RPSBLAST alignment of GI: 254781037 and MMDB domain: 3ecr_A_242-364

>3ecr_A (A:242-364) Porphobilinogen deaminase; heme biosynthesis, porphobilinogen hinge, alternative splicing, cytoplasm, disease mutation, porphyrin biosynthesis; HET: DPM; 2.18A {Homo sapiens} PDB: 3eq1_A*Length = 123
 Score = 78.8 bits (194), Expect = 9e-16
 Identities = 17/76 (22%), Positives = 25/76 (32%)

Query: 222 NHEDTWDSVNCERAFLAELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGN 281
           +  +T      ERAFL  L+G C   +A     K   LY  G V + DG    + +    
Sbjct: 1   HDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQETMQAT 60

Query: 282 RCDAINIGRDAAQYIR 297
                          +
Sbjct: 61  IHVPAQHEDGPEDDPQ 76