RPSBLAST alignment for GI: 254781037 and conserved domain: PLN02691

>gnl|CDD|178294 PLN02691, PLN02691, porphobilinogen deaminase. Length = 351
 Score =  280 bits (719), Expect = 2e-76
 Identities = 137/299 (45%), Positives = 187/299 (62%), Gaps = 5/299 (1%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVH--KIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            P RIGTR SPLALA A+ETR  L   H        + I+ + T GD+I ++ L +IGGK
Sbjct: 42  APIRIGTRGSPLALAQAYETRDLLKAAHPELAEEGALEIVIIKTTGDKILDQPLADIGGK 101

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLFT+EI+  L+SG ID AVHS KD+PT L +G  +   LPRED+RD FIS  A+SL +L
Sbjct: 102 GLFTKEIDDALLSGRIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFISLKAKSLAEL 161

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              SV+GT+SLRR++ +L     + V++FRG ++TRL KL      A LLA AG+KRL  
Sbjct: 162 PAGSVVGTASLRRQSQILHKYPHLKVVNFRGNVQTRLRKLQEGVVDATLLALAGLKRLDM 221

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
            +    IL+ ++  P+  QGAI I    ++ K  E +  +NHE+T  +V CERAFLA LD
Sbjct: 222 TEHATSILSTDEMLPAVAQGAIGIACRTDDDKMLEYLASLNHEETRLAVACERAFLAALD 281

Query: 242 GSCKSAIAGFAY-CKGSTLYFYGIVLASDGKIFHEVSRNGNRC--DAINIGRDAAQYIR 297
           GSC++ IAG+A   K     F G+V + DGK   E SR G     DA+ +G+DA + ++
Sbjct: 282 GSCRTPIAGYARRDKDGNCDFRGLVASPDGKQVLETSRKGPYVIDDAVAMGKDAGKELK 340