RPSBLAST alignment of GI: 254781037 and protein with PDBid: 3ecr

>3ecr_A Porphobilinogen deaminase; heme biosynthesis, porphobilinogen hinge, alternative splicing, cytoplasm, disease mutation, porphyrin biosynthesis; HET: DPM; 2.18A {Homo sapiens} PDB: 3eq1_A* Length = 364
 Score =  199 bits (507), Expect = 6e-52
 Identities = 99/285 (34%), Positives = 144/285 (50%), Gaps = 6/285 (2%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
            + +  R+GTR S LA        ++L   +  P     II +ST GD+I +  L++IG 
Sbjct: 19  PKMRVIRVGTRKSQLARIQTDSVVATLKASY--PGLQFEIIAMSTTGDKILDTALSKIGE 76

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISH---TAQS 117
           K LFT+E+E  L   E+D  VHS KD+PT L  G  I A   RE+  D  + H     ++
Sbjct: 77  KSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKT 136

Query: 118 LKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKL-NNNKAHAILLAYAGI 176
           L+ L   SV+GTSSLRR A L R    +     RG + TRL KL    +  AI+LA AG+
Sbjct: 137 LETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGL 196

Query: 177 KRLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAF 236
           +R+     + +IL+ E+   + GQGA+ +E    +    +LV V++  +T      ERAF
Sbjct: 197 QRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAF 256

Query: 237 LAELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGN 281
           L  L+G C   +A     K   LY  G V + DG    + +    
Sbjct: 257 LRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQETMQAT 301