>cd03499 SQR_TypeC_SdhC Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase C (SdhC) subunit; composed of bacterial SdhC and eukaryotic large cytochrome b binding (CybL) proteins. SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. Members of this family reduce high potential quinones such as ubiquinone. SQR is also called succinate dehydrogenase or Complex II, and is part of the citric acid cycle and the aerobic respiratory chain. SQR is composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. Proteins in this subfamily are classified as Type C SQRs because they contain two transmembrane subunits and one heme group. The heme and quinone binding sites reside in the transmembrane subunits. The SdhC or CybL protein is one of the two transmembrane subunits of bacterial and eukaryotic SQRs. The two-electron oxidation of succinate in the flavoprotein a

Probab=100.00 E-value=1.1e-42 Score=252.52 Aligned_cols=117 Identities=35% Similarity=0.666 Sum_probs=114.8 Q ss_pred CCCCCCCCEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH Q ss_conf 89997735102666599999999999999999999999999985163035546753068316999999999999999998 Q gi|254781041|r 8 RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGG 87 (129) Q Consensus 8 RPlsphL~iyk~~~t~~~SI~HRitGi~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~yH~~nG 87 (129) T Consensus 1 RP~sPhL~iyk~~~ta~~SI~HRiSGv~l~~~~~~~~~~l~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~yH~~~G 80 (117) T cd03499 1 RPLSPHLTIYRPPLTAILSILHRITGVALFLGLPLLLWWLLASLSSPESFESVSALLGSWLGKLVLFGLTWALFYHLLNG 80 (117) T ss_pred CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99897433045169999999999999999999999999999980287789999999615799999999999999999866 Q ss_pred HHHHHHHCCHHCCHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999985212335899999999999999999999999 Q gi|254781041|r 88 IRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWI 124 (129) Q Consensus 88 iRHL~wD~g~g~~~~~~~~s~~~vl~~sil~~~~~~~ 124 (129) T Consensus 81 iRHL~wD~g~g~~~~~~~~s~~~v~~~s~~~t~~~~~ 117 (117) T cd03499 81 IRHLIWDLGKGLELKTVYKSGYAVLVLSVVLTVLLGI 117 (117) T ss_pred HHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHC T ss_conf 8999998113564999999999999999999999979

HHsearch alignment for GI: 254781041 and conserved domain: cd03499