERAFLRRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC + IA F   +G TL   G+V   DGK     +  G       +G+  A  +    
Sbjct: 239 GGSCVTPIAAFGRLEGETLELTGMVAGLDGKRLLRQAVVGEAGAPEQVGQTLADRLLSAG 298

Query: 301 NKNVF 305
              + 
Sbjct: 299 AGEII 303


>gi|225075410|ref|ZP_03718609.1| hypothetical protein NEIFLAOT_00415 [Neisseria flavescens
           NRL30031/H210]
 gi|224953228|gb|EEG34437.1| hypothetical protein NEIFLAOT_00415 [Neisseria flavescens
           NRL30031/H210]
          Length = 325

 Score =  255 bits (651), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 104/305 (34%), Positives = 169/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K   I +R S LA+  A   +  L  ++  P   + I+ ++T+GDRI +RTL+++GG
Sbjct: 15  MNPKKLVIASRESLLAMWQAKHIQGRLKALY--PDCEVEILGMTTRGDRILDRTLSKVGG 72

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L  G  D AVHS KD+P  L +G  ++A   R +  D F+S+    L++
Sbjct: 73  KGLFVKELEQALYDGRADLAVHSIKDVPMDLPEGFALAAIGERANPFDAFVSNQYARLEE 132

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           +   +++GTSSLRR+A L      + +   RG ++TRL+KL+N +  AI+LA AG++RL+
Sbjct: 133 MPKGAIVGTSSLRREAQLRARYPHLVIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLE 192

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            ++ I+ IL+  D  P+ GQGA+ IE   +     E++K +NH+ T   V  ERA    L
Sbjct: 193 LDERIRMILSESDSLPAAGQGALGIEIAAHREDLYEVLKPLNHDTTHACVTAERALARAL 252

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC+  +A +   +   L   G+V   DG +  +         A  +GR  A+ +    
Sbjct: 253 GGSCQVPLAAYCTEENGLLTLRGLVGHPDGSVILQADAQAPAEYADALGRAVAKKLADDG 312

Query: 301 NKNVF 305
            + + 
Sbjct: 313 AEELI 317


>gi|87123876|ref|ZP_01079726.1| Porphobilinogen deaminase [Synechococcus sp. RS9917]
 gi|86168445|gb|EAQ69702.1| Porphobilinogen deaminase [Synechococcus sp. RS9917]
          Length = 317

 Score =  255 bits (650), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 103/308 (33%), Positives = 152/308 (49%), Gaps = 5/308 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI +R S LA+      ++ L   H  P   I +  ++T+GD+I +  L +IG 
Sbjct: 1   MALEHLRIASRRSQLAMVQTNWVKAELEQAH--PGLPISVEAMATQGDKILDVALAKIGD 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+E+E +++ G  + AVHS KD+PT L +GL +     RED  D  + +   +   
Sbjct: 59  KGLFTKELEAQMLVGRAEIAVHSLKDLPTNLPEGLMLGCITEREDPADALVVNAKNADHK 118

Query: 121 L---ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           L      +V+GTSSLRR A L      +   D RG + TRL KL+      ++LA AG+ 
Sbjct: 119 LETLPEGAVVGTSSLRRLAQLRHHYPHLEFKDVRGNVITRLEKLDAGDYDCLILAAAGLT 178

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL     I +I+       + GQGA+ IE     P   EL+KV+ H  T      ERAFL
Sbjct: 179 RLGFADRIHQIIPSHISLHAVGQGALGIECVEGQPDVLELIKVLEHSPTASRCLAERAFL 238

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            EL+G C+  I      + + L   G+V + DGK      R G    A  IG+  A  ++
Sbjct: 239 RELEGGCQVPIGVNTRIEANELVLTGMVASLDGKRLIRDERRGTVDKAEAIGQLLAADLK 298

Query: 298 FISNKNVF 305
                ++ 
Sbjct: 299 SQGAGDIL 306


>gi|319639194|ref|ZP_07993945.1| porphobilinogen deaminase [Neisseria mucosa C102]
 gi|317399378|gb|EFV80048.1| porphobilinogen deaminase [Neisseria mucosa C102]
          Length = 325

 Score =  255 bits (650), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 104/305 (34%), Positives = 169/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K   I +R S LA+  A   +  L  ++  P   + I+ ++T+GD+I +RTL+++GG
Sbjct: 15  MNPKKLVIASRESLLAMWQAKHIQGRLKALY--PDCEVEILGMTTRGDQILDRTLSKVGG 72

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L  G  D AVHS KD+P  L +G  ++A   R +  D F+S+    L++
Sbjct: 73  KGLFVKELEQALYDGRADLAVHSIKDVPMDLPEGFALAAIGERANPFDAFVSNQYARLEE 132

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           +   +V+GTSSLRR+A L      + +   RG ++TRL+KL+N +  AI+LA AG++RL+
Sbjct: 133 MPKGAVVGTSSLRREAQLRARYPHLVIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLE 192

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            ++ I+ IL+  D  P+ GQGA+ IE   +     E++K +NH+ T   V  ERA    L
Sbjct: 193 LDERIRMILSESDSLPAAGQGALGIEIAAHREDLYEVLKPLNHDTTHACVTAERALARAL 252

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC+  +A +   +   L   G+V   DG +  +         A  +GR  A+ +    
Sbjct: 253 GGSCQVPLAAYCTEENGLLTLRGLVGHPDGSVILQADAQAPAEYADALGRAVAKKLADDG 312

Query: 301 NKNVF 305
            + + 
Sbjct: 313 AEELI 317


>gi|284799715|ref|ZP_05984671.2| hydroxymethylbilane synthase [Neisseria subflava NJ9703]
 gi|284797316|gb|EFC52663.1| hydroxymethylbilane synthase [Neisseria subflava NJ9703]
          Length = 323

 Score =  255 bits (650), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 104/305 (34%), Positives = 169/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K   I +R S LA+  A   +  L  ++  P   + I+ ++T+GD+I +RTL+++GG
Sbjct: 15  MNPKKLVIASRESLLAMWQAKHIQGRLKALY--PDCEVEILGMTTRGDQILDRTLSKVGG 72

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L  G  D AVHS KD+P  L +G  ++A   R +  D F+S+    L++
Sbjct: 73  KGLFVKELEQALYDGRADLAVHSIKDVPMDLPEGFTLAAISERANPFDAFVSNQYARLEE 132

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           +   +V+GTSSLRR+A L      + +   RG ++TRL+KL+N +  AI+LA AG++RL+
Sbjct: 133 MPKGAVVGTSSLRREAQLRVRYPHLVIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLE 192

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            ++ I+ IL+  D  P+ GQGA+ IE   +     E++K +NH+ T   V  ERA    L
Sbjct: 193 LDERIRMILSESDSLPAAGQGALGIEIAAHREDLYEVLKPLNHDTTHACVTAERALARAL 252

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC+  +A +   +   L   G+V   DG +  +         A  +GR  A+ +    
Sbjct: 253 GGSCQVPLAAYCTEENGLLTLRGLVGHPDGSVILQADAQAPAEYADALGRAVAKKLADDG 312

Query: 301 NKNVF 305
            + + 
Sbjct: 313 AEELI 317


>gi|241759313|ref|ZP_04757419.1| hydroxymethylbilane synthase [Neisseria flavescens SK114]
 gi|241320449|gb|EER56746.1| hydroxymethylbilane synthase [Neisseria flavescens SK114]
          Length = 325

 Score =  255 bits (650), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 103/305 (33%), Positives = 169/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K   I +R S LA+  A   +  L  ++  P   + I+ ++T+GD+I +RTL+++GG
Sbjct: 15  MNPKKLVIASRESLLAMWQAKHIQGRLKALY--PDCEVEILGMTTRGDQILDRTLSKVGG 72

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L  G  D AVHS KD+P  L +G  ++A   R +  D F+S+    L++
Sbjct: 73  KGLFVKELEQALYDGRADLAVHSIKDVPMDLPEGFALAAIGERANPFDAFVSNQYARLEE 132

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           +   +++GTSSLRR+A L      + +   RG ++TRL+KL+N +  AI+LA AG++RL+
Sbjct: 133 MPKGAIVGTSSLRREAQLRARYPHLVIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLE 192

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            ++ I+ IL+  D  P+ GQGA+ IE   +     E++K +NH+ T   V  ERA    L
Sbjct: 193 LDERIRMILSESDSLPAAGQGALGIEIAAHREDLYEVLKPLNHDTTHACVTAERALARAL 252

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC+  +A +   +   L   G+V   DG +  +         A  +GR  A+ +    
Sbjct: 253 GGSCQVPLAAYCTEENGLLTLRGLVGHPDGSVILQADAQAPAEYADALGRAVAKKLADDG 312

Query: 301 NKNVF 305
            + + 
Sbjct: 313 AEELI 317


>gi|134300009|ref|YP_001113505.1| porphobilinogen deaminase [Desulfotomaculum reducens MI-1]
 gi|189028090|sp|A4J6H7|HEM3_DESRM RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|134052709|gb|ABO50680.1| hydroxymethylbilane synthase [Desulfotomaculum reducens MI-1]
          Length = 309

 Score =  255 bits (650), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 106/305 (34%), Positives = 156/305 (51%), Gaps = 2/305 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            K    +G+R S LAL         L   +  P     I  + TKGD++ +  L +IG K
Sbjct: 1   MKHKITVGSRDSALALWQTRWVVEQLEKQN--PDVTFEITTMKTKGDKMLDVALAKIGDK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLFT+E+E  ++  EID AVHS KDMPT L +GL I A   R++  D  IS   + L +L
Sbjct: 59  GLFTKELEVAMLQKEIDFAVHSLKDMPTALPEGLIIGAVCKRDNPGDALISKDGRKLDEL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              + IGTSSLRR A LL +R D  +   RG + TR+ KL + +   I+LA AGI R+  
Sbjct: 119 PKGARIGTSSLRRCAQLLNYRPDFQLEALRGNLNTRMKKLVSEQLDGIILAAAGITRMGW 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E +I EI+  +   P+ GQGAI +E   ++P+   L+K I H +T  +   ER+ L  L+
Sbjct: 179 EDMIAEIIPFQVCLPAVGQGAISVECREDDPEILNLLKGIEHTETKAATEAERSLLRYLE 238

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I   +  K + L    +V   DG              A+ +G + A+ +  +  
Sbjct: 239 GGCQVPIGAHSEVKNNRLMLTAVVATLDGTKVIRAQGENEVNKAVELGIEVAEKLMAMGG 298

Query: 302 KNVFN 306
           K +  
Sbjct: 299 KKILE 303


>gi|309379620|emb|CBX21791.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 326

 Score =  255 bits (650), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 106/305 (34%), Positives = 168/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K   I +R S LA+  A   +  L  ++  P   + I+ ++T+GDRI +RTL+++GG
Sbjct: 16  MNPKKLVIASRESLLAMWQAKHIQGRLKALY--PDCEVEILGMTTRGDRILDRTLSKVGG 73

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L  G  D AVHS KD+P  L +G  ++A   R +  D F+S+    L++
Sbjct: 74  KGLFVKELEQALQDGRADLAVHSIKDVPMDLPEGFALAAIGERANPFDAFVSNRYARLEE 133

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           +   +V+GTSSLRR+A L      +++   RG ++TRL+KL+N +  AI+LA AG++RL+
Sbjct: 134 MPESAVVGTSSLRREAQLRARYPHLAIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLE 193

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I+ IL+  D  P+ GQGA+ IE   +     E++K +NH  T   V  ERA    L
Sbjct: 194 LDGRIRMILSESDSLPAAGQGALGIEIAAHREDLYEVLKPLNHGVTNACVTAERALARAL 253

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC+  +A +   +   L   G+V   DG I  +         A  +GR  A+ +    
Sbjct: 254 GGSCQVPLAAYCTEENGLLTLRGLVGHPDGSIVLQADAQAPAEYADALGRAVAKKLADDG 313

Query: 301 NKNVF 305
            + + 
Sbjct: 314 ARELI 318


>gi|123965794|ref|YP_001010875.1| porphobilinogen deaminase [Prochlorococcus marinus str. MIT 9515]
 gi|158512730|sp|A2BVF7|HEM3_PROM5 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|123200160|gb|ABM71768.1| Porphobilinogen deaminase [Prochlorococcus marinus str. MIT 9515]
          Length = 316

 Score =  254 bits (649), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 97/308 (31%), Positives = 159/308 (51%), Gaps = 5/308 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M K   +I +R S LA+      +  L     IP   + I  ++T+GD+I +  L +IG 
Sbjct: 1   MTKLKLKIASRRSKLAMVQTLWVKEQLEK--NIPNLEVSIESMATQGDKILDVALAKIGD 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK- 119
           KGLFT+E+E +++ G+ D AVHS KD+PT L  GL++     RED  D  + +    +  
Sbjct: 59  KGLFTKELEAQMLIGKADIAVHSLKDLPTNLPDGLKLGCITKREDPSDALVVNKKNEIYQ 118

Query: 120 --DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
              L   S++GTSSLRR A L      ++  D RG + TR+ KL++ +   I+LA AG+K
Sbjct: 119 LESLPAGSIVGTSSLRRLAQLRYKFPYLNFKDIRGNVITRIEKLDSGEFDCIILAAAGLK 178

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL  E  I +I+  E    + GQGA+ IE    + +  +++ V+  + +      ER+FL
Sbjct: 179 RLGFESRIHQIIPNEISLHAVGQGALGIECKSEDKEVLKIISVLEDKASSQKCLAERSFL 238

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            EL+G C+  I   +  +   +   G+V + DGK   +   +GN      +G+  A+ ++
Sbjct: 239 RELEGGCQVPIGVNSSIQNDEICLKGMVASIDGKKLIKDESSGNVKYPEEVGKKLAEKLK 298

Query: 298 FISNKNVF 305
                 + 
Sbjct: 299 LQGADKIL 306


>gi|86604967|ref|YP_473730.1| porphobilinogen deaminase [Synechococcus sp. JA-3-3Ab]
 gi|86553509|gb|ABC98467.1| porphobilinogen deaminase [Synechococcus sp. JA-3-3Ab]
          Length = 310

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 102/303 (33%), Positives = 156/303 (51%), Gaps = 5/303 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI +R S LALA  +     L   H  P   + +  LST+GD I +  L +IG KGLFT
Sbjct: 1   MRIASRKSELALAQTYWVMGQLQAHH--PGLPLELHTLSTQGDIILDVALAKIGDKGLFT 58

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTA---QSLKDLA 122
           +E+E  L++G  D AVHS KD+PT+L +GL + A   RED  D  +         L  L 
Sbjct: 59  KELEVSLLNGSSDLAVHSLKDLPTRLPEGLVLGAITQREDPLDALVLREELRGYQLATLP 118

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +VIGTSSLRR A L      +   + RG + TRL KL+  +   ++LA AG+KRL +E
Sbjct: 119 AGTVIGTSSLRRLAQLRHAFPHLQFKNVRGNLNTRLAKLDRGEYDGLILAVAGLKRLGQE 178

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I E+L+      + GQG++ IE    + +  EL++ +   +       ERAFL  L+G
Sbjct: 179 QRIHEVLDPSVSLYAVGQGSLGIECRQGDERILELIRPLADAEATARCLAERAFLRALEG 238

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  I   +  +G  L+  G+V   +G+     ++ G+  D   +G   A+ ++     
Sbjct: 239 GCQVPIGVHSQVQGEELHLTGMVADLEGRQLIRDTQTGSTADPEAVGMALAEKLKRQGAD 298

Query: 303 NVF 305
            + 
Sbjct: 299 EIL 301


>gi|288957245|ref|YP_003447586.1| hydroxymethylbilane synthase [Azospirillum sp. B510]
 gi|288909553|dbj|BAI71042.1| hydroxymethylbilane synthase [Azospirillum sp. B510]
          Length = 312

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 134/307 (43%), Positives = 175/307 (57%), Gaps = 2/307 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEI 58
           M   P RIGTR SPLALA A ETR  L+  H     P  I I+   T GDRI +RTL E 
Sbjct: 1   MTTHPLRIGTRGSPLALAQAHETRDRLIAAHPHLAAPGAIEIVVFKTTGDRILDRTLAEA 60

Query: 59  GGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSL 118
           GGKGLFT+E+E+ L  G  D AVHS KD+PT+L  GL+I+  LPRED RD F S +   L
Sbjct: 61  GGKGLFTKELEEALFDGRADLAVHSMKDVPTQLPDGLEIATLLPREDPRDAFFSRSGGGL 120

Query: 119 KDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR 178
            DL   +V+GT+ LRR+A +L  R D+ +   RG ++TRL+KL+  +  A LLA AG++R
Sbjct: 121 ADLPAGAVVGTAGLRRQAQVLELRPDLRIFPLRGNVQTRLSKLDAGEVDATLLALAGLRR 180

Query: 179 LKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLA 238
           L     I  +L  E   P+  QGAI IE    +   + L+  +N  +T   V  ERA LA
Sbjct: 181 LGLTGRISAVLEPETMLPAVAQGAIGIEIRSADDATRALLAPLNCAETMVRVTAERALLA 240

Query: 239 ELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRF 298
            LDGSC++ IA  A   G  L+    VL+ DG+      R G   +A ++G DA   IR 
Sbjct: 241 ALDGSCRTPIAALALLDGDALHLRAKVLSCDGRSIFRAERRGKAANAESLGADAGAEIRA 300

Query: 299 ISNKNVF 305
               + F
Sbjct: 301 QLPPDFF 307


>gi|269215203|ref|ZP_05987933.2| hydroxymethylbilane synthase [Neisseria lactamica ATCC 23970]
 gi|269208048|gb|EEZ74503.1| hydroxymethylbilane synthase [Neisseria lactamica ATCC 23970]
          Length = 326

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 105/305 (34%), Positives = 167/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K   I +R S LA+  A   +  L  ++  P   + I+ ++T+GDRI +RTL+++GG
Sbjct: 16  MNPKKLVIASRESLLAMWQAKHIQGRLKALY--PDCEVEILGMTTRGDRILDRTLSKVGG 73

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L  G  D AVHS KD+P  L +G  ++A   R +  D F+S+    L++
Sbjct: 74  KGLFVKELEQALQDGRADLAVHSIKDVPMDLPEGFALAAIGERANPFDAFVSNRYARLEE 133

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           +   +V+GTSSLRR+A L      +++   RG ++TRL+KL+N +  AI+LA AG++RL+
Sbjct: 134 MPESAVVGTSSLRREAQLRARYPHLAIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLE 193

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I+ IL+  D  P+ GQGA+ IE   +     E++K +NH  T   V  ERA    L
Sbjct: 194 LDGRIRMILSESDSLPAAGQGALGIEIAAHREDLYEVLKPLNHGVTNACVTAERALARAL 253

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC+  +A +   +   L   G+V   DG +            A  +GR  A+ +    
Sbjct: 254 GGSCQVPLAAYCTEENGLLTLRGLVGHPDGSVILRADAQAPAGYADALGRAVAKKLADDG 313

Query: 301 NKNVF 305
            + + 
Sbjct: 314 ARELI 318


>gi|33861052|ref|NP_892613.1| porphobilinogen deaminase [Prochlorococcus marinus subsp. pastoris
           str. CCMP1986]
 gi|39931394|sp|Q7V2I1|HEM3_PROMP RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|33639784|emb|CAE18954.1| Porphobilinogen deaminase [Prochlorococcus marinus subsp. pastoris
           str. CCMP1986]
          Length = 316

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 96/308 (31%), Positives = 156/308 (50%), Gaps = 5/308 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M K   +I +R S LA+      +  L     IP   + I  ++T+GD+I +  L +IG 
Sbjct: 1   MTKFKLKIASRRSKLAMVQTLWVKEQLEK--NIPDLEVSIEAMATQGDKILDVALAKIGD 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK- 119
           KGLFT+E+E +++ G  D AVHS KD+PT L  GL +     RED  D  + +    +  
Sbjct: 59  KGLFTKELEAQMLVGHADIAVHSLKDLPTNLPDGLTLGCITKREDPSDALVVNKKNKIYQ 118

Query: 120 --DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
              L   S++GTSSLRR A L      +   D RG + TR+ KL++ +   I+LA AG+K
Sbjct: 119 LESLPPGSIVGTSSLRRLAQLRYKFPHLDFKDIRGNVITRIEKLDSGEFDCIILAAAGLK 178

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL  E  + +I+  E    + GQGA+ IE   ++ +  +++ V+  + +      ER+FL
Sbjct: 179 RLGFESRVHQIIPNEISLHAVGQGALGIECKSDDKEVLKIISVLEDKVSSQRCLAERSFL 238

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            EL+G C+  I   +  +   +   G+V + DGK   +    GN      +G+  A+ ++
Sbjct: 239 RELEGGCQVPIGVNSSIQNDEIALIGMVASIDGKRLIKNESIGNIKYPEEVGKKLAEKLK 298

Query: 298 FISNKNVF 305
                 + 
Sbjct: 299 LQGADKIL 306


>gi|94676875|ref|YP_588539.1| porphobilinogen deaminase [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
 gi|123384158|sp|Q1LU25|HEM3_BAUCH RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|94220025|gb|ABF14184.1| porphobilinogen deaminase [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
          Length = 311

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 99/305 (32%), Positives = 160/305 (52%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     +I TR SPLA+  A   R+ L+  +  P   I ++P+ T GD I ++ L + GG
Sbjct: 1   MLNNILKIATRQSPLAIWQANYVRNQLLSFY--PTLLIELVPIVTSGDLILDKPLMKAGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           K LF +E+E+ ++    D AVHS KD+     +G+ ++    RED RD FIS    S+  
Sbjct: 59  KRLFIKELEQAMLERRADIAVHSMKDITISFPEGIGLAVLCAREDPRDAFISTHYASIDL 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSS+RR+  L   R D+ + D RG I TRL KL+  +  A++LA AG+KRL 
Sbjct: 119 LPTGAVVGTSSMRRQCQLRERRPDLVMRDLRGNIGTRLEKLDKGEYDALILAAAGLKRLD 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I+ I++  +  P+ GQG I IE  + +     ++  ++H  T   V+ ERA  A+L
Sbjct: 179 LAHRIRMIIDPTELLPAVGQGVIGIEYRLEDTHILSILAPLHHSATALRVSAERAMNAKL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G  ++   +V + DG +            A  +G+  A  + +  
Sbjct: 239 AGGCQVPIGSYAEIEGDQIWLRALVGSPDGSLIIRSEGRAPLSQAEILGQSIANDLLYRG 298

Query: 301 NKNVF 305
            +++ 
Sbjct: 299 AESIL 303


>gi|253991598|ref|YP_003042954.1| porphobilinogen deaminase [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253783048|emb|CAQ86213.1| porphobilinogen deaminase [Photorhabdus asymbiotica]
          Length = 313

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 108/305 (35%), Positives = 165/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLA+  A   +  L   +  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MSTKTIRIATRQSPLAMWQALYVQQKLQQFY--PDLEVQLVPMVTQGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     R+D RD F+S    SL +
Sbjct: 59  KGLFVKELELALLEGRADIAVHSMKDVPISFPEGLGLVTICERDDPRDAFVSAKYHSLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+++ D RG + TRL+KL+N    AI+LA AG+KRL+
Sbjct: 119 LPTGSIVGTSSLRRQCQLRELRPDLTIRDLRGNVGTRLSKLDNGHYDAIILAVAGLKRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I+  L+ +   P+ GQGA+ IE  +++ + + L+  +NH DT   V  ER     L
Sbjct: 179 LHDRIRTPLSAKQLLPAVGQGAVGIECRLDDQQTRALLAPLNHYDTEICVLAERTMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +   ++   +V A DG +     R     DA   G + A+ +    
Sbjct: 239 EGGCQVPIGSYAIWQDGKIWLRALVGAPDGSVIIRGERTVLPKDACQAGLELAEELLERG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|224826001|ref|ZP_03699104.1| porphobilinogen deaminase [Lutiella nitroferrum 2002]
 gi|224601638|gb|EEG07818.1| porphobilinogen deaminase [Lutiella nitroferrum 2002]
          Length = 311

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 108/301 (35%), Positives = 166/301 (55%), Gaps = 2/301 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
              I +R S LA+  A   ++ L  ++  P   + I+ ++T+GD+I ++TL++IGGKGLF
Sbjct: 3   KIVIASRESKLAMWQAEHIKARLEQLY--PQLAVEILGMTTQGDQILDKTLSKIGGKGLF 60

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +E+E  L  G  D AVHS KD+P  L +G  ++A   RED RD F+S+T  SL +L   
Sbjct: 61  VKELELALQEGRADLAVHSIKDVPMNLPEGFALAAICEREDPRDAFVSNTYASLSELPDG 120

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           +V+GTSSLRR++ L      +++   RG ++TRL KL++ +  AI+LA AG+KRL+    
Sbjct: 121 AVVGTSSLRRESQLRARFPRLTIKPLRGNVQTRLRKLDDGEFDAIILAAAGLKRLELSAR 180

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I+  L   +  P+ GQGA+ IE   +     +L+  ++H DT   V+ ERA    L GSC
Sbjct: 181 IRCELAPSESLPAVGQGALGIEIRADRADLMQLLAPLDHADTHACVSAERALSRVLGGSC 240

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           +  + GFA      +   G V   DG +    S +  R  A  +GR  AQ +       +
Sbjct: 241 QIPLGGFATLSDDVITLGGFVAHPDGSVMLTASASAPREYADALGRAVAQKLLDAGAAPL 300

Query: 305 F 305
            
Sbjct: 301 I 301


>gi|318041172|ref|ZP_07973128.1| porphobilinogen deaminase [Synechococcus sp. CB0101]
          Length = 317

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 105/309 (33%), Positives = 153/309 (49%), Gaps = 5/309 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI +R S LA+      R  L   H+     I I  ++T+GD+I +  L +IG 
Sbjct: 1   MAASQLRIASRRSQLAMVQTHWVRDELAKAHE--GLEITIEAMATQGDKILDVALAKIGD 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFI---SHTAQS 117
           KGLFT+E+E +++    D AVHS KD+PT L +GL +     RED  D  +    H  ++
Sbjct: 59  KGLFTKELEAQMLVDRADIAVHSLKDLPTNLPEGLMLGCITEREDPADALVVHEKHKDKT 118

Query: 118 LKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           L  L   SV+GTSSLRR A L      ++  D RG + TRL KL++ +   ++LA AG+ 
Sbjct: 119 LATLPEGSVVGTSSLRRLAQLRHHFPHLTFKDVRGNVITRLEKLDSGEFDCLILAAAGLG 178

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL     I E+++      + GQGA+ IE    +    E +KV+ H  T      ERAFL
Sbjct: 179 RLGLGDRIHELIDPSISLHAVGQGALGIECREGDTAVLEQIKVLEHLPTARRCLAERAFL 238

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            EL+G C+  I      +G  L   G+V + DG+        G++ D   IG   A  +R
Sbjct: 239 RELEGGCQVPIGVNTRFEGDELVLTGMVASLDGQRLIRDEARGDQKDPEAIGIALAHALR 298

Query: 298 FISNKNVFN 306
                 +  
Sbjct: 299 AQGAGEILE 307


>gi|251773212|gb|EES53764.1| porphobilinogen deaminase [Leptospirillum ferrodiazotrophum]
          Length = 321

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 111/302 (36%), Positives = 160/302 (52%), Gaps = 4/302 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P RIGTR S LAL  A    + +            +  + T GD I +  L+++GGKGLF
Sbjct: 9   PIRIGTRGSELALWQARHVAAMIR---HTAGLESELTIIKTTGDMILSVPLSQVGGKGLF 65

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +EIE+ LI+G ID AVHS KD+P  L +GL+I A L RED RD F+S+   S   L   
Sbjct: 66  VKEIEEALIAGTIDLAVHSMKDVPAFLPEGLEIGAILSREDPRDAFVSNAYSSFSSLPPG 125

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           + IGTSSLRR A L + R D+     RG + TRL KL+ N+  AI+LA AG+ RL     
Sbjct: 126 ARIGTSSLRRMAQLKKRRPDLRFESLRGNVGTRLRKLDENQIDAIILAAAGLIRLGFSDR 185

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I+E L +E   P+ GQGA+ +E    + + + ++  ++  +T   V  ER  L+ LDG C
Sbjct: 186 IREYLPVELSLPAVGQGALGLECRTGDHRIRTILARMHDPETTACVLAERGVLSALDGGC 245

Query: 245 KSAIAGFAY-CKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKN 303
           +  IA  A       +     +L  +G    E   +G   +A  +G +AAQ +     + 
Sbjct: 246 QLPIAAHARTISPEQIELIARILDVEGTTLLEEHTSGPAKEAHRLGVEAAQKLLSRGGQK 305

Query: 304 VF 305
           + 
Sbjct: 306 IL 307


>gi|212633296|ref|YP_002309821.1| porphobilinogen deaminase [Shewanella piezotolerans WP3]
 gi|212554780|gb|ACJ27234.1| Porphobilinogen deaminase [Shewanella piezotolerans WP3]
          Length = 294

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 104/290 (35%), Positives = 161/290 (55%), Gaps = 2/290 (0%)

Query: 17  LAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEEIEKKLISGE 76
           +  A   ++ L  +H+     + ++P+STKGD I +  L ++GGKGLF +E+E  ++   
Sbjct: 1   MWQAEFVKAELEKIHE--GLTVELLPMSTKGDIILDTPLAKVGGKGLFVKELEVAMLEDR 58

Query: 77  IDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVIGTSSLRRKA 136
            D AVHS KD+P    +GL +     RED RD F+S+   S+ +L   +V+GTSSLRR+ 
Sbjct: 59  ADIAVHSMKDVPVDFPEGLGLEVICEREDPRDAFVSNNFSSINELPQGAVVGTSSLRRQC 118

Query: 137 LLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKEILNIEDFPP 196
            +   R D+ + D RG + TRL KL+     AI+LA AG+KRLK E+ I   ++ ED  P
Sbjct: 119 QIRAARPDLQIKDLRGNVGTRLAKLDAGNYDAIILAAAGLKRLKLEERITSFISAEDSLP 178

Query: 197 SPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKSAIAGFAYCKG 256
           + GQGA+ IE   ++ + + L+  + H +T   V  ERA    L+G C+  I  +A   G
Sbjct: 179 ANGQGAVGIECRTDDARVKALLAPLEHLETRQRVIAERAMNTRLEGGCQVPIGAYAEIDG 238

Query: 257 STLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVFN 306
            TL   G+V   DG    E + +GN+ DA  +G   A+ +     K + +
Sbjct: 239 DTLSLRGLVGNPDGSQVIEAATSGNKNDAEQLGVALAEELLSKGAKTILD 288


>gi|188996629|ref|YP_001930880.1| porphobilinogen deaminase [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188931696|gb|ACD66326.1| porphobilinogen deaminase [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 310

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 107/306 (34%), Positives = 176/306 (57%), Gaps = 8/306 (2%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
             RIGTR S LAL  A      L ++H      + ++ ++T+GD+I +  L +IGGKGLF
Sbjct: 2   KIRIGTRKSQLALWQANYIADRLREIH---GIEVELVKITTQGDKILDVPLAKIGGKGLF 58

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +EIE  L+  EID AVHS KD+PT L +GL++ A   RED RD F+S   +++  L  +
Sbjct: 59  VKEIEDALLRNEIDIAVHSLKDVPTVLPEGLELIAITEREDPRDAFLSIRYENIYQLPEN 118

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           +VIGTSSLRRK+ +++ R D+ + D RG ++TR+ KL   +  AI+LAYAG+KRL  +  
Sbjct: 119 TVIGTSSLRRKSQIMKIRKDLQIKDLRGNVDTRIRKLEEGQYDAIILAYAGLKRLGLDSK 178

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           +K I + ++  P+  QG + IE   ++ + + L+K +NH +++     ER+FL  L+G C
Sbjct: 179 VKYIFSPDEMIPAVCQGFLAIEGRSDDERIKNLIKPLNHYESYLRATAERSFLKTLEGGC 238

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSR-----NGNRCDAINIGRDAAQYIRFI 299
           +  +  +   K ++    G +   +GK +++           +  AI +G+  A+ +   
Sbjct: 239 QVPLGAYCEIKENSFIITGFIADLEGKEYYQEKMIEQIKENPQEQAIILGKTLAEKLLND 298

Query: 300 SNKNVF 305
             K + 
Sbjct: 299 GGKQIL 304


>gi|297583719|ref|YP_003699499.1| porphobilinogen deaminase [Bacillus selenitireducens MLS10]
 gi|297142176|gb|ADH98933.1| porphobilinogen deaminase [Bacillus selenitireducens MLS10]
          Length = 312

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 110/308 (35%), Positives = 175/308 (56%), Gaps = 7/308 (2%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +   +G+R S LA+       S L  +    P    I  ++T+GD I + TL+++GG
Sbjct: 1   MT-RTITLGSRRSNLAMTQTRWVISELEKLGL--PFQFEIKEITTRGDEILDVTLSKVGG 57

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE+ + +GEID AVHS KD+P+   +GL +++   R D RD  IS++ ++L +
Sbjct: 58  KGLFVKEIEQAMHNGEIDMAVHSMKDVPSTRSEGLVLASVPKRYDPRDALISNSGKTLME 117

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR + +L  R D+ +   RG I+TRL K       AI+LA AG++R+ 
Sbjct: 118 LPAGSIVGTSSLRRGSQVLAKRPDLEIQWIRGNIDTRLRKCREENFDAIILAAAGLERVG 177

Query: 181 K-EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
             E ++ E L+ +   P+ GQGA+ +E   ++ + +EL+  INHE T  +V  ERAFL  
Sbjct: 178 WTEDIVTEFLDPDLCLPAVGQGALGLECREDDYELRELLAHINHEQTAITVAAERAFLRT 237

Query: 240 LDGSCKSAIAGFAYCKG-STLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRF 298
           ++G C+  I  +A     + ++   +V ++DGK   + S  G   D   IG + A+ I  
Sbjct: 238 VEGGCQVPIGAYATLDEQNQIHLTALVASTDGKQVFKESIIG--EDPEYIGTEVAERILR 295

Query: 299 ISNKNVFN 306
              K V +
Sbjct: 296 QGAKGVLD 303


>gi|118602764|ref|YP_903979.1| porphobilinogen deaminase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
 gi|226740639|sp|A1AX51|HEM3_RUTMC RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|118567703|gb|ABL02508.1| porphobilinogen deaminase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 304

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 105/304 (34%), Positives = 166/304 (54%), Gaps = 2/304 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
             K  +I TR SPLAL  A   +  L   H  P   ++++ ++TKGD+I N  L++IGGK
Sbjct: 1   MNKTLKIATRQSPLALWQAQNVKIRLEKHH--PDLTVILVEMTTKGDQILNSPLSKIGGK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  ++ G  D AVHS KD+P ++ +G ++ A L RE+  D F+S+   S+ DL
Sbjct: 59  GLFIKELEVSMMKGITDIAVHSMKDVPYEIPQGFKLGAILKRENPFDAFVSNDFSSIDDL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
             ++ +GT S+RR   L   R D+ ++D RG + TRL KL+      I+LA AG+ RL  
Sbjct: 119 PQNAKVGTCSIRRIVQLKAIRPDLKILDLRGNVNTRLKKLDKGGFDGIILACAGLIRLGF 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E  IK+ ++ +   P+ GQG + IE   N+ +  +L+K +   +T   V+ ERA  A L+
Sbjct: 179 ESRIKQQISDQQSLPAVGQGVVGIEIRENDTEILDLIKPLIDVETTYMVSAERAMNARLE 238

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C   IAGFA      +   G+V   D  +  +     +   A  +G + A  +  +  
Sbjct: 239 GGCSVPIAGFALIDNEQIMLTGLVGNVDTGVILKEQILSHVSQAEALGVELANKLISLGA 298

Query: 302 KNVF 305
           K++ 
Sbjct: 299 KDIL 302


>gi|269798482|ref|YP_003312382.1| porphobilinogen deaminase [Veillonella parvula DSM 2008]
 gi|282849932|ref|ZP_06259315.1| hydroxymethylbilane synthase [Veillonella parvula ATCC 17745]
 gi|269095111|gb|ACZ25102.1| porphobilinogen deaminase [Veillonella parvula DSM 2008]
 gi|282580369|gb|EFB85769.1| hydroxymethylbilane synthase [Veillonella parvula ATCC 17745]
          Length = 312

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 107/301 (35%), Positives = 169/301 (56%), Gaps = 2/301 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LAL  A    + L  ++  P   + ++  +TKGDRI  + L ++GGKGLFT
Sbjct: 5   IRIGTRKSALALWQAEHISAELQRLY--PNITVELVHFNTKGDRILEKPLAQVGGKGLFT 62

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
            E+E+ + +G+ID AVHS KDMPT+L +GL + A   RE   D  +S   ++L  L   +
Sbjct: 63  AELEEAMHAGDIDIAVHSLKDMPTELPEGLTLGAISAREVPYDALVSPVYKTLDKLPQGA 122

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+A LL  R D+ V   RG ++TRL+K+   K   ++LA AG+KRL  E  I
Sbjct: 123 RVGTSSLRRQAQLLHVRPDLKVEVIRGNVQTRLSKIETEKLDGVILAQAGLKRLGLEDQI 182

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            ++   ++  P+ GQGA+ IE   ++ +  +++  IN E T  +V  ER+FL +L+G C+
Sbjct: 183 TQVFKADEMIPAVGQGALAIECRADDTEMLDMLDPINDEATRYAVEGERSFLRQLNGGCQ 242

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             +          L    ++ + DGK  +E   +G       +G++ A+ +     K + 
Sbjct: 243 VPMGVHGTINKGQLTLKAMIASLDGKTVYEGEISGPAKKGEILGKNLAKALYEEGGKRIV 302

Query: 306 N 306
           +
Sbjct: 303 D 303


>gi|16330297|ref|NP_441025.1| porphobilinogen deaminase [Synechocystis sp. PCC 6803]
 gi|2495177|sp|P73660|HEM3_SYNY3 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|1652786|dbj|BAA17705.1| porphobilinogen deaminase [Synechocystis sp. PCC 6803]
          Length = 320

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 103/304 (33%), Positives = 157/304 (51%), Gaps = 5/304 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
             RIG+R S LAL   +  +  L      P     +  + T+GD+I +  L +IG KGLF
Sbjct: 9   TVRIGSRKSQLALVQTYWVQEELQK--HFPDRQFDVETMETQGDKILDVALAKIGDKGLF 66

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL--- 121
           T+E+E  ++    D AVHS KD+PT L  GL +     R +  D  + +     KDL   
Sbjct: 67  TQELEDGMLGKRTDLAVHSLKDLPTNLPAGLMLGCVTKRVNPADALVLNAKHQGKDLASL 126

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +VIGTSSLRR A L      ++  D RG + TRL KL++N+  AI+LA AG++RL  
Sbjct: 127 PEGAVIGTSSLRRLAQLRYHFPHLTFKDVRGNVNTRLAKLDSNEYDAIILAAAGLERLDM 186

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
              I +++  E    + GQGA+ IE    + +   L+KV+  E++ D    ERAFL +L+
Sbjct: 187 ANRIDQLIPPEISLHAVGQGALGIECREGDQEILSLLKVLEDENSRDRCLAERAFLRQLE 246

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I    +  G  L   G+V + DG+   + + +  R +A  +G+D A  +R    
Sbjct: 247 GGCQVPIGVNTHLDGDNLTLTGMVASLDGQRLIKDTLSAPRKEAEKLGQDLALKLREQGA 306

Query: 302 KNVF 305
             + 
Sbjct: 307 GEIL 310


>gi|225023639|ref|ZP_03712831.1| hypothetical protein EIKCOROL_00499 [Eikenella corrodens ATCC
           23834]
 gi|224943521|gb|EEG24730.1| hypothetical protein EIKCOROL_00499 [Eikenella corrodens ATCC
           23834]
          Length = 312

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 110/305 (36%), Positives = 163/305 (53%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M      I +R S LA+  A   +S L  ++  P   + I+ L+T+GDRI ++TL++IGG
Sbjct: 1   MIPHKLVIASRESALAMWQAEHIQSRLRTLY--PGCEVSILGLTTQGDRILDKTLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L  G  D AVHS KD+P  L +G  ++A   RE   D F+S+  Q L+D
Sbjct: 59  KGLFVKELEQALSDGRADLAVHSIKDVPMVLPEGFALAAICERESPFDAFVSNNYQRLED 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+A L      + V   RG ++TRL KL+     AI+LA AG+KRL 
Sbjct: 119 LPAGAVVGTSSLRREAQLRARFPQLQVAPLRGNVQTRLAKLDQGDYAAIILAEAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I+  L+  D  P+ GQGA+ IE   +  +   L+  +NH  T   V  ERA    L
Sbjct: 179 LTQRIRHTLSPADSLPAAGQGALGIEIAAHRSELLPLLAPLNHAQTAACVTAERALARAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC+  +A +   +   L  +G+V   DG +         R  A  +GR  A+ +    
Sbjct: 239 GGSCQVPLAAYCTKQDGLLTLHGLVGHPDGSVILREEAQAPREYADALGRAVAKKLADNG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AQELI 303


>gi|240112249|ref|ZP_04726739.1| porphobilinogen deaminase [Neisseria gonorrhoeae MS11]
 gi|268598310|ref|ZP_06132477.1| porphobilinogen deaminase [Neisseria gonorrhoeae MS11]
 gi|268582441|gb|EEZ47117.1| porphobilinogen deaminase [Neisseria gonorrhoeae MS11]
          Length = 311

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 106/305 (34%), Positives = 169/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K   I +R S LA+  A   +  L  ++  P   + I+ ++T+GDRI +RTL+++GG
Sbjct: 1   MNPKKLVIASRESLLAMWQAKHIQGRLKALY--PDCEVEILGMTTRGDRILDRTLSKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L  G  D AVHS KD+P  L +G  ++A   R +  D F+S+    L++
Sbjct: 59  KGLFVKELEQALQDGRADLAVHSIKDVPMDLPEGFALAAISERANPFDAFVSNRYARLEE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           +   +V+GTSSLRR+A L      + +   RG ++TRL+KL+N +  AI+LA AG++RL+
Sbjct: 119 MPEGAVVGTSSLRREAQLRARYPHLLIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            ++ I+ IL+  D  P+ GQGA+ IE   +     E++K +NH+ T   V  ERA    L
Sbjct: 179 LDERIRMILSESDSLPAAGQGALGIEIATHREDLYEVLKPLNHDTTHACVTAERALARAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC+  +A +   +   L   G+V   DG I  +         A  +GR  A+ +    
Sbjct: 239 GGSCQVPLAAYCTEENGLLILRGLVGHPDGSIVLQADAQAPAGYADALGRAVAKKLADDG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AQELI 303


>gi|296136292|ref|YP_003643534.1| porphobilinogen deaminase [Thiomonas intermedia K12]
 gi|294340528|emb|CAZ88912.1| Porphobilinogen deaminase (PBG) (Hydroxymethylbilane synthase)
           (HMBS) (Pre-uroporphyrinogen synthase) [Thiomonas sp.
           3As]
 gi|295796414|gb|ADG31204.1| porphobilinogen deaminase [Thiomonas intermedia K12]
          Length = 317

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 101/303 (33%), Positives = 160/303 (52%), Gaps = 5/303 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
             I TR S LAL  A   R  L  ++  P  ++ I  ++T+GD+I +++L +IGGKGLF 
Sbjct: 11  LVIATRESRLALWQAEHVRDLLKGLY--PQCDVRIFGMTTQGDQILDKSLAKIGGKGLFV 68

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  +  G  D AVHS KD+P  L  G  ++A + RED RD ++S    +L DL   +
Sbjct: 69  KELEVAMEQGHADLAVHSLKDVPMVLPTGFALTAVMEREDPRDAWVSPHYANLADLPAGA 128

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+GTSSLRR++ L      + V   RG ++TRL KL+  +   ILLA AG+KRL   + +
Sbjct: 129 VVGTSSLRRESQLRARYPHLKVQALRGNLDTRLRKLDEGQYAGILLAAAGLKRLGLGERV 188

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           + ++  ED  P+ GQ A+ IE   + P   + +  +NH  T    + ERA    L GSC 
Sbjct: 189 RAVIEPEDMLPAVGQAALGIEIRADRPDLAQALAALNHPPTALCTHAERAVSRGLGGSCT 248

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNG---NRCDAINIGRDAAQYIRFISNK 302
           + +  +A  +G  ++   ++   DG       + G   +   A  +G+  A+ +R     
Sbjct: 249 TPMGAYATLEGEAMHLRAVLGLPDGSQALHAQQRGRVTDLAQAEALGQQVARQLREQGAD 308

Query: 303 NVF 305
            + 
Sbjct: 309 ALL 311


>gi|237756363|ref|ZP_04584911.1| porphobilinogen deaminase [Sulfurihydrogenibium yellowstonense
           SS-5]
 gi|237691477|gb|EEP60537.1| porphobilinogen deaminase [Sulfurihydrogenibium yellowstonense
           SS-5]
          Length = 310

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 106/306 (34%), Positives = 174/306 (56%), Gaps = 8/306 (2%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
             RIGTR S LAL  A      L ++H      + ++ ++T+GD+I +  L +IGGKGLF
Sbjct: 2   KIRIGTRKSQLALWQANYIADRLREIH---GVEVELVKITTQGDKILDVPLAKIGGKGLF 58

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +EIE  L+  EID AVHS KD+PT L +GL++ A   RED RD F+S   + +  L  +
Sbjct: 59  VKEIEDALLKNEIDIAVHSLKDVPTVLPEGLELIAITEREDPRDAFLSIKHEHIYQLPEN 118

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           +VIGTSSLRRK+ +++ R D+ + D RG ++TR+ KL   +  AI+LAYAG+KRL  +  
Sbjct: 119 AVIGTSSLRRKSQIMKIRKDLQIKDLRGNVDTRIRKLEEGQYDAIILAYAGLKRLGLDGK 178

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           +K I + ++  P+  QG + IE   ++ + + L+K +NH +++     ER+FL  L+G C
Sbjct: 179 VKYIFSPDEMIPAVCQGFLAIEGRSDDERIKNLIKPLNHYESYLRATAERSFLKTLEGGC 238

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNR-----CDAINIGRDAAQYIRFI 299
           +  +  +   K ++    G +   +G+ +++              AI +G+  A+ +   
Sbjct: 239 QVPLGAYCEIKENSFIITGFIADLEGREYYQEKITEQIKENTQEQAIILGKTLAEKLLND 298

Query: 300 SNKNVF 305
             K + 
Sbjct: 299 GGKQIL 304


>gi|83590097|ref|YP_430106.1| porphobilinogen deaminase [Moorella thermoacetica ATCC 39073]
 gi|123766782|sp|Q2RJ26|HEM3_MOOTA RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|83573011|gb|ABC19563.1| hydroxymethylbilane synthase [Moorella thermoacetica ATCC 39073]
          Length = 313

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 116/300 (38%), Positives = 164/300 (54%), Gaps = 2/300 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            ++G+R S LA   A     +L      P  +  ++ L TKGD+I +  L  IG KGLFT
Sbjct: 4   IKVGSRESELARWQARWVIQALEKA--WPGLSCRLVTLKTKGDKILDVALARIGDKGLFT 61

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+ G ID AVHS KDMPT L +GL I A  PRED  DV +S    +L  L + +
Sbjct: 62  KELELALLDGAIDLAVHSMKDMPTTLPEGLVIGAIGPREDPADVLVSPEGYTLATLPIKA 121

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRRKA L   R D+ ++D RG + TRL K+  +   AI+LA AG+KRL   +V+
Sbjct: 122 RVGTSSLRRKAQLAYARPDLELVDLRGNVPTRLAKMERDGLTAIVLAAAGLKRLNHGQVL 181

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            E +      P+ GQGAI +E    + +  ELV  INH  T  +V  ERA+L  L+G C+
Sbjct: 182 GEPIPYHICLPAVGQGAIGVEIRAGDRRVAELVAAINHPPTAAAVRAERAYLRALEGGCQ 241

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             IA  A  + + L   G+V + DG+       +G+  D    GR+ A+ +       + 
Sbjct: 242 VPIAALATVEDTALVLQGMVASLDGREMLRDIASGSTRDPEAAGRELARKLLARGAGEIL 301


>gi|283851270|ref|ZP_06368553.1| porphobilinogen deaminase [Desulfovibrio sp. FW1012B]
 gi|283573439|gb|EFC21416.1| porphobilinogen deaminase [Desulfovibrio sp. FW1012B]
          Length = 310

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 105/305 (34%), Positives = 162/305 (53%), Gaps = 2/305 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            ++   I TR S LAL  A    + L + +  P   + ++P+ TKGD+I +  L ++GGK
Sbjct: 1   MREKLVIATRSSKLALWQANHVSARLRETY--PGLVVDLLPIKTKGDKILDVPLAKVGGK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +EIE+ L+ G  D AVHS KD+P +  +GL +     RED  D  +S        L
Sbjct: 59  GLFVKEIEEALLDGRADLAVHSMKDVPAEQPQGLVVGIVPEREDPCDTLLSVAYAGFAAL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              + +GTSSLRRKA L+  R D+S+ID RG ++TR+ KL +    AI++A AG+ RL  
Sbjct: 119 PAGARVGTSSLRRKAQLMALRPDLSIIDLRGNLDTRVGKLLDGLFDAIVVATAGLNRLGL 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
                  L   +F P+  QGA+ +E   ++P+   ++   +H ++ D+V  ER FLA L+
Sbjct: 179 TAPQAVRLGPPEFLPAAAQGALGLEYRTDDPETAAMLAFFDHPESRDAVAAERGFLARLE 238

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  IA  A   G  L   G+V   +       +  G R +A  +G+  A+ +  +  
Sbjct: 239 GGCQVPIAAHATIDGDALALDGLVADPETGQTFRGNVTGKRSEARALGQGLAESVLAMGA 298

Query: 302 KNVFN 306
           K V  
Sbjct: 299 KAVLE 303


>gi|296314908|ref|ZP_06864849.1| hydroxymethylbilane synthase [Neisseria polysaccharea ATCC 43768]
 gi|296838093|gb|EFH22031.1| hydroxymethylbilane synthase [Neisseria polysaccharea ATCC 43768]
          Length = 311

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 105/305 (34%), Positives = 167/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K   I +R S LA+  A   +  L  ++  P   + I+ ++T+GDRI +RTL+++GG
Sbjct: 1   MNPKKLVIASRESLLAMWQAKHIQGRLKALY--PDCKVEILGMTTRGDRILDRTLSKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L  G  D AVHS KD+P  L +G  ++A   R +  D F+S+    L++
Sbjct: 59  KGLFVKELEQALQDGRADLAVHSIKDVPMDLPEGFALAAIGERANPFDAFVSNRYARLEE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           +   +V+GTSSLRR+A L      +++   RG ++TRL+KL+N +  AI+LA AG++RL+
Sbjct: 119 MPESAVVGTSSLRREAQLRARYPHLAIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I+ IL+  D  P+ GQGA+ IE   +     E++K +NH  T   V  ERA    L
Sbjct: 179 LDGRIRMILSESDSLPAAGQGALGIEIAAHREDLYEVLKPLNHGVTNACVTAERALARAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC+  +A +   +   L   G+V   DG +            A  +GR  A+ +    
Sbjct: 239 GGSCQVPLAAYCTEENGLLTLRGLVGHPDGSVILRADAQAPAGYADALGRAVAKKLADDG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 ARELI 303


>gi|155967344|gb|ABU41508.1| HemC [Heliophilum fasciatum]
          Length = 315

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 105/304 (34%), Positives = 165/304 (54%), Gaps = 3/304 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            +P  IGTR S LAL         L    + P     I  + TKGD+I +  L +IG KG
Sbjct: 5   NRPIVIGTRDSALALWQTHWVLEQLQA--RFPEQRFEIKAIKTKGDKILDVALAKIGDKG 62

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT+E+E  ++ GE+D AVHS KD+PT+L +GL + A   RED RDV I  TA++L +L 
Sbjct: 63  LFTKELEVAMLEGEVDMAVHSLKDLPTQLPEGLTVGAMCIREDYRDVLIGRTARTLAELK 122

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GT+SLRRK+ + + R D+ ++D RG ++TR+ K+       I+LA AG+ RL   
Sbjct: 123 PGARVGTASLRRKSQIWKVRPDLELLDIRGNLQTRMRKMEEQDLDGIILAAAGVLRLGWA 182

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I + ++ +   P+ GQG++ IE    +     +V  +NH+DT D +  ERA +  L+G
Sbjct: 183 DKITQYIDEDVCLPAVGQGSVGIEIRDGDEAIARVVGALNHKDTADCITAERALMRTLEG 242

Query: 243 SCKSAIAGFAYC-KGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
            C+  I       +  +L  +G+V + DG+        G+R +A ++G   A  +     
Sbjct: 243 GCQVPIGALGKLGEDDSLTLHGVVASLDGREICRDQVTGHRSEAADLGHRLADILIAKGA 302

Query: 302 KNVF 305
             + 
Sbjct: 303 AEIL 306


>gi|294670387|ref|ZP_06735269.1| hypothetical protein NEIELOOT_02105 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307851|gb|EFE49094.1| hypothetical protein NEIELOOT_02105 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 312

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 105/306 (34%), Positives = 169/306 (55%), Gaps = 3/306 (0%)

Query: 1   MEK-KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M   K   I +R S LA+  A   +  L  ++  P   + I+ ++T+GD+I +RTL++IG
Sbjct: 1   MNTPKKLVIASRESMLAMWQAEHIKGRLKALY--PDCEVEILGMTTRGDQILDRTLSKIG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E+ L  G  D AVHS KD+P +L +G  ++A   R    D F+S+    L+
Sbjct: 59  GKGLFIKELEQALQDGRADLAVHSIKDVPMELPEGFALAAIGERASPFDAFVSNQYARLE 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           ++   +++GTSSLRR+A L      +++   RG ++TRL+KL+N    A++LA AG++RL
Sbjct: 119 EMPEGAIVGTSSLRREAQLRAKFPHLTIQPLRGNVQTRLSKLDNGDYDAVILAAAGLQRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
             +  I+EIL+  D  P+ GQGA+ IE         ++++ +NHE+T   V  ERA    
Sbjct: 179 GLDSRIREILSPADSLPAAGQGALGIEIAARRTDLADILRPLNHEETAACVTAERALARA 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           L GSC+  +A +   +   L   G+V   DG +  E S       A  +GR  A+ +   
Sbjct: 239 LGGSCQVPLAAYCVMEDGLLTLNGLVGHPDGSVIIEASAQAPDAYANALGRAVAKRLADD 298

Query: 300 SNKNVF 305
             + + 
Sbjct: 299 GAEELI 304


>gi|88770654|gb|ABD51930.1| chloroplast hydroxymethylbilane synthase [Guillardia theta]
          Length = 346

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 125/310 (40%), Positives = 187/310 (60%), Gaps = 5/310 (1%)

Query: 1   MEKKP-FRIGTRCSPLALAHAFETRSSLMDVH----KIPPHNIVIIPLSTKGDRITNRTL 55
           M  +P  ++GTR SPLALA A+ETR  L ++           + I  ++T GD   ++ L
Sbjct: 13  MSGEPVIKLGTRGSPLALAQAYETRRRLAELFPEELGEKGEKVSINIINTSGDMELSKAL 72

Query: 56  TEIGGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTA 115
           +EIGGKGLFT+E++  L+  E+D  VHS KD+PT L  G  + A LPRED RD FIS   
Sbjct: 73  SEIGGKGLFTKELDVALLKKEVDFCVHSMKDVPTYLPDGTHLEAMLPREDTRDAFISPKY 132

Query: 116 QSLKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAG 175
           QS +++   +VIG++SLRR+A +      I  ++FRG ++TRL KL++    A LLA AG
Sbjct: 133 QSFEEMPEGTVIGSASLRRQAQIFAKNPKIKCVNFRGNVQTRLRKLDDEVVDATLLALAG 192

Query: 176 IKRLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERA 235
           +KR+     + ++L+ ++  P+  QGAI I+   ++ K  + +  +NH+DT   V+CER+
Sbjct: 193 LKRMNMADCVTKVLDWDEMLPAVAQGAIGIQVRSDDDKTLKYISALNHKDTKTCVDCERS 252

Query: 236 FLAELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQY 295
           FLA LDGSCK+ IAG A      ++F G+V + DG       R G+  D + IG+DA + 
Sbjct: 253 FLATLDGSCKTPIAGQARIIDGKIHFRGLVASPDGSKIFRAERVGDVSDYMKIGKDAGEE 312

Query: 296 IRFISNKNVF 305
           IR  + +  F
Sbjct: 313 IRKEAGEQFF 322


>gi|294676723|ref|YP_003577338.1| hydroxymethylbilane synthase [Rhodobacter capsulatus SB 1003]
 gi|12280937|gb|AAG50298.1| porphobilinogen deaminase [Rhodobacter capsulatus]
 gi|294475543|gb|ADE84931.1| hydroxymethylbilane synthase [Rhodobacter capsulatus SB 1003]
          Length = 317

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 126/307 (41%), Positives = 179/307 (58%), Gaps = 4/307 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGD----RITNRTLTEIGG 60
           P +IGTR SPLALA AFETRS LM    +P     I+ + T GD       ++ L E+GG
Sbjct: 10  PLKIGTRGSPLALAQAFETRSRLMAAFDLPEEAFEIVVIKTSGDNAALIAADKPLKEVGG 69

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ +++G ID AVHS KDMPT   +GL +  YLPRED RD F+S    SL +
Sbjct: 70  KGLFTKEIEEAMLAGSIDIAVHSMKDMPTLQPEGLILDCYLPREDTRDAFVSMKYNSLAE 129

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+A L   R D+ +++FRG ++TR+ KL    A A  LA AG+ RL 
Sbjct: 130 LPEGAVVGTSSLRRRAQLAARRPDLKMVEFRGNVQTRMKKLGEGVADATFLALAGLNRLG 189

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             +V K  +  ED  P+  QG I IE    + +A+ L+  I+H  +   + CER+FL  L
Sbjct: 190 MSEVAKSAIEPEDMLPAVAQGCIGIERREADTRAKMLLDAIHHAPSGLRLACERSFLLTL 249

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ I G +  +G  ++  G +L  DG         G   D + +G + A+ +   +
Sbjct: 250 DGSCETPIGGLSVLEGDQIWLRGEILRPDGSETITGEIRGPAADGVALGAELAKQLLAKA 309

Query: 301 NKNVFNF 307
             + F +
Sbjct: 310 PADFFCW 316


>gi|155241760|gb|ABT18042.1| porphobilinogen deaminase [Heliobacillus mobilis]
          Length = 314

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 107/308 (34%), Positives = 163/308 (52%), Gaps = 5/308 (1%)

Query: 1   ME--KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEI 58
           M   ++P  IGTR S LAL       + L ++   P     +  + TKGD+I +  L +I
Sbjct: 1   MSVLQRPVVIGTRDSALALWQTNWVMARLKEL--FPEQAFEVKAIKTKGDKILDVALAKI 58

Query: 59  GGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSL 118
           G KGLFT+E+E  ++ GEID AVHS KD+PT L +GL I A   RED RD+ IS     L
Sbjct: 59  GDKGLFTKELEVSMLEGEIDMAVHSLKDLPTVLPEGLTIGAMCVREDCRDILISR-HGGL 117

Query: 119 KDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR 178
             L   + +GT+SLRRKA + + R D+ ++D RG ++TRL K+       ++LA AG+ R
Sbjct: 118 DALPQGARVGTASLRRKAQIWQVRPDLELLDIRGNLQTRLRKMEEQNLDGLILAAAGVIR 177

Query: 179 LKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLA 238
           L   + I + + ++   P+ GQG+I IE    + +  ++V  +NH +T  S+  ERA + 
Sbjct: 178 LGWAEKISQYIPVDMCLPAVGQGSIGIEIREGDDEIAKIVGALNHYETSVSIRAERALMR 237

Query: 239 ELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRF 298
            L+G C+  I      +   L   GIV + DGK        G+      +G   A+ +  
Sbjct: 238 TLEGGCQVPIGSLGRLQEGRLVLDGIVASLDGKHVARGREEGDPSQPEEVGIRLAEQLLQ 297

Query: 299 ISNKNVFN 306
              + + N
Sbjct: 298 QGAREILN 305


>gi|116072875|ref|ZP_01470140.1| porphobilinogen deaminase [Synechococcus sp. BL107]
 gi|116064401|gb|EAU70162.1| porphobilinogen deaminase [Synechococcus sp. BL107]
          Length = 317

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 103/308 (33%), Positives = 154/308 (50%), Gaps = 5/308 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI +R S LA+      ++ L   H  P   I +  ++T+GD+I +  L +IG 
Sbjct: 1   MALTELRIASRRSQLAMVQTNWVKAELEKAH--PGLTITVEAMATQGDKILDVALAKIGD 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+E+E +++ G  D AVHS KD+PT L +GL +     RED  D  + H      +
Sbjct: 59  KGLFTKELEAQMLIGRADIAVHSLKDLPTNLPEGLMLGCITEREDPADALVLHAKNKHLN 118

Query: 121 L---ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           L      +V+GTSSLRR A L      +   D RG + TRL KL++     ++LA AG+ 
Sbjct: 119 LATLPEGAVVGTSSLRRLAQLRHHYPHLEFKDVRGNVITRLEKLDSGAYDCLILAAAGLG 178

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           RL     I + +  +    + GQGA+ IE   N P+  +++KV+ H  T      ERAFL
Sbjct: 179 RLGFADRIDQSIPGDISLHAVGQGALGIECVENKPEVMDIIKVLEHGPTSQRCLAERAFL 238

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            EL+G C+  I      +G  L   G+V + DGK       +G   D  +IG   A  ++
Sbjct: 239 RELEGGCQVPIGVNTRFEGDQLILTGMVASLDGKRLIREKASGPSTDPESIGLALATTLK 298

Query: 298 FISNKNVF 305
            +    + 
Sbjct: 299 GLGAGEIL 306


>gi|295399407|ref|ZP_06809389.1| porphobilinogen deaminase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312110034|ref|YP_003988350.1| porphobilinogen deaminase [Geobacillus sp. Y4.1MC1]
 gi|294978873|gb|EFG54469.1| porphobilinogen deaminase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311215135|gb|ADP73739.1| porphobilinogen deaminase [Geobacillus sp. Y4.1MC1]
          Length = 310

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 116/306 (37%), Positives = 172/306 (56%), Gaps = 6/306 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            +   +G+R S LAL         L  +    P    +  + TKGD+I + TL+++GGKG
Sbjct: 1   MRKIIVGSRRSKLALTQTNWVIEQLRQLGA--PFEFEVKEIVTKGDKILDVTLSKVGGKG 58

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +EIE  +++ EID AVHS KDMP  L  GL I    PRED RDV IS   ++  DL 
Sbjct: 59  LFVKEIEHAMLNNEIDMAVHSMKDMPAVLPDGLIIGCVPPREDHRDVLISKNKETFADLP 118

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +V+GTSSLRR A LL  R D+++   RG I+TRL KL      AI+LA AG+ R+   
Sbjct: 119 SGAVVGTSSLRRSAQLLAKRPDLTIKWIRGNIDTRLAKLQTEDYDAIVLAAAGLVRMGWA 178

Query: 183 -KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
             VI E L  +   P+ GQGA+ +E   ++ + +E ++ +N  DT  +V  ERAFL +L+
Sbjct: 179 SDVITEYLATDVCLPAVGQGALAVECRESDEELREWLQKLNDIDTERAVYAERAFLRQLE 238

Query: 242 GSCKSAIAGFAYCKG-STLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           G C+  IAG+A+    + +    +V + DGK  ++ + +G+  D  N+G  AA  +    
Sbjct: 239 GGCQVPIAGYAHVNNQNDIVLTALVASPDGKELYKETVSGS--DPENVGTTAADLLIKRG 296

Query: 301 NKNVFN 306
            K + +
Sbjct: 297 AKALID 302


>gi|288553611|ref|YP_003425546.1| porphobilinogen deaminase [Bacillus pseudofirmus OF4]
 gi|288544771|gb|ADC48654.1| porphobilinogen deaminase [Bacillus pseudofirmus OF4]
          Length = 310

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 116/306 (37%), Positives = 174/306 (56%), Gaps = 6/306 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            +   IG+R S LAL       + L    K  P+N  +  + TKGDRI + TL+++GGKG
Sbjct: 1   MRTIVIGSRRSNLALTQTDWVINQLKK--KEVPYNFEVKKIVTKGDRILDVTLSKVGGKG 58

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +EIE+ L + EID AVHS KD+P+ + +G  ++A   RED RD FIS     LKDL 
Sbjct: 59  LFVKEIEQALENKEIDIAVHSMKDVPSVMPEGFSLAAITEREDARDAFISLDHVKLKDLP 118

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK- 181
             +++GTSSLRR A LL  R D+ V   RG +ETRL KL      AI+LA AG+ RL   
Sbjct: 119 SGAIVGTSSLRRSAQLLAERPDLEVKWIRGNVETRLRKLKEEDFSAIILAAAGLNRLGYS 178

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E+++ E L  E   P+ GQGA+ +E   ++ +  EL++ +N E T  +V  ER FL +++
Sbjct: 179 EELVTEYLEPEMCVPAVGQGALGLECRSDDQEVIELIQKLNDEATALTVTAERTFLHKME 238

Query: 242 GSCKSAIAGFAYC-KGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           G C+  IAG+A   +   +    +V + DGK   + +  G   D + +G + ++ +    
Sbjct: 239 GGCQVPIAGYATMQEDGQVSLTALVGSPDGKTILKDTVVG--QDPVKVGEEVSERLLEKG 296

Query: 301 NKNVFN 306
            K + +
Sbjct: 297 AKEILD 302


>gi|59800604|ref|YP_207316.1| porphobilinogen deaminase [Neisseria gonorrhoeae FA 1090]
 gi|240013461|ref|ZP_04720374.1| porphobilinogen deaminase [Neisseria gonorrhoeae DGI18]
 gi|240117279|ref|ZP_04731341.1| porphobilinogen deaminase [Neisseria gonorrhoeae PID1]
 gi|240120532|ref|ZP_04733494.1| porphobilinogen deaminase [Neisseria gonorrhoeae PID24-1]
 gi|254493056|ref|ZP_05106227.1| porphobilinogen deaminase [Neisseria gonorrhoeae 1291]
 gi|260441191|ref|ZP_05795007.1| porphobilinogen deaminase [Neisseria gonorrhoeae DGI2]
 gi|268602974|ref|ZP_06137141.1| porphobilinogen deaminase [Neisseria gonorrhoeae PID1]
 gi|59717499|gb|AAW88904.1| putative porphobilinogen deaminase [Neisseria gonorrhoeae FA 1090]
 gi|226512096|gb|EEH61441.1| porphobilinogen deaminase [Neisseria gonorrhoeae 1291]
 gi|268587105|gb|EEZ51781.1| porphobilinogen deaminase [Neisseria gonorrhoeae PID1]
          Length = 311

 Score =  252 bits (644), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 106/305 (34%), Positives = 169/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K   I +R S LA+  A   +  L  ++  P   + I+ ++T+GDRI +RTL+++GG
Sbjct: 1   MNPKKLVIASRESLLAMWQAKHIQGRLKALY--PDCEVEILGMTTRGDRILDRTLSKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L  G  D AVHS KD+P  L +G  ++A   R +  D F+S+    L++
Sbjct: 59  KGLFVKELEQSLQDGRADLAVHSIKDVPMDLPEGFALAAISERANPFDAFVSNRYARLEE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           +   +V+GTSSLRR+A L      + +   RG ++TRL+KL+N +  AI+LA AG++RL+
Sbjct: 119 MPEGAVVGTSSLRREAQLRARYPHLVIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            ++ I+ IL+  D  P+ GQGA+ IE   +     E++K +NH+ T   V  ERA    L
Sbjct: 179 LDERIRMILSESDSLPAAGQGALGIEIATHREDLYEVLKPLNHDTTHACVTAERALARAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC+  +A +   +   L   G+V   DG I  +         A  +GR  A+ +    
Sbjct: 239 GGSCQVPLAAYCTEENGLLILRGLVGHPDGSIVLQADAQAPAGYADALGRAVAKKLADDG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AQELI 303


>gi|119503707|ref|ZP_01625789.1| porphobilinogen deaminase [marine gamma proteobacterium HTCC2080]
 gi|119460215|gb|EAW41308.1| porphobilinogen deaminase [marine gamma proteobacterium HTCC2080]
          Length = 302

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 107/306 (34%), Positives = 161/306 (52%), Gaps = 8/306 (2%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M K    I TR SPLAL  A      L  ++  P   + ++ ++++GD++ ++ L ++GG
Sbjct: 1   MSK--LVIATRESPLALWQANYVADRLRALY--PELMVELLGMTSRGDQLLDKPLYKVGG 56

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P  L  GL +     RED RD  +     +L +
Sbjct: 57  KGLFVKELETALLDGRADIAVHSMKDVPMALPPGLTLGVICEREDPRDALV--GISALSE 114

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +  GTSSLRR   + R R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 115 LEQGARFGTSSLRRACQIRRVRPDLEIGFLRGNVNTRLAKLDAGEFDAIILATAGLVRLG 174

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   +  E   P+ GQGA+ IE   ++ +  EL+  +N  DT + V  ERA +  L
Sbjct: 175 FESRIGARIEPEVSLPAGGQGAVGIEYRSDDDRVAELLAPLNDADTAECVTAERAVVRVL 234

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DG C   IA +A  +G+ L+   +V + DG+   E    G   +A  +G++ AQ +    
Sbjct: 235 DGGCDVPIASYAVKEGNELWLRALVGSVDGRSVLEAQSRG--ANAEELGQEVAQALLDGG 292

Query: 301 NKNVFN 306
              V  
Sbjct: 293 AAAVLE 298


>gi|168059289|ref|XP_001781636.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162666950|gb|EDQ53592.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 393

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 134/306 (43%), Positives = 187/306 (61%), Gaps = 4/306 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHN--IVIIPLSTKGDRITNRTLTEIGGKGL 63
            RIGTR SPLALA A++TR  L   H        + I+ + T GD+I ++ L +IGGKGL
Sbjct: 88  VRIGTRGSPLALAQAYQTRDKLKAAHPELAEEGALEIVIIKTTGDKILSQPLADIGGKGL 147

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT+EI+  L++G+ID AVHS KD+PT L +G  +   LPRED+RD FI     SL +L  
Sbjct: 148 FTKEIDDALLNGDIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICPNYSSLAELPE 207

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            SV+G++SLRR++ LL     + V++FRG ++TRL KL+     A LLA AG+KRL   +
Sbjct: 208 GSVVGSASLRRQSQLLHKYPHLKVVNFRGNVQTRLRKLSEGTVQATLLALAGLKRLDMTE 267

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            +  IL+ +D  P+  QGAI I     + K +E +  +NHEDT  +V CERAFLA+LDGS
Sbjct: 268 HVTTILDTDDMLPAIAQGAIGIACRTGDTKMEEYLSSLNHEDTRLAVACERAFLAKLDGS 327

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGN--RCDAINIGRDAAQYIRFISN 301
           C++ IAG A        F G+V  +DGK   E SR G+    D I + +DA Q +   + 
Sbjct: 328 CRTPIAGLAQRTDDGCSFRGLVATTDGKQVLETSRKGSFFYDDMIALAQDAGQELISRAG 387

Query: 302 KNVFNF 307
            + F +
Sbjct: 388 PDFFEW 393


>gi|298527685|ref|ZP_07015089.1| porphobilinogen deaminase [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298511337|gb|EFI35239.1| porphobilinogen deaminase [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 313

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 106/303 (34%), Positives = 161/303 (53%), Gaps = 2/303 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            K   I TR S LAL  A    S L + +      + ++ + T GD+I +  L ++GGKG
Sbjct: 1   MKKVVIATRGSKLALWQAEHISSRLRERYS--GLEVELLKVKTTGDKILDVPLAKVGGKG 58

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +EIE+ L+ G  D AVHS KDMP +L +GL++     RE   DV +S +   +  L 
Sbjct: 59  LFVKEIEEALMDGRADIAVHSMKDMPAELPRGLKLGIIPERESRFDVLLSTSYPDISSLP 118

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRR+A +L  R D+ +   RG ++TRL KL      AI++A AG+ RL   
Sbjct: 119 TGATVGTSSLRRQAQILHMRPDLEIQMLRGNLDTRLRKLKEGIYDAIIVAAAGMSRLNMH 178

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
                 L+   F P+ GQGA+ IE   +  +  EL+  ++   T   + CERAFLAEL+G
Sbjct: 179 ADYVTELSPPYFLPAVGQGALGIEYLQDRQELDELLGFMDDFSTRYCIECERAFLAELEG 238

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  IA +   +G+ +   G+V    G+     S +G   DA ++G D A+ +     +
Sbjct: 239 GCQVPIACYCRHEGNNIQATGLVCDLKGERMIRKSVSGKPKDARSLGVDMARQVLEAGGR 298

Query: 303 NVF 305
            + 
Sbjct: 299 EIL 301


>gi|254781037|ref|YP_003065450.1| porphobilinogen deaminase [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040714|gb|ACT57510.1| porphobilinogen deaminase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 307

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 307/307 (100%), Positives = 307/307 (100%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG
Sbjct: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD
Sbjct: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK
Sbjct: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL
Sbjct: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS
Sbjct: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300

Query: 301 NKNVFNF 307
           NKNVFNF
Sbjct: 301 NKNVFNF 307


>gi|194097777|ref|YP_002000818.1| porphobilinogen deaminase [Neisseria gonorrhoeae NCCP11945]
 gi|239998278|ref|ZP_04718202.1| porphobilinogen deaminase [Neisseria gonorrhoeae 35/02]
 gi|240015900|ref|ZP_04722440.1| porphobilinogen deaminase [Neisseria gonorrhoeae FA6140]
 gi|240080040|ref|ZP_04724583.1| porphobilinogen deaminase [Neisseria gonorrhoeae FA19]
 gi|240114994|ref|ZP_04729056.1| porphobilinogen deaminase [Neisseria gonorrhoeae PID18]
 gi|240122831|ref|ZP_04735787.1| porphobilinogen deaminase [Neisseria gonorrhoeae PID332]
 gi|240125027|ref|ZP_04737913.1| porphobilinogen deaminase [Neisseria gonorrhoeae SK-92-679]
 gi|240127540|ref|ZP_04740201.1| porphobilinogen deaminase [Neisseria gonorrhoeae SK-93-1035]
 gi|268600662|ref|ZP_06134829.1| porphobilinogen deaminase [Neisseria gonorrhoeae PID18]
 gi|268681446|ref|ZP_06148308.1| porphobilinogen deaminase [Neisseria gonorrhoeae PID332]
 gi|268683614|ref|ZP_06150476.1| porphobilinogen deaminase [Neisseria gonorrhoeae SK-92-679]
 gi|268685917|ref|ZP_06152779.1| porphobilinogen deaminase [Neisseria gonorrhoeae SK-93-1035]
 gi|193933067|gb|ACF28891.1| porphobilinogen deaminase [Neisseria gonorrhoeae NCCP11945]
 gi|268584793|gb|EEZ49469.1| porphobilinogen deaminase [Neisseria gonorrhoeae PID18]
 gi|268621730|gb|EEZ54130.1| porphobilinogen deaminase [Neisseria gonorrhoeae PID332]
 gi|268623898|gb|EEZ56298.1| porphobilinogen deaminase [Neisseria gonorrhoeae SK-92-679]
 gi|268626201|gb|EEZ58601.1| porphobilinogen deaminase [Neisseria gonorrhoeae SK-93-1035]
 gi|317163558|gb|ADV07099.1| porphobilinogen deaminase [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 311

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 106/305 (34%), Positives = 169/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K   I +R S LA+  A   +  L  ++  P   + I+ ++T+GDRI +RTL+++GG
Sbjct: 1   MNPKKLVIASRESLLAMWQAKHIQGRLKALY--PDCEVEILGMTTRGDRILDRTLSKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L  G  D AVHS KD+P  L +G  ++A   R +  D F+S+    L++
Sbjct: 59  KGLFVKELEQSLQDGRADLAVHSIKDVPMDLPEGFALAAISERANPFDAFVSNRYARLEE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           +   +V+GTSSLRR+A L      + +   RG ++TRL+KL+N +  AI+LA AG++RL+
Sbjct: 119 MPEGAVVGTSSLRREAQLRARYPHLLIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            ++ I+ IL+  D  P+ GQGA+ IE   +     E++K +NH+ T   V  ERA    L
Sbjct: 179 LDERIRMILSESDSLPAAGQGALGIEIATHREDLYEVLKPLNHDTTHACVTAERALARAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            GSC+  +A +   +   L   G+V   DG I  +         A  +GR  A+ +    
Sbjct: 239 GGSCQVPLAAYCTEENGLLILRGLVGHPDGSIVLQADAQAPAGYADALGRAVAKKLADDG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AQELI 303


>gi|197121772|ref|YP_002133723.1| porphobilinogen deaminase [Anaeromyxobacter sp. K]
 gi|220916566|ref|YP_002491870.1| porphobilinogen deaminase [Anaeromyxobacter dehalogenans 2CP-1]
 gi|196171621|gb|ACG72594.1| porphobilinogen deaminase [Anaeromyxobacter sp. K]
 gi|219954420|gb|ACL64804.1| porphobilinogen deaminase [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 314

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 101/300 (33%), Positives = 149/300 (49%), Gaps = 3/300 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLA   A      L D  + P   + +  L T+GD+I    L ++GGKGLF 
Sbjct: 2   IRIATRRSPLAKWQANHVSQLLRD--REPGLEVRLHELVTRGDKILEVPLADVGGKGLFV 59

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE  L++ + + AVHS KD+P  L  GL ++A   RED RD   S   ++L  L   +
Sbjct: 60  KEIEDALLNRDAEVAVHSMKDLPAVLAPGLVLAAVPQREDPRDALCSPRWKTLAALPKGA 119

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR A L   R D+ +   RG +ETRL K +     A++LAYAG++RL   +  
Sbjct: 120 RVGTSSLRRSAQLKALRPDLQMEMVRGNVETRLRKASEGL-DAVVLAYAGLRRLGLAEHA 178

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
             +   E+  P+  QGA+ +E   ++      +  +   DT   +  ER FLA ++G C+
Sbjct: 179 TYVFPPEEMLPAVAQGALALEARADDAPTLARLAALEDPDTRVRIEAERGFLARIEGGCQ 238

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             IAG A   G  +    +V + DG       R G   +A  +G   A  +       + 
Sbjct: 239 VPIAGHATLAGGKVTIRALVASLDGARVIRGERTGAYAEARAMGESLADELLSRGADQIL 298


>gi|115444475|ref|NP_001046017.1| Os02g0168800 [Oryza sativa Japonica Group]
 gi|75259105|sp|Q6H6D2|HEM3_ORYSJ RecName: Full=Porphobilinogen deaminase, chloroplastic; Short=PBG;
           AltName: Full=Hydroxymethylbilane synthase; Short=HMBS;
           AltName: Full=Pre-uroporphyrinogen synthase; Flags:
           Precursor
 gi|49388602|dbj|BAD25717.1| putative porphobilinogen deaminase [Oryza sativa Japonica Group]
 gi|113535548|dbj|BAF07931.1| Os02g0168800 [Oryza sativa Japonica Group]
 gi|222622259|gb|EEE56391.1| hypothetical protein OsJ_05540 [Oryza sativa Japonica Group]
          Length = 358

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 126/306 (41%), Positives = 180/306 (58%), Gaps = 5/306 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHN--IVIIPLSTKGDRITNRTLTEIGGKGL 63
            RIGTR SPLALA A ETR  L   H        + I+ + T GD I ++ L +IGGKGL
Sbjct: 50  IRIGTRGSPLALAQAHETRDKLKAAHSELAEEGAVEIVIIKTTGDMILDKPLADIGGKGL 109

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT+EI+  L+ G ID AVHS KD+PT L +G  +   LPRED+RD FI  TA SL +L  
Sbjct: 110 FTKEIDDALLQGRIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICLTASSLAELPA 169

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            SV+G++SLRR++ +L     + V++FRG ++TRL KL     HA LLA AG+KRL   +
Sbjct: 170 GSVVGSASLRRQSQILYKYPSLKVVNFRGNVQTRLRKLKEGDVHATLLALAGLKRLNMAE 229

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
               +L++++  P+  QGAI I    ++      +  +NHEDT  +V CER FL+ LDG+
Sbjct: 230 TATSVLSVDEMLPAVAQGAIGIACRSSDDTMMNYLSSLNHEDTRLAVACEREFLSVLDGN 289

Query: 244 CKSAIAGFA-YCKGSTLYFYGIVLASDGKIFHEVSRNGNRCD--AINIGRDAAQYIRFIS 300
           C++ IA +A   K     F G++ + DG   +E SR G       + +G+DA   ++  +
Sbjct: 290 CRTPIAAYASRDKDGNCSFRGLLASPDGSTVYETSRTGPYDFDIMVEMGKDAGHELKAKA 349

Query: 301 NKNVFN 306
               F+
Sbjct: 350 GPGFFD 355


>gi|313623622|gb|EFR93785.1| porphobilinogen deaminase [Listeria innocua FSL J1-023]
          Length = 309

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 117/307 (38%), Positives = 165/307 (53%), Gaps = 7/307 (2%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            K+   +G+R S LAL  +      L + +  P  +  I  + TKGDRI + TL+++GGK
Sbjct: 1   MKRKIIVGSRRSKLALTQSNWVIKKLKENY--PEIDFEIKEIVTKGDRILDVTLSKVGGK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF  E+E+ L    ID AVHS KD+P+ L  GL I A   RE   D F+ +   +L DL
Sbjct: 59  GLFVSEVEQALSDEVIDFAVHSMKDVPSSLKDGLVIGAIPKRESPLDCFVFNEVSTLDDL 118

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +VIGTSSLRR A LL+ R D  V   RG I+TRL KL+     AI+LA AG+ R+  
Sbjct: 119 PKGAVIGTSSLRRAAQLLKHRPDFVVKPIRGNIDTRLQKLHAENFDAIILAKAGLARMGW 178

Query: 182 EKVIK---EILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLA 238
            +      E ++ E   P+ GQGA+ IE    + +   ++  I+HE+T   V  ER FL 
Sbjct: 179 LENPSLKLEDISPELCLPAVGQGALAIECRETDLQICNMLASIHHEETGICVEAERVFLK 238

Query: 239 ELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRF 298
           +L+G C+  IAGFA   G +++F G+V  +DG I  E  R G       IG   A+ +  
Sbjct: 239 KLNGGCEIPIAGFATKTGDSVHFKGLVGNADGSIILESERTG--ASPAEIGNQVAEELLS 296

Query: 299 ISNKNVF 305
                + 
Sbjct: 297 EGADTII 303


>gi|291044525|ref|ZP_06570234.1| porphobilinogen deaminase [Neisseria gonorrhoeae DGI2]
 gi|293397661|ref|ZP_06641867.1| porphobilinogen deaminase [Neisseria gonorrhoeae F62]
 gi|291011419|gb|EFE03415.1| porphobilinogen deaminase [Neisseria gonorrhoeae DGI2]
 gi|291611607|gb|EFF40676.1| porphobilinogen deaminase [Neisseria gonorrhoeae F62]
          Length = 313

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 106/305 (34%), Positives = 169/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K   I +R S LA+  A   +  L  ++  P   + I+ ++T+GDRI +RTL+++GG
Sbjct: 3   MNPKKLVIASRESLLAMWQAKHIQGRLKALY--PDCEVEILGMTTRGDRILDRTLSKVGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L  G  D AVHS KD+P  L +G  ++A   R +  D F+S+    L++
Sbjct: 61  KGLFVKELEQSLQDGRADLAV